| Basic Information | |
|---|---|
| Family ID | F036936 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 169 |
| Average Sequence Length | 45 residues |
| Representative Sequence | LHTALYYCPGADLYGKTPKGKFTSQRDAQLDQFEPAYRKACD |
| Number of Associated Samples | 150 |
| Number of Associated Scaffolds | 169 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 93.49 % |
| % of genes from short scaffolds (< 2000 bps) | 86.98 % |
| Associated GOLD sequencing projects | 142 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.083 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.018 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.036 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.805 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.43% β-sheet: 7.14% Coil/Unstructured: 81.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 169 Family Scaffolds |
|---|---|---|
| PF00196 | GerE | 20.71 |
| PF13240 | zinc_ribbon_2 | 1.78 |
| PF01925 | TauE | 0.59 |
| PF01522 | Polysacc_deac_1 | 0.59 |
| PF08238 | Sel1 | 0.59 |
| PF00535 | Glycos_transf_2 | 0.59 |
| PF12773 | DZR | 0.59 |
| PF13248 | zf-ribbon_3 | 0.59 |
| PF13439 | Glyco_transf_4 | 0.59 |
| PF01850 | PIN | 0.59 |
| COG ID | Name | Functional Category | % Frequency in 169 Family Scaffolds |
|---|---|---|---|
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.59 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.59 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.08 % |
| Unclassified | root | N/A | 5.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001471|JGI12712J15308_10198716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300001593|JGI12635J15846_10608839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300001686|C688J18823_10688648 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300001867|JGI12627J18819_10220920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100799751 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101020321 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300003368|JGI26340J50214_10176820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300004080|Ga0062385_10368041 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300004102|Ga0058888_1431563 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300004104|Ga0058891_1442459 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300005187|Ga0066675_10238269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1295 | Open in IMG/M |
| 3300005434|Ga0070709_10013954 | All Organisms → cellular organisms → Bacteria | 4531 | Open in IMG/M |
| 3300005468|Ga0070707_100113275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2632 | Open in IMG/M |
| 3300005530|Ga0070679_101654908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300005535|Ga0070684_100096832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2631 | Open in IMG/M |
| 3300005561|Ga0066699_10217136 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
| 3300005568|Ga0066703_10863383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300005569|Ga0066705_10387514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
| 3300005712|Ga0070764_10125942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1390 | Open in IMG/M |
| 3300005921|Ga0070766_10550507 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300005952|Ga0080026_10062540 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300006041|Ga0075023_100474391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300006052|Ga0075029_100671962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300006055|Ga0097691_1192560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300006086|Ga0075019_11064936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300006102|Ga0075015_100830728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300006162|Ga0075030_101148355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300006162|Ga0075030_101318926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300006163|Ga0070715_11031017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300006172|Ga0075018_10772166 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300006173|Ga0070716_100605128 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300006174|Ga0075014_100975586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300006176|Ga0070765_100929307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 822 | Open in IMG/M |
| 3300006893|Ga0073928_10426422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 965 | Open in IMG/M |
| 3300006893|Ga0073928_11244567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300009038|Ga0099829_10110991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2147 | Open in IMG/M |
| 3300009038|Ga0099829_11113157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300009524|Ga0116225_1435959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300009552|Ga0116138_1087906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 866 | Open in IMG/M |
| 3300009665|Ga0116135_1381913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300009672|Ga0116215_1332831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
| 3300009683|Ga0116224_10508360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300010048|Ga0126373_12019022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300010159|Ga0099796_10235191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 756 | Open in IMG/M |
| 3300010341|Ga0074045_11035556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300010358|Ga0126370_11607972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300010360|Ga0126372_11465801 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300010376|Ga0126381_101498123 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300010379|Ga0136449_100883682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1460 | Open in IMG/M |
| 3300010398|Ga0126383_12736549 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300010937|Ga0137776_1140317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300010937|Ga0137776_1497536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300011086|Ga0138564_1021852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
| 3300011120|Ga0150983_16395694 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300011270|Ga0137391_11100849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300011271|Ga0137393_10243584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1525 | Open in IMG/M |
| 3300012096|Ga0137389_10624322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 926 | Open in IMG/M |
| 3300012357|Ga0137384_10900886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 713 | Open in IMG/M |
| 3300012683|Ga0137398_11051702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300012927|Ga0137416_10427165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1128 | Open in IMG/M |
| 3300012957|Ga0164303_10858049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300012971|Ga0126369_13421264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300012985|Ga0164308_10603416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 934 | Open in IMG/M |
| 3300014658|Ga0181519_10299010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1000 | Open in IMG/M |
| 3300014968|Ga0157379_12212301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300015374|Ga0132255_103206973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 697 | Open in IMG/M |
| 3300016371|Ga0182034_10771294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
| 3300016750|Ga0181505_10604620 | All Organisms → cellular organisms → Bacteria | 2641 | Open in IMG/M |
| 3300017823|Ga0187818_10043995 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1918 | Open in IMG/M |
| 3300017823|Ga0187818_10409476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300017823|Ga0187818_10446363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300017933|Ga0187801_10276871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| 3300017948|Ga0187847_10449036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 712 | Open in IMG/M |
| 3300017955|Ga0187817_10013913 | All Organisms → cellular organisms → Bacteria | 4679 | Open in IMG/M |
| 3300017955|Ga0187817_10184141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1330 | Open in IMG/M |
| 3300017972|Ga0187781_11269943 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300017973|Ga0187780_10225100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1311 | Open in IMG/M |
| 3300017975|Ga0187782_11206937 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300018007|Ga0187805_10116669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1210 | Open in IMG/M |
| 3300018009|Ga0187884_10261180 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300018034|Ga0187863_10841064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300018047|Ga0187859_10172612 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300018060|Ga0187765_10940825 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300018086|Ga0187769_10981696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300018088|Ga0187771_11198933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300018088|Ga0187771_11569666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300019275|Ga0187798_1615910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2174 | Open in IMG/M |
| 3300019278|Ga0187800_1093664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300020579|Ga0210407_10541712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 909 | Open in IMG/M |
| 3300020580|Ga0210403_10378821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1157 | Open in IMG/M |
| 3300020581|Ga0210399_10518319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 990 | Open in IMG/M |
| 3300021180|Ga0210396_10322837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1364 | Open in IMG/M |
| 3300021401|Ga0210393_10791308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 772 | Open in IMG/M |
| 3300021402|Ga0210385_11509863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300021406|Ga0210386_11571007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300021433|Ga0210391_11533428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300021475|Ga0210392_10487328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
| 3300022505|Ga0242647_1019410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300022506|Ga0242648_1006258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1222 | Open in IMG/M |
| 3300022510|Ga0242652_1003538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1250 | Open in IMG/M |
| 3300022527|Ga0242664_1041912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 810 | Open in IMG/M |
| 3300022533|Ga0242662_10078227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 908 | Open in IMG/M |
| 3300022533|Ga0242662_10095694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 840 | Open in IMG/M |
| 3300022721|Ga0242666_1172862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300022722|Ga0242657_1070854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 808 | Open in IMG/M |
| 3300022873|Ga0224550_1044952 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300025906|Ga0207699_10159773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1499 | Open in IMG/M |
| 3300025922|Ga0207646_10610264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 979 | Open in IMG/M |
| 3300025929|Ga0207664_11844590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300026214|Ga0209838_1058923 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300026217|Ga0209871_1036704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 923 | Open in IMG/M |
| 3300026322|Ga0209687_1248664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300026325|Ga0209152_10234458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300026333|Ga0209158_1231768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300026529|Ga0209806_1335276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300026869|Ga0207821_1026441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300027567|Ga0209115_1060006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 867 | Open in IMG/M |
| 3300027605|Ga0209329_1130464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300027681|Ga0208991_1007891 | All Organisms → cellular organisms → Bacteria | 3181 | Open in IMG/M |
| 3300027824|Ga0209040_10240732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 913 | Open in IMG/M |
| 3300027842|Ga0209580_10115251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1308 | Open in IMG/M |
| 3300027842|Ga0209580_10420632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
| 3300027857|Ga0209166_10371853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
| 3300027862|Ga0209701_10174396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1298 | Open in IMG/M |
| 3300027874|Ga0209465_10414929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300027879|Ga0209169_10151500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1208 | Open in IMG/M |
| 3300027895|Ga0209624_10639699 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300027895|Ga0209624_10832773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300027903|Ga0209488_10785991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
| 3300028536|Ga0137415_10142612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2235 | Open in IMG/M |
| 3300028673|Ga0257175_1119332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300028906|Ga0308309_11286736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300030007|Ga0311338_11336678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300030399|Ga0311353_10395856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1244 | Open in IMG/M |
| 3300030399|Ga0311353_10534383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1034 | Open in IMG/M |
| 3300030494|Ga0310037_10429697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300030580|Ga0311355_10258543 | All Organisms → cellular organisms → Bacteria | 1777 | Open in IMG/M |
| 3300030707|Ga0310038_10040484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2699 | Open in IMG/M |
| 3300030730|Ga0307482_1089556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 824 | Open in IMG/M |
| 3300030740|Ga0265460_10010450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2109 | Open in IMG/M |
| 3300031057|Ga0170834_101870712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1087 | Open in IMG/M |
| 3300031090|Ga0265760_10246467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300031231|Ga0170824_116949737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1286 | Open in IMG/M |
| 3300031231|Ga0170824_120638708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1046 | Open in IMG/M |
| 3300031469|Ga0170819_13686199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
| 3300031525|Ga0302326_10011454 | All Organisms → cellular organisms → Bacteria | 19097 | Open in IMG/M |
| 3300031708|Ga0310686_107740624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1642 | Open in IMG/M |
| 3300031938|Ga0308175_100363391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1500 | Open in IMG/M |
| 3300031946|Ga0310910_11024434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300031962|Ga0307479_10478803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1229 | Open in IMG/M |
| 3300031962|Ga0307479_10569459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1115 | Open in IMG/M |
| 3300031962|Ga0307479_10695403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 996 | Open in IMG/M |
| 3300032059|Ga0318533_10883093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300032160|Ga0311301_11064796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1058 | Open in IMG/M |
| 3300032180|Ga0307471_102728434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300032783|Ga0335079_11128110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
| 3300032805|Ga0335078_10757775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1192 | Open in IMG/M |
| 3300032829|Ga0335070_11325735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300033806|Ga0314865_022325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1591 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.02% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.69% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.10% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.33% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.73% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.73% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.14% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.55% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.96% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.96% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.37% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.37% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.78% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.78% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.18% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 1.18% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.18% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.18% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.18% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.18% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.59% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.59% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.59% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.59% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.59% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.59% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.59% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004102 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF212 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011086 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 49 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300022505 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU2 | Host-Associated | Open in IMG/M |
| 3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
| 3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026869 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 53 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033806 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12712J15308_101987161 | 3300001471 | Forest Soil | APQDKGNPYTQVWVDLHTALYYCPGADLYGKTPKGRYANQRDAQLDQFEPAYRKNCD* |
| JGI12635J15846_106088391 | 3300001593 | Forest Soil | VWVDLHTALYYCPGSDLYGKTPKGKTTSQRDAQLDQFEPAYRKACD* |
| C688J18823_106886482 | 3300001686 | Soil | QDKGNPSAAVWVDLQTGLYYCSGTDLYGKTPRGKYTGQRDAQLDRFEPAYRQPCK* |
| JGI12627J18819_102209202 | 3300001867 | Forest Soil | TALYYCPGTDLYGKTTQGKFTTQREAQLDQFEPAYRKACN* |
| JGIcombinedJ26739_1007997511 | 3300002245 | Forest Soil | YYCPGTDLYGKTPKGKFATQRDAQLDQFEPAYRKACD* |
| JGIcombinedJ26739_1010203211 | 3300002245 | Forest Soil | YYCPGTDLYGKTPKGKFTSQREAQLDQFEPAYRKACD* |
| JGI26340J50214_101768202 | 3300003368 | Bog Forest Soil | VWVDLQTALYYCPGADLYGKTPKGKYSSQRDAQLDSFEPAMRKACK* |
| Ga0062385_103680411 | 3300004080 | Bog Forest Soil | TALYYCPGTDLYGKSPKGKFETQRDAQLDQFEPANRKVCD* |
| Ga0058888_14315632 | 3300004102 | Forest Soil | QVWVDLHTALYYCPGTDLYGKTAKGKFATQRDAQLDQFEPAYRKACD* |
| Ga0058891_14424591 | 3300004104 | Forest Soil | VDTRTALYYCPGADLYGKTPKGKFASQRDAQLDQYEPAYRKACD* |
| Ga0062388_1029615571 | 3300004635 | Bog Forest Soil | HTALYYCAGSELYGKTQGGKFTTQRDAQMDQFEPAARKTCE* |
| Ga0066675_102382691 | 3300005187 | Soil | VPEDKGNPSTAVWVDLQTGLYYCPNADPYGKTPKGKYTSQRDAQLDQFAPAYRKVCD* |
| Ga0070709_100139541 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | GNPDAQVWIDLHTALYYCPGADLYGKTPKGRFASQRSAQLDQFEPAYRKACD* |
| Ga0070707_1001132753 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | NPETQVWVDLHTALYYCPGADLYGKTPKGKFTTQRDAQLDQFEPAYRRACD* |
| Ga0070679_1016549081 | 3300005530 | Corn Rhizosphere | VWVDLQTGLYYCPNADTYGKTPKGKYTSQRDAQLDQFAPAYRKVCD* |
| Ga0070684_1000968324 | 3300005535 | Corn Rhizosphere | STAVWVDLQTGLYYCPNADTYGKTPKGKYTSQRDAQLDQFAPAYRKVCN* |
| Ga0066699_102171361 | 3300005561 | Soil | APQYLGNPDVKVWVDLQTALYYCPGTDLYGSTPKGKYTTQGDAQQDQFEPAYRKPCD* |
| Ga0066703_108633832 | 3300005568 | Soil | EQRGNPETKVWVDTHTALYYCPGTDLYGKTPQGKYTTQRDAQLDQFEPAYRKACN* |
| Ga0066705_103875142 | 3300005569 | Soil | TAVWVDLQTGLYYCPNADPYGKTPKGKYTSQRDAQLDQFAPAYRKVCD* |
| Ga0070764_101259422 | 3300005712 | Soil | DAEVWVDLHTALYYCAGDDLYNRTPKGKFTTQRDAQLDRYEPAYRKACD* |
| Ga0070766_105505071 | 3300005921 | Soil | LYYCPGSDLYGKTPKGKLSSQREAQLDQFEPAYRKPCD* |
| Ga0080026_100625401 | 3300005952 | Permafrost Soil | GNPDAQVWVDLHTALYYCPGADLYGKTPKGRITTQRSAQLDQFEPAYRKACD* |
| Ga0075023_1004743912 | 3300006041 | Watersheds | PALTYQGNPNAKVWVDLQTAIYYCSGTDLYGKTPKGKYTTQQDAQRDQFEPAYRRPCQ* |
| Ga0075029_1006719622 | 3300006052 | Watersheds | HTALYYCPGADLYGKTPKGKVTSQRDAQLDQFQPAARKACD* |
| Ga0097691_11925601 | 3300006055 | Arctic Peat Soil | ENKGNPETQVWVDLHTALYYCPGTDLYGKTPKGKFTSQRDAQLDQFEPAYRRACD* |
| Ga0075019_110649362 | 3300006086 | Watersheds | PATQVWVDLHTALYYCPLDDLYGKTPKGKFTSQRDAQLDQFEPAYRKTCD* |
| Ga0075015_1008307281 | 3300006102 | Watersheds | YCPGTDLYGRTPKGKFTSQKDAQLDQFEPAYRKACD* |
| Ga0075030_1011483551 | 3300006162 | Watersheds | YKGNPNTQVWVDAQTALYYCPGADLYGKTPKGTYRSQRDAQLDSYEPAYRKPCD* |
| Ga0075030_1013189262 | 3300006162 | Watersheds | TEVWVDLQTALYYCPGADLYGKTPKGRFSTQRDAQLDQFEPAYRKACN* |
| Ga0070715_110310171 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VWVDLQTGLYYCPNADLYGHTPKGKFTTQRDAQLDQFEPGYRKTCE* |
| Ga0075018_107721661 | 3300006172 | Watersheds | NPSIQVWVDLHTALYYCPGSDLYGKTPKGKYEAQRDAELDQFQAAYRKPCE* |
| Ga0070716_1006051282 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | DPNVKVWVDLQSALYYCPSADLYGKTSKGKFTTQGDAQLDQFEPALRRPCD* |
| Ga0075014_1009755862 | 3300006174 | Watersheds | YYCPGTDLYGKTPQGKFTTQREAQLDQFEPAYRKACN* |
| Ga0070765_1009293071 | 3300006176 | Soil | DLHTALYYCPGADLYGKTPKGRFASQREAQLDQFEPAYRKACD* |
| Ga0073928_104264221 | 3300006893 | Iron-Sulfur Acid Spring | CPDSELYGKTPKGKFASQQDAQLDQFEPASRRACN* |
| Ga0073928_112445672 | 3300006893 | Iron-Sulfur Acid Spring | ALYYCPGADLYGKTPKGRFSSQRAARLDQFEPAYRKACD* |
| Ga0099829_101109913 | 3300009038 | Vadose Zone Soil | ALYYCPGSDLYGKTEKGRLTSQRSAQLDQFEPAYRKACD* |
| Ga0099829_111131571 | 3300009038 | Vadose Zone Soil | HSALYYCPGSDLYGKTEKGKMTSQRSAQLDQFEPAYRKACN* |
| Ga0116225_14359592 | 3300009524 | Peatlands Soil | DLHTALYYCPGSELYGKTPKGKFASQRDAQLDQFEPASRKACD* |
| Ga0116138_10879062 | 3300009552 | Peatland | HTALYYCPGADLYGKTAKGKFVSQRDAQLDQFEPAYRKACD* |
| Ga0116135_13819132 | 3300009665 | Peatland | LYYCPGADLYGKTAKGKFASQRDAQLDQFEPAYRKACD* |
| Ga0116215_13328311 | 3300009672 | Peatlands Soil | QVWEDLHTALYYCPGSDLYGKTPKGKFTSQRSAQLDQFEPAYRKACD* |
| Ga0116224_105083601 | 3300009683 | Peatlands Soil | QVWVDLHTALYYCPGADLYGKTPKGKFTSQRDAQLDQFEPAYRKTCD* |
| Ga0126373_120190221 | 3300010048 | Tropical Forest Soil | VWVDLHTALYYCPGSDSYGKTQKGKFMTQRDAQLDSYEPAYRKTCN* |
| Ga0099796_102351912 | 3300010159 | Vadose Zone Soil | DSQVWIDLHTALYYCPGSDLYDKTPKGRLSSQRDAQLDQFEPANRKPCD* |
| Ga0074045_110355561 | 3300010341 | Bog Forest Soil | PAEYKGNPETEVWIDLRTALYYCPGTDLYGKTPKGKFETQRDAQLDQFEPAYRKACD* |
| Ga0126370_116079722 | 3300010358 | Tropical Forest Soil | DTQVWIDLHTALYYCPGTDLYGKTPKGRYATQRSAQLDQFEPAYRKACD* |
| Ga0126372_114658011 | 3300010360 | Tropical Forest Soil | PEDKGNPATEVWVDLRSGLYYCPSTDLYGKTPKGKYTTQRDAQLDQFQPAYRKACD* |
| Ga0126381_1014981231 | 3300010376 | Tropical Forest Soil | VDLSTALYYCQGSEFYGKTPKGKFTSQQDAQQDQFEPAGRKPCD* |
| Ga0136449_1008836821 | 3300010379 | Peatlands Soil | VWIDLHTALYYCPGSELYGKTPKGKFASQRDAQLDQFEPASRKACD* |
| Ga0126383_127365491 | 3300010398 | Tropical Forest Soil | LAEAPQQTTTYTGNPEVKVWVDLRTALYYCPGADLYGRTPKGKYMTQREAQLDQFEAASR |
| Ga0137776_11403172 | 3300010937 | Sediment | LHTALYYCPGADLYGKTPKGKFTSQRDAQLDQFEPAYRKACD* |
| Ga0137776_14975361 | 3300010937 | Sediment | TALYYCPGSDSYGKTQKGKFMTQRDAQLