| Basic Information | |
|---|---|
| Family ID | F036955 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 169 |
| Average Sequence Length | 52 residues |
| Representative Sequence | MNRKFAVTLASYAGLAILAFFTLDGKIRLATWIFLGAFALKTWLVVLKQRQD |
| Number of Associated Samples | 128 |
| Number of Associated Scaffolds | 169 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.33 % |
| % of genes near scaffold ends (potentially truncated) | 20.12 % |
| % of genes from short scaffolds (< 2000 bps) | 83.43 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.65 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.882 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere (10.651 % of family members) |
| Environment Ontology (ENVO) | Unclassified (53.846 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (61.538 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.50% β-sheet: 0.00% Coil/Unstructured: 42.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.65 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 169 Family Scaffolds |
|---|---|---|
| PF13103 | TonB_2 | 52.07 |
| PF04545 | Sigma70_r4 | 6.51 |
| PF04542 | Sigma70_r2 | 6.51 |
| PF03544 | TonB_C | 1.78 |
| PF00270 | DEAD | 1.78 |
| PF01242 | PTPS | 1.78 |
| PF13641 | Glyco_tranf_2_3 | 1.18 |
| PF13186 | SPASM | 0.59 |
| PF13307 | Helicase_C_2 | 0.59 |
| PF07494 | Reg_prop | 0.59 |
| PF02873 | MurB_C | 0.59 |
| PF12867 | DinB_2 | 0.59 |
| PF00133 | tRNA-synt_1 | 0.59 |
| PF10458 | Val_tRNA-synt_C | 0.59 |
| COG ID | Name | Functional Category | % Frequency in 169 Family Scaffolds |
|---|---|---|---|
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 6.51 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 6.51 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 6.51 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 6.51 |
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 1.78 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.78 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.59 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.59 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.59 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.59 |
| COG0812 | UDP-N-acetylenolpyruvoylglucosamine reductase | Cell wall/membrane/envelope biogenesis [M] | 0.59 |
| COG3292 | Periplasmic ligand-binding sensor domain | Signal transduction mechanisms [T] | 0.59 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.88 % |
| Unclassified | root | N/A | 20.12 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459019|G14TP7Y01DR1FF | Not Available | 694 | Open in IMG/M |
| 2228664022|INPgaii200_c0753129 | Not Available | 803 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100637739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2221 | Open in IMG/M |
| 3300000567|JGI12270J11330_10137948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 947 | Open in IMG/M |
| 3300004114|Ga0062593_100909953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 890 | Open in IMG/M |
| 3300004114|Ga0062593_101489382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 728 | Open in IMG/M |
| 3300004480|Ga0062592_101080445 | Not Available | 740 | Open in IMG/M |
| 3300005327|Ga0070658_11541907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 576 | Open in IMG/M |
| 3300005328|Ga0070676_10080235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1977 | Open in IMG/M |
| 3300005329|Ga0070683_100029146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 4994 | Open in IMG/M |
| 3300005329|Ga0070683_100124792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 2433 | Open in IMG/M |
| 3300005329|Ga0070683_100229052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1766 | Open in IMG/M |
| 3300005329|Ga0070683_101061161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 778 | Open in IMG/M |
| 3300005329|Ga0070683_101221955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 722 | Open in IMG/M |
| 3300005331|Ga0070670_100489991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1092 | Open in IMG/M |
| 3300005334|Ga0068869_100728048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 848 | Open in IMG/M |
| 3300005334|Ga0068869_101485801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 601 | Open in IMG/M |
| 3300005338|Ga0068868_101505918 | Not Available | 630 | Open in IMG/M |
| 3300005340|Ga0070689_100617511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 940 | Open in IMG/M |
| 3300005353|Ga0070669_101250209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 642 | Open in IMG/M |
| 3300005355|Ga0070671_100601862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 950 | Open in IMG/M |
| 3300005364|Ga0070673_100429237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1186 | Open in IMG/M |
| 3300005434|Ga0070709_10097486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1952 | Open in IMG/M |
| 3300005434|Ga0070709_10343472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1101 | Open in IMG/M |
| 3300005436|Ga0070713_100106148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2441 | Open in IMG/M |
| 3300005439|Ga0070711_100284313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1310 | Open in IMG/M |
| 3300005455|Ga0070663_100568005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 950 | Open in IMG/M |
| 3300005459|Ga0068867_100147636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1844 | Open in IMG/M |
| 3300005468|Ga0070707_101409908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 663 | Open in IMG/M |
| 3300005529|Ga0070741_10000146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 272174 | Open in IMG/M |
| 3300005534|Ga0070735_10004422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11867 | Open in IMG/M |
| 3300005538|Ga0070731_10107475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1848 | Open in IMG/M |
| 3300005541|Ga0070733_10756311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 652 | Open in IMG/M |
| 3300005542|Ga0070732_10221565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1131 | Open in IMG/M |
| 3300005542|Ga0070732_10677310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 627 | Open in IMG/M |
| 3300005563|Ga0068855_100006374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 14378 | Open in IMG/M |
| 3300005614|Ga0068856_100061233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3718 | Open in IMG/M |
| 3300005614|Ga0068856_101049148 | Not Available | 833 | Open in IMG/M |
| 3300005615|Ga0070702_100872025 | Not Available | 702 | Open in IMG/M |
| 3300005618|Ga0068864_100104029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2521 | Open in IMG/M |
| 3300005618|Ga0068864_100974488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 840 | Open in IMG/M |
| 3300005718|Ga0068866_10213267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1161 | Open in IMG/M |
| 3300005719|Ga0068861_101121595 | Not Available | 757 | Open in IMG/M |
| 3300005836|Ga0074470_11550324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 4339 | Open in IMG/M |
| 3300005841|Ga0068863_100415762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1317 | Open in IMG/M |
| 3300005843|Ga0068860_100487667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1229 | Open in IMG/M |
| 3300006059|Ga0075017_100137651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1730 | Open in IMG/M |
| 3300006163|Ga0070715_10065650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1607 | Open in IMG/M |
| 3300006173|Ga0070716_101134729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 625 | Open in IMG/M |
| 3300006237|Ga0097621_100029486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 4334 | Open in IMG/M |
| 3300006358|Ga0068871_100649461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 963 | Open in IMG/M |
| 3300006638|Ga0075522_10001385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 18349 | Open in IMG/M |
| 3300006755|Ga0079222_10668709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 813 | Open in IMG/M |
| 3300006755|Ga0079222_11725373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 602 | Open in IMG/M |
| 3300006797|Ga0066659_11218002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 628 | Open in IMG/M |
| 3300006806|Ga0079220_11411015 | Not Available | 591 | Open in IMG/M |
| 3300006847|Ga0075431_101817959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 565 | Open in IMG/M |
| 3300006904|Ga0075424_102769699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 511 | Open in IMG/M |
| 3300006954|Ga0079219_11022597 | Not Available | 689 | Open in IMG/M |
| 3300009093|Ga0105240_10945740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300009093|Ga0105240_11303979 | Not Available | 766 | Open in IMG/M |
| 3300009098|Ga0105245_10020668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 5772 | Open in IMG/M |
| 3300009098|Ga0105245_10539184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1188 | Open in IMG/M |
| 3300009098|Ga0105245_10780641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 992 | Open in IMG/M |
| 3300009098|Ga0105245_10831406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 963 | Open in IMG/M |
| 3300009098|Ga0105245_10932518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 911 | Open in IMG/M |
| 3300009098|Ga0105245_11261676 | Not Available | 787 | Open in IMG/M |
| 3300009100|Ga0075418_11091849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
| 3300009174|Ga0105241_10390276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1219 | Open in IMG/M |
| 3300009174|Ga0105241_11755724 | Not Available | 604 | Open in IMG/M |
| 3300009174|Ga0105241_12024581 | Not Available | 567 | Open in IMG/M |
| 3300009176|Ga0105242_10431847 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium | 1237 | Open in IMG/M |
| 3300009176|Ga0105242_10533970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1122 | Open in IMG/M |
| 3300009176|Ga0105242_10867106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 900 | Open in IMG/M |
| 3300009176|Ga0105242_11029437 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
| 3300009177|Ga0105248_11199684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 858 | Open in IMG/M |
| 3300009545|Ga0105237_12410263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 536 | Open in IMG/M |
| 3300009551|Ga0105238_11420875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300010359|Ga0126376_10120062 | All Organisms → cellular organisms → Bacteria | 2048 | Open in IMG/M |
| 3300010379|Ga0136449_100066581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7797 | Open in IMG/M |
| 3300010396|Ga0134126_13056478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 505 | Open in IMG/M |
| 3300010399|Ga0134127_11453266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 757 | Open in IMG/M |
| 3300010400|Ga0134122_10511503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1089 | Open in IMG/M |
| 3300010401|Ga0134121_12670001 | Not Available | 544 | Open in IMG/M |
| 3300012958|Ga0164299_11104935 | Not Available | 593 | Open in IMG/M |
| 3300012982|Ga0168317_1001639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 12105 | Open in IMG/M |
| 3300013100|Ga0157373_10746203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 719 | Open in IMG/M |
| 3300013100|Ga0157373_11466847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 520 | Open in IMG/M |
| 3300013104|Ga0157370_10033420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5016 | Open in IMG/M |
| 3300013105|Ga0157369_11675227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 646 | Open in IMG/M |
| 3300013297|Ga0157378_10646311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1073 | Open in IMG/M |
| 3300013307|Ga0157372_11500738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 776 | Open in IMG/M |
| 3300013307|Ga0157372_11860873 | Not Available | 692 | Open in IMG/M |
| 3300013308|Ga0157375_10793126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1096 | Open in IMG/M |
| 3300013308|Ga0157375_12061273 | Not Available | 678 | Open in IMG/M |
| 3300014166|Ga0134079_10114735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1046 | Open in IMG/M |
| 3300014325|Ga0163163_11136901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 844 | Open in IMG/M |
| 3300014326|Ga0157380_11791276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 673 | Open in IMG/M |
| 3300014969|Ga0157376_12229570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 587 | Open in IMG/M |
| 3300017939|Ga0187775_10405121 | Not Available | 565 | Open in IMG/M |
| 3300020579|Ga0210407_10579943 | Not Available | 875 | Open in IMG/M |
| 3300020580|Ga0210403_10055950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3157 | Open in IMG/M |
| 3300020580|Ga0210403_10600069 | Not Available | 889 | Open in IMG/M |
| 3300020583|Ga0210401_11430707 | Not Available | 549 | Open in IMG/M |
| 3300021168|Ga0210406_10407330 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1088 | Open in IMG/M |
| 3300021407|Ga0210383_10172464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1845 | Open in IMG/M |
| 3300021432|Ga0210384_10897563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
| 3300021474|Ga0210390_11152028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 628 | Open in IMG/M |
| 3300021559|Ga0210409_10686287 | Not Available | 895 | Open in IMG/M |
| 3300025862|Ga0209483_1036265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 2406 | Open in IMG/M |
| 3300025899|Ga0207642_10862810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300025899|Ga0207642_11106634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 512 | Open in IMG/M |
| 3300025906|Ga0207699_10314370 | Not Available | 1097 | Open in IMG/M |
| 3300025907|Ga0207645_10067984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 2278 | Open in IMG/M |
| 3300025909|Ga0207705_10816496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 723 | Open in IMG/M |
| 3300025911|Ga0207654_10078081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 1986 | Open in IMG/M |
| 3300025911|Ga0207654_10150485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1493 | Open in IMG/M |
| 3300025911|Ga0207654_11116729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300025911|Ga0207654_11187077 | Not Available | 556 | Open in IMG/M |
| 3300025912|Ga0207707_10225394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1631 | Open in IMG/M |
| 3300025913|Ga0207695_10003356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 22617 | Open in IMG/M |
| 3300025913|Ga0207695_11374869 | Not Available | 586 | Open in IMG/M |
| 3300025914|Ga0207671_10500174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 969 | Open in IMG/M |
| 3300025914|Ga0207671_10644086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 844 | Open in IMG/M |
| 3300025914|Ga0207671_11204698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 592 | Open in IMG/M |
| 3300025919|Ga0207657_10227098 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
| 3300025924|Ga0207694_10586618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
| 3300025924|Ga0207694_11899398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300025927|Ga0207687_10338002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 1223 | Open in IMG/M |
| 3300025927|Ga0207687_10837707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 785 | Open in IMG/M |
| 3300025934|Ga0207686_10012131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4734 | Open in IMG/M |
| 3300025934|Ga0207686_10112467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1839 | Open in IMG/M |
| 3300025934|Ga0207686_10641834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 839 | Open in IMG/M |
| 3300025935|Ga0207709_10158349 | All Organisms → cellular organisms → Bacteria | 1576 | Open in IMG/M |
| 3300025936|Ga0207670_10280770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1298 | Open in IMG/M |
| 3300025940|Ga0207691_10497155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1036 | Open in IMG/M |
| 3300025941|Ga0207711_11172524 | Not Available | 709 | Open in IMG/M |
| 3300025942|Ga0207689_10586777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
| 3300025981|Ga0207640_10509073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1004 | Open in IMG/M |
| 3300025981|Ga0207640_11419183 | Not Available | 622 | Open in IMG/M |
| 3300025986|Ga0207658_11430735 | Not Available | 632 | Open in IMG/M |
| 3300026035|Ga0207703_10465833 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium | 1182 | Open in IMG/M |
| 3300026078|Ga0207702_11595640 | Not Available | 646 | Open in IMG/M |
| 3300026118|Ga0207675_100649452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1061 | Open in IMG/M |
| 3300027775|Ga0209177_10034017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1357 | Open in IMG/M |
| 3300027842|Ga0209580_10163684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1097 | Open in IMG/M |
| 3300027854|Ga0209517_10001389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 36879 | Open in IMG/M |
| 3300027857|Ga0209166_10699478 | Not Available | 510 | Open in IMG/M |
| 3300027986|Ga0209168_10010193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 5664 | Open in IMG/M |
| 3300028381|Ga0268264_10489923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1197 | Open in IMG/M |
| 3300029636|Ga0222749_10307463 | Not Available | 821 | Open in IMG/M |
| 3300031057|Ga0170834_110503339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300031231|Ga0170824_105654164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 900 | Open in IMG/M |
| 3300031231|Ga0170824_125953821 | Not Available | 719 | Open in IMG/M |
| 3300031235|Ga0265330_10422048 | Not Available | 565 | Open in IMG/M |
| 3300031240|Ga0265320_10403506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 604 | Open in IMG/M |
| 3300031250|Ga0265331_10155753 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300031595|Ga0265313_10009464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 6325 | Open in IMG/M |
| 3300031716|Ga0310813_10980731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
| 3300031938|Ga0308175_100898042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 974 | Open in IMG/M |
| 3300031996|Ga0308176_10137353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 2217 | Open in IMG/M |
| 3300032160|Ga0311301_10357901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2276 | Open in IMG/M |
| 3300032174|Ga0307470_11961554 | Not Available | 500 | Open in IMG/M |
| 3300033412|Ga0310810_10014370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 9376 | Open in IMG/M |
| 3300033412|Ga0310810_10349264 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
| 3300033412|Ga0310810_10535408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1151 | Open in IMG/M |
| 3300033433|Ga0326726_10300859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1505 | Open in IMG/M |
| 3300033513|Ga0316628_101334821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 955 | Open in IMG/M |
| 3300033805|Ga0314864_0190899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 10.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 9.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.92% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.73% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.96% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.37% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.37% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.78% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.78% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.18% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.18% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.18% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.18% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.59% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.59% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.59% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.59% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.59% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.59% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.59% |
| Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.59% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.59% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012982 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4MG_02691120 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | MNRKFAAAMASFAGLAILAFFTLDGKIRLATWIFLGAFALKTWLVVLKARQS |
| INPgaii200_07531292 | 2228664022 | Soil | REALVPNINRKLATTLSAYAVLAILASFTLDGKIRLATWIFLGAFAFKTWLVVLKDRQD |
| INPhiseqgaiiFebDRAFT_1006377392 | 3300000364 | Soil | VPNINRKLATTLSAYAVLAILASFTLDGKIRLATWIFLGAFAFKTWLVVLKDRQD* |
| JGI12270J11330_101379482 | 3300000567 | Peatlands Soil | MNRKFAVTLATFAGLAILAYFTLDGKILLATWIFLGAFALKSWLVVLKQRQS* |
| Ga0062593_1009099531 | 3300004114 | Soil | MNRKFAAALAAFAGLAIMAYFTLDGPILLATWIFLGAFALKSWLVVLKQRQS* |
| Ga0062593_1014893822 | 3300004114 | Soil | MNRKLAATQATFAGLAILAYFTLDGKILLATWIFLGAFALKTWLVVLKQRQS* |
| Ga0062592_1010804452 | 3300004480 | Soil | MNRKFAIAVSTYAVLALLAFFTLDGTIRLATWIFLGAFAFKTWLVVLKDRQD* |
| Ga0070658_115419071 | 3300005327 | Corn Rhizosphere | MNRKFAVTLAAFAGLAALAYFTLDGKILLATWIFLGAFALKAWLVVLKERQS* |
| Ga0070676_100802352 | 3300005328 | Miscanthus Rhizosphere | VPNINRKLAITLSTYAVLAILASFTLDGKIRLATWIFLGAFAFKTWLVVLKDRQD* |
| Ga0070683_1000291465 | 3300005329 | Corn Rhizosphere | MNRKFAVAMATFAGLAILAYFTLDGKILLATWIFLGAFALKSWLVVLKQRQS* |
| Ga0070683_1001247923 | 3300005329 | Corn Rhizosphere | VPTINRKLAITLSTYAVLAILAFFTLDGTIRLATWIFLGAFAFKTWLVVLKDRQD* |
| Ga0070683_1002290522 | 3300005329 | Corn Rhizosphere | MNRKFAVALAAFAGLAILAYFTLDGKMLLATWIFLGAFALKSWLVVLKQRQS* |
| Ga0070683_1010611612 | 3300005329 | Corn Rhizosphere | MNRKFAGALTAFAVLAILAYFTLDGKMLLATWIFLGAFALKSWLVVLKQRQS* |
| Ga0070683_1012219551 | 3300005329 | Corn Rhizosphere | MTRKLAIAVSTYAVLAVLAYFTLDGKILLATWLFLGAFAFKTWLVVLKDRQD* |
| Ga0070670_1004899911 | 3300005331 | Switchgrass Rhizosphere | VPNINRKLAITLSTYAVLAILASFTLDGKIRLATWIFLGAFALKTWLVVLKQRQS* |
| Ga0068869_1007280482 | 3300005334 | Miscanthus Rhizosphere | MHRKLTVTLAIFAGLAILAYFTLDGKIRLATWIFLGAFALKTWLVVLKQRQS* |
| Ga0068869_1014858012 | 3300005334 | Miscanthus Rhizosphere | MNRKFAATMASFAGLAVLAFFTVDGKIRLATCIFLGAFALKTWLVVLKARQD* |
| Ga0068868_1015059182 | 3300005338 | Miscanthus Rhizosphere | TLMNRKFAVAMATFAGLAILAYFTLDGKILLATWIFLGAFALKSWLVVLKQRQS* |
| Ga0070689_1006175112 | 3300005340 | Switchgrass Rhizosphere | MNRKFAATMASFAGLAVLAFFTLDGKIRLATCIFLGAFALKTWLVVLKARQD* |
| Ga0070669_1012502091 | 3300005353 | Switchgrass Rhizosphere | MNRKLAATQATFAGLAILAYFTLDGKILLATWIFLGAFALKTWLVVLKERKS* |
| Ga0070671_1006018622 | 3300005355 | Switchgrass Rhizosphere | VPNINRKLAITLSTYAVLAILASFTLDGKIRLATWIFLGAFAFKTWLVV |
| Ga0070673_1004292372 | 3300005364 | Switchgrass Rhizosphere | VPNINRKLAITLSTYAVLAILASFTLDGKIRLATWIFLGAFAFKTWLVVLKNRQD* |
| Ga0070709_100974863 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRKLAVTLSSFGGLAILAFFTLDGKIRLATWIFLGAFALKTWLVVLKERQD* |
| Ga0070709_103434722 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRKFVVTLAAFAGLAILAYFTLDGKILLATWIFLGAFALKSWLVVLKQRQS* |
| Ga0070713_1001061483 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRKFAAALAAFAGLAILAYFTLDGKILLATWIFLGAFALKSWLVVLKQRQS* |
| Ga0070711_1002843132 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRKLAATLAVYAGLAILAAFTLDGKIRLATWIFLGAFAFKTWLVVLKERQG* |
| Ga0070663_1005680052 | 3300005455 | Corn Rhizosphere | VPINRKLAVTLSTYAALAILAFFTLDGKIRLATWIFLGAFALKTWLVVLKDRQD* |
| Ga0068867_1001476364 | 3300005459 | Miscanthus Rhizosphere | VPNINRKLAITMSTYAVLAILASFTLDGKIRLATWIFLGAFAFKTWLVVLKDRQD* |
| Ga0070707_1014099082 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VPNSKRKLAITLSTYAALAILASFTLDGRIRLATWIFLGAFAFKTWLVVLKDRQD* |
| Ga0070741_10000146110 | 3300005529 | Surface Soil | MNRKLAVALSNYSVLAILAFFTLDGKIRLATWIFLGAFALKTWLVVLKQRQG* |
| Ga0070735_100044228 | 3300005534 | Surface Soil | MNRKFAAALAAFAGLAILAYFTLDGKILLATWIFLGGLAVKAWLVVLKQRQS* |
| Ga0070731_101074752 | 3300005538 | Surface Soil | MNRKFAAALVAFAGLAILAYFTLDGKILLATWIFLGAFAFKSWLVVLKQRQS* |
| Ga0070733_107563112 | 3300005541 | Surface Soil | MNRKFTAALSIFTALGILAYFTLDGTILLATWIFLGAFALKSWLVVLKQRQS* |
| Ga0070732_102215652 | 3300005542 | Surface Soil | MNRKLAIALGSYAVLAMLAFFTLDGKIRVATWIFLGGFAIKTWLVVLKERQS* |
| Ga0070732_106773102 | 3300005542 | Surface Soil | MNRKLAVALASYAGLAILAFFTLDGKIRLATWIFLGAFAFKTWLVVLKERQS* |
| Ga0068855_10000637413 | 3300005563 | Corn Rhizosphere | MNRKFAAAMAAFAGLAILAFFTLDGKVLLATWIFLGAFALKSWLVVLKQRQS* |
| Ga0068856_1000612331 | 3300005614 | Corn Rhizosphere | MNRKFAAAMAAFAGLAILAFFTLDGKVLLATWIFLGAFALKSWLVVLKQR |
| Ga0068856_1010491481 | 3300005614 | Corn Rhizosphere | VPKINRKLAMTMSTYAVLAILASFTLDGKIRLATWIFLGAFAFKTWLVVLKDRQD* |
| Ga0070702_1008720251 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | KLTVTLAIFAGLAILAYFTLDGKIRLATWIFLGAFALKTWLVVLKQRQS* |
| Ga0068864_1001040293 | 3300005618 | Switchgrass Rhizosphere | VPNINRKLAITMSTYAVLAILAFFTLDGKIRLATWIFLGAFAFKTWLVVLKDRQD* |
| Ga0068864_1009744882 | 3300005618 | Switchgrass Rhizosphere | MHRKLTVTLAIFAGLAILAYFTLDGKIHLATWIFLGAFALKTWLVVLKE |
| Ga0068866_102132671 | 3300005718 | Miscanthus Rhizosphere | VQNFNRKLAITMSTYAVLAILASFTLEGKIRLATWIFLGAFAFKTWLVVLKDRQD* |
| Ga0068861_1011215952 | 3300005719 | Switchgrass Rhizosphere | CEALVSNSNRRLAITLSTYAALAILASFTLDGKIRLATWIFLGAFAFKTWLVVLKDRQD* |
| Ga0074470_115503242 | 3300005836 | Sediment (Intertidal) | MNRKFGAAMASFAGLAVLAFFTLDGKILLATWIFLGAFALKTWLVVLKLRRS* |
| Ga0068863_1004157622 | 3300005841 | Switchgrass Rhizosphere | VPNSNRRLAITLSTYAALAILASFTLDGKIRLATWIFLGAFAFKTWLVVLKDRQD* |
| Ga0068860_1004876672 | 3300005843 | Switchgrass Rhizosphere | MNRKFAATMASFAGLAVLAFFTLDGEIRLATCIFLGAFALKTWLVVLKARQD* |
| Ga0075017_1001376512 | 3300006059 | Watersheds | MNRKLAITLGIYVGLAILAFFTLDDKILLATWIFLGAFAFKTWLVVLKGRQD* |
| Ga0070715_100656503 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRKLIAALATYAGLAILAAFTLEGKIRLATWIFLGAFAFKTWLVVLKERQG* |
| Ga0070716_1011347292 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRKLAATLATFAGLAVLAFFTLDGKILLATWIFLGAFALKSWLVVLKQRQS* |
| Ga0097621_1000294863 | 3300006237 | Miscanthus Rhizosphere | MNRKFAAAMASFAGLAILAFFTLDGKIRLATWIFLGAFALKTWLVVLKARQN* |
| Ga0068871_1006494612 | 3300006358 | Miscanthus Rhizosphere | MNQKFAVTMGAFAALAILAYFTLDGKILLATWIFLGGFAIRAWLVVLKQRQS* |
| Ga0075522_1000138519 | 3300006638 | Arctic Peat Soil | MNRKFTATLASFAGLAILAYFTLDGNILLATWIFLAAFALKAWLVVLKERQS* |
| Ga0079222_106687092 | 3300006755 | Agricultural Soil | MSRKLRVTLASYAFLAILAFFTLDGKIRLATWIFLGAFALKTWLVVLKERQG* |
| Ga0079222_117253732 | 3300006755 | Agricultural Soil | MNRKLAVTLSSFGGLAILAFFTLDGKISLATWIFLGAFALKTWLVVLKERQD* |
| Ga0066659_112180022 | 3300006797 | Soil | MNRKFALATAIYAVLAILTFFTLDGKIRIATWLFLGAFAFKTWLVVLKQRQD* |
| Ga0079220_114110152 | 3300006806 | Agricultural Soil | MNRKLAVTLSSFGGLAILAFFTLDGKIRLATWIFLGAFTLKTWLVVLKERQD* |
| Ga0075431_1018179592 | 3300006847 | Populus Rhizosphere | MNRKFAAAVATYAALAILAFFTLEGKIRLATWIFLGAFAFKTWLVVLKQRQG* |
| Ga0075424_1027696992 | 3300006904 | Populus Rhizosphere | MNRKLAVTLASYAVLAILAFFTLDGKFRLGTLIFLGAFALKTWLVVL |
| Ga0079219_110225972 | 3300006954 | Agricultural Soil | RKLAVTLSSFGGLAILAFFTLDGKIRLATWIFLGAFALKTWLVVLKERQD* |
| Ga0105240_109457402 | 3300009093 | Corn Rhizosphere | MNRRFAVTLAAFAGLAILAYFTLDGKILLATWIFLGAFALKAWLVVLKERQS* |
| Ga0105240_113039792 | 3300009093 | Corn Rhizosphere | MNRKFAVALAAFAALAILAYFTLDGKILLATWIFLGAFALKSWLVVLKQRQS* |
| Ga0105245_100206685 | 3300009098 | Miscanthus Rhizosphere | MKRKFAVALSAFAGLAVLAYFTLDGKMLLATWIFLGAFAFKSWLVVLKQRQS* |
| Ga0105245_105391842 | 3300009098 | Miscanthus Rhizosphere | MNRKFAGALTAFAVLAILAYFTLEGKMLLATWIFLGAFALKSWLVVLKQRQS* |
| Ga0105245_107806412 | 3300009098 | Miscanthus Rhizosphere | MNRKFAAAMASFAGLAVLAFFTLDGKIRLATWIFLGAFALKTWLVVLKARQN* |
| Ga0105245_108314061 | 3300009098 | Miscanthus Rhizosphere | MNRKFAAALATFAGLAILAYFTLDGKILLATWIFLGAFALKSWLVVLKQRQS* |
| Ga0105245_109325181 | 3300009098 | Miscanthus Rhizosphere | NRKFAAAMASFAGLAVLAFFTLDGKIRLATCIFLGAFALKTWLVVLKARQD* |
| Ga0105245_112616761 | 3300009098 | Miscanthus Rhizosphere | TFAGLAILAYFTLDGKILLATWIFLGAFALKAWLVVLKQRQS* |
| Ga0075418_110918492 | 3300009100 | Populus Rhizosphere | MNRKFAAAVATYAALAVLAFFTLEGKIRLATWIFLGAFAFKTWLVVLKQRQG* |
| Ga0105241_103902762 | 3300009174 | Corn Rhizosphere | VPTINRKLAITLSTYAVLAILAFFTLDGTIRLATWIFLGAFAFKTWLVVLKNRQD* |
| Ga0105241_117557241 | 3300009174 | Corn Rhizosphere | MNRKFAVTLSAFTILAILAYFTLDGKILLATWIFLGAFALKAWLVVLKQRQS* |
| Ga0105241_120245811 | 3300009174 | Corn Rhizosphere | FAVALAAFAGLAILAYFTLDGKMLLATWIFLGAFALKSCLVVLKQRQS* |
| Ga0105242_104318471 | 3300009176 | Miscanthus Rhizosphere | ASYAGLAILATFTLDGKIRLATWIFLGAFAFKTLLVVLRERQG* |
| Ga0105242_105339701 | 3300009176 | Miscanthus Rhizosphere | VPNSNRKLAITLSTYAALAILASFTLDGKIRLATWIFLGAFAFKTWLVVLKDRQD* |
| Ga0105242_108671062 | 3300009176 | Miscanthus Rhizosphere | VPNINRKLAITLSTYAVLAILASFTLDGKIRLATWIFLGAFAFKTWLVVLK |
| Ga0105242_110294372 | 3300009176 | Miscanthus Rhizosphere | VPNFNSKLAITLSTYAVLAILAFFTLDGTIRLATWIFLGAFAFKTWLVVLKDRQD* |
| Ga0105248_111996842 | 3300009177 | Switchgrass Rhizosphere | VKSQEMNRKFAATMASFAGLALLAFFTLDGNIRIATLVFLGGFALKMWLVVLKSRMD* |
| Ga0105237_124102632 | 3300009545 | Corn Rhizosphere | MNRKFAVTLSAFAILAILAYFTLDGKILLATWIFLGAFALKAWLVVLKQRQS* |
| Ga0105238_114208752 | 3300009551 | Corn Rhizosphere | MNRKFAGALASYAVLAILAFFSLDGKMLLATWIFLGAFALKTWLVVLKQRQD* |
| Ga0126376_101200621 | 3300010359 | Tropical Forest Soil | MSRKLAGALGTYAGLAILAGFTLDGKIRLATWIFLGAFAFKTWLVVLKERQG* |
| Ga0136449_1000665814 | 3300010379 | Peatlands Soil | MNRKFAAALATFAALAILAYFTLDGKILLATWIFLGAFALKSWLVVLKQRQS* |
| Ga0134126_130564781 | 3300010396 | Terrestrial Soil | MNRRFAVTLAAFAGLAILAYFTLDGKILLATWIFLGAFALKSWLVVLKQRQS* |
| Ga0134127_114532661 | 3300010399 | Terrestrial Soil | MNGKFAVTLAAFAGLAALAYFTLDGKILLATWIFLGAFALKAWLVVLKERQS* |
| Ga0134122_105115031 | 3300010400 | Terrestrial Soil | VPNINRKLAITLSTFAVLAILAFFTLDGKIRLATWIFLGAFAFKTWLVVLKDRQD* |
| Ga0134121_126700011 | 3300010401 | Terrestrial Soil | ASFAGLAVLAFFTLEGKIRLATWIFLGAFALKTWLVVLKARQN* |
| Ga0164299_111049351 | 3300012958 | Soil | KLAVTLSSFGGLAILAFFTLDGKIRLATWIFLGAFALKTWLVVLKERQD* |
| Ga0168317_10016395 | 3300012982 | Weathered Mine Tailings | MNRRFAVTLAMFAGLATLAYFTLDGKILLATWIFLGAFALKAWLVVLKARQS* |
| Ga0157373_107462032 | 3300013100 | Corn Rhizosphere | MPNINRKLAITLSTYAVLAILASFTLDGKIRLATWIFLGAFAFKTWLVVLKNRQD* |
| Ga0157373_114668472 | 3300013100 | Corn Rhizosphere | MTRKLAIAVSTYAVLAVLAYFTLDGKILLATWLFLGAFAFKTWLVVLKD |
| Ga0157370_100334205 | 3300013104 | Corn Rhizosphere | MNRKFAAAMAAFAGLAILAFFTLDGKMLLATWIFLGAFALKSWLVVLKQRQS* |
| Ga0157369_116752271 | 3300013105 | Corn Rhizosphere | MNRRFAVTLAMFAGLAILAYFTLDGKILLATWIFLGAFALKAWLVVLKARQS* |
| Ga0157378_106463112 | 3300013297 | Miscanthus Rhizosphere | MNRKFAATMASFAGLAVLAFFTLDGKIRLATWIFLGAFALKTWLVVLKARQN* |
| Ga0157372_115007382 | 3300013307 | Corn Rhizosphere | MNRKFAATLAAFAGLAILAYFTLDGKILLATWIFLGAFALKSWLVVLKQRQS* |
| Ga0157372_118608732 | 3300013307 | Corn Rhizosphere | VTLAAFAGLAILAYFTLDGKILLATWIFLGAFALKAWLVVLKERQS* |
| Ga0157375_107931262 | 3300013308 | Miscanthus Rhizosphere | MDRKLTVTLAIFAGLAILAYFTLDGKIRLATWIFLGAFALKTWLVVLKQRQS* |
| Ga0157375_120612731 | 3300013308 | Miscanthus Rhizosphere | MPNINRKLAITLSTYAVLAILASFTLDGKIRLATWIFLGAFAFKTWLVVLKDRQD* |
| Ga0134079_101147351 | 3300014166 | Grasslands Soil | VPNSNRKLAITLSTYAALAILAFFTLDGKIRLATWIFLGAFAFKTWLVVLKERQD* |
| Ga0163163_111369011 | 3300014325 | Switchgrass Rhizosphere | VPNINRKLVITLSTYAVLAILAFFTLDGTIRLATWIFLGAFAFKTWLVVLKDRQD* |
| Ga0157380_117912762 | 3300014326 | Switchgrass Rhizosphere | MNRKFAATMASFAGLALLAFFTLDGKIRLATCIFLGAFALKTWLVVLKARQD* |
| Ga0157376_122295701 | 3300014969 | Miscanthus Rhizosphere | MNRKLAAALATYAGLAILAAFTLDGKIRLATWILLGGFAFKTWLVVLKERQG* |
| Ga0187775_104051212 | 3300017939 | Tropical Peatland | MNRKLAVTLASYAGLAILAFFTLEGRIRLATWIFLGAFALKTWLVVLKQRQD |
| Ga0210407_105799432 | 3300020579 | Soil | MNRKFAVTLASYAGLAILAFFTLDGKIRLATWIFLGAFALKTWLVVLKQRQD |
| Ga0210403_100559502 | 3300020580 | Soil | MNRKFAIALASYAGLAILAFFSLDGKIRLATWIFLGAFAFKTWLVVLKQRQD |
| Ga0210403_106000691 | 3300020580 | Soil | MNRKLAVTLASYAVLAILAFFTLDGKIRLATWIFLGAFALKTWLVVLKERQG |
| Ga0210401_114307072 | 3300020583 | Soil | MSRKLAVTLASYAGLAILAFFTLDGKIRLATWIFLGAFALKTGLVVLKERQG |
| Ga0210406_104073302 | 3300021168 | Soil | MNRKLRVTLTIYAGLAILAFFTLDGKIRLATWIFLGAFALKTWLVVLKERQG |
| Ga0210383_101724642 | 3300021407 | Soil | MNRKFAAALATFAGLGILAYFTLDGTILLATWIFLGAFALKSWLVVLKQRQS |
| Ga0210384_108975632 | 3300021432 | Soil | MNRKFAVTLASYAGLAILAFFTLDGKIRLATWIFLGAFAFKTWLVVLKQRQD |
| Ga0210390_111520281 | 3300021474 | Soil | MNRKLAITLASYAGLAILAFFSLDGKIRLATWIFLGAFALKTWLVVLKQRQD |
| Ga0210409_106862872 | 3300021559 | Soil | MNRKLAITLASYAGLAILAFFSLDGKIRLATWIFLGAFAFKTWLVVLKQRQD |
| Ga0209483_10362652 | 3300025862 | Arctic Peat Soil | MNRKFTATLASFAGLAILAYFTLDGNILLATWIFLAAFALKAWLVVLKERQS |
| Ga0207642_108628102 | 3300025899 | Miscanthus Rhizosphere | VPNFNSKLAITLSAYAVLAILAFFTLDGTIRLATWIFLGAFAFKTWLVVLKNRQD |
| Ga0207642_111066341 | 3300025899 | Miscanthus Rhizosphere | MNRKFAATMASFAGLAVLAFFTLDGKIRLATCIFLGAFALKTWLVVLKARQD |
| Ga0207699_103143702 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRRFAVTLAAFAGLAILAYFTLDGKILLATWIFLGAFALKAWLVVLKERQS |
| Ga0207645_100679842 | 3300025907 | Miscanthus Rhizosphere | VPNINRKLAITLSTYAVLAILASFTLDGKIRLATWIFLGAFAFKTWLVVLKDRQD |
| Ga0207705_108164961 | 3300025909 | Corn Rhizosphere | MNRKFAVTLAAFAGLAALAYFTLDGKILLATWIFLGAFALKAWLVVLKERQS |
| Ga0207654_100780813 | 3300025911 | Corn Rhizosphere | ITLSTYAVLAILASFTLDGKIRLATWIFLGAFAFKTWLVVLKNRQD |
| Ga0207654_101504852 | 3300025911 | Corn Rhizosphere | VPINRKLAVTLSTYAALAILAFFTLDGKIRLATWIFLGAFALKTWLVVLKDRQD |
| Ga0207654_111167291 | 3300025911 | Corn Rhizosphere | VPTINRKLAITLSTYAVLAILAFFTLDGTIRLATWIFLGAFAFKTWLVVL |
| Ga0207654_111870771 | 3300025911 | Corn Rhizosphere | FAVALAAFAGLAILAYFTLDGKMLLATWIFLGAFALKSWLVVLKQRQS |
| Ga0207707_102253942 | 3300025912 | Corn Rhizosphere | VPTINRKLAITLSTYAVLAILAFFTLDGTIRLATWIFLGAFAFKTWLVVLKDRQD |
| Ga0207695_1000335623 | 3300025913 | Corn Rhizosphere | MNRKFAAAMAAFAGLAILAFFTLDGKVLLATWIFLGAFALKSWLVVLKQRQS |
| Ga0207695_113748691 | 3300025913 | Corn Rhizosphere | AAFAALAILAYFTLDGKILLATWIFLGAFALKSWLVVLKQRQS |
| Ga0207671_105001741 | 3300025914 | Corn Rhizosphere | MNRKFAGALTAFAVLAILAYFTLDGKMLLATWIFLGAFALKSWLVVLKQRQS |
| Ga0207671_106440862 | 3300025914 | Corn Rhizosphere | MNRKFAVALAAFAALAILAYFTLDGKILLATWIFLGAFALKSWLVVLKQRQS |
| Ga0207671_112046981 | 3300025914 | Corn Rhizosphere | MNRKFAVTLSAFTILAILAYFTLDGKILLATWIFLGAFALKTWLVVLKERKS |
| Ga0207657_102270981 | 3300025919 | Corn Rhizosphere | VPTINRKLAITLSTYAVLAILAFFTLDGTIRLATWIFLGAFAFKTWLVVLKDRQY |
| Ga0207694_105866182 | 3300025924 | Corn Rhizosphere | MNRKFAAAMAAFAGLAILAFFTLDGKMLLATWIFLGAFALKSWLVVLKQRQS |
| Ga0207694_118993982 | 3300025924 | Corn Rhizosphere | MNRKLAATQATFAGLAILAYFTLDGKILLATWIFLGAFALKTWLVVLKERKS |
| Ga0207687_103380022 | 3300025927 | Miscanthus Rhizosphere | MNRKFAAAMASFAGLAVLAFFTLDGKIRLATWIFLGAFALKTWLVVLKARQN |
| Ga0207687_108377072 | 3300025927 | Miscanthus Rhizosphere | VPNSNRRLAITLSTYAALAILASFTLDGKIRLATWIFLGAFAFKTWLVVLKDRQD |
| Ga0207686_100121316 | 3300025934 | Miscanthus Rhizosphere | VPNFNSKLAITLSAYAVLAILAFFTLDGTIRLATWIFLGAFAFKTWLVVLKDRQD |
| Ga0207686_101124671 | 3300025934 | Miscanthus Rhizosphere | MASFAGLAVVAFFTLDGKIRLATCIFLGAFALKTWLVVLKARQD |
| Ga0207686_106418341 | 3300025934 | Miscanthus Rhizosphere | VPNINRKLAITMSTYAVLAILASFTLDGKIRLATWIFLGAFAFKTWLVVLKDRQD |
| Ga0207709_101583491 | 3300025935 | Miscanthus Rhizosphere | MDRKLTVTLAIFVGLAVLAYFTLDGKIRLATWIFLGAFAFKTWLVVLKDRQD |
| Ga0207670_102807702 | 3300025936 | Switchgrass Rhizosphere | MHRKLTVTLAIFAGLAILAYFTLDGKIRLATWIFLGAFALKTWLVVLKQRQS |
| Ga0207691_104971552 | 3300025940 | Miscanthus Rhizosphere | VPNINRKLAITLSTYAVLAILASFTLDGKIRLATLIFLGAFAFKTWLVVLKDRQD |
| Ga0207711_111725242 | 3300025941 | Switchgrass Rhizosphere | MNRKFAATMASFAGLALLAFFTLDGNIRIATLVFLGGFALKMWLVVLKSRMD |
| Ga0207689_105867772 | 3300025942 | Miscanthus Rhizosphere | MNRKFAATMASFAGLAVLAFFTVDGKIRLATCIFLGAFALKTWLVVLKARQD |
| Ga0207640_105090732 | 3300025981 | Corn Rhizosphere | MNRKFAVTLAAFAGLAALAYFTLDGKILLATWIFLGAFALKSWLVVLKQRQS |
| Ga0207640_114191832 | 3300025981 | Corn Rhizosphere | AITLSTYAVLAILASFTLDGKIRLATWIFLGAFAFKTWLVVLKDRQD |
| Ga0207658_114307351 | 3300025986 | Switchgrass Rhizosphere | ALMPNINRKLAITLSTYAVLAILASFTLDGKIRLATWIFLGAFAFKTWLVVLKDRQD |
| Ga0207703_104658332 | 3300026035 | Switchgrass Rhizosphere | GALTAFAVLAILAYFTLDGKMLLATWIFLGAFALKSWLVVLKQRQS |
| Ga0207702_115956401 | 3300026078 | Corn Rhizosphere | MNRKFAVAMATFAGLAILAYFTLDGKILLATWIFLGAFALKTWLVVLKQRQS |
| Ga0207675_1006494522 | 3300026118 | Switchgrass Rhizosphere | VSNSNRRLAITLSTYAALAILASFTLDGKIRLATWIFLGAFAFKTWLVVLKDRQD |
| Ga0209177_100340172 | 3300027775 | Agricultural Soil | MSRKLRVTLASYAFLAILAFFTLDGKIRLATWIFLGAFALKTWLVVLKERQG |
| Ga0209580_101636842 | 3300027842 | Surface Soil | MNRKLAIALGSYAVLAMLAFFTLDGKIRVATWIFLGGFAIKTWLVVLKERQS |
| Ga0209517_1000138913 | 3300027854 | Peatlands Soil | MNRKFAVTLATFAGLAILAYFTLDGKILLATWIFLGAFALKSWLVVLKQRQS |
| Ga0209166_106994781 | 3300027857 | Surface Soil | NRKLAVALASYAGLAILAFFTLDGKIRLATWIFLGAFAFKTWLVVLKERQS |
| Ga0209168_100101935 | 3300027986 | Surface Soil | MNRKFAAALAAFAGLAILAYFTLDGKILLATWIFLGGLAVKAWLVVLKQRQS |
| Ga0268264_104899232 | 3300028381 | Switchgrass Rhizosphere | MNRKFAATMASFAGLAVLAFFTLDGEIRLATCIFLGAFALKTWLVVLKARQD |
| Ga0222749_103074631 | 3300029636 | Soil | MNRKLAVTLASYLGLAILAFFTLDGKIRLATWIFLGAFAFKTWLVVLKQRQD |
| Ga0170834_1105033391 | 3300031057 | Forest Soil | MNRKFAAALAAFAGLAILAYFTLDGKMLLATWIFLGAFAFKSWLVVLKQRQS |
| Ga0170824_1056541641 | 3300031231 | Forest Soil | MNRKLAVTLASYAGLAILAFFTLDGKIRLATWIFLGAFALKTGLVVLKERQG |
| Ga0170824_1259538211 | 3300031231 | Forest Soil | MNRKFAVALATFAALAILAYFTLDGKILLATWIFLGAFALKSWLVVLKERQS |
| Ga0265330_104220481 | 3300031235 | Rhizosphere | MNRKFAVTLAAFAGLAILAYFTLDGKILLATWIFLGAFAVKSWLVVLKQRQS |
| Ga0265320_104035061 | 3300031240 | Rhizosphere | MNRKLAITLGIYVGLAILAFFTLDDKILLATWIFLGAFAFKTWLVVLKGRQD |
| Ga0265331_101557532 | 3300031250 | Rhizosphere | KFAVTLAAFAGLAILAYFTLDGKILLATWIFLGAFAVKSWLVVLKQRQS |
| Ga0265313_100094645 | 3300031595 | Rhizosphere | MNRKFAAALAAFAGLAIMAYFTLDGVLLLATWIFLGAFALKSWLVVLKQRQS |
| Ga0310813_109807311 | 3300031716 | Soil | MNRKLAVTLASYVGLAILAFFTLDGKIRLATWIFLGAFALKTWL |
| Ga0308175_1008980421 | 3300031938 | Soil | MIRRFAVTLAAFATLAVLAYFTLDGKILIATWIFLGAFALKAWLVVLKARKS |
| Ga0308176_101373532 | 3300031996 | Soil | MIRRFAVTLAAFATLAVLAYFTLDGKILVATWIFLGAFALKAWLVVLKARKS |
| Ga0311301_103579013 | 3300032160 | Peatlands Soil | MNRKFAAALATFAALAILAYFTLDGKILLATWIFLGAFALKSWLVVLKQRQS |
| Ga0307470_119615541 | 3300032174 | Hardwood Forest Soil | ALVPNINRKLAMTLSTYAVLAILASFTLDGKIRLATWIFLGAFAFKTWLVVLKDRQD |
| Ga0310810_100143706 | 3300033412 | Soil | MDQPKLNQKFAAAMASFAGLAVLAFFTLDGKIRLATWIFLGAFALKTWLVVLKARQN |
| Ga0310810_103492641 | 3300033412 | Soil | MNRKLAVTLASYVGLAILAFFTLDGKIRLATWIFLGAFALKTWLVVLKEHQS |
| Ga0310810_105354082 | 3300033412 | Soil | MHRKLTVALAIFAGLAILAYFTLDGKIRLATWIFLGAFALKSWLVVLKQRQS |
| Ga0326726_103008591 | 3300033433 | Peat Soil | MNRKFAVTLAAFAGLAILAYFTLDGKILLATWIFLGAFALKSWLVVLKQRKS |
| Ga0316628_1013348212 | 3300033513 | Soil | MNRRFAVTLAMFAGLATLAYFTLDGKILLATWIFLGAFALKAWLVVLKARQS |
| Ga0314864_0190899_306_464 | 3300033805 | Peatland | MNRKFAVALATFAGLAILAYFTLDGKILLATWIFLGAFALKSWLVVLKQRQS |
| ⦗Top⦘ |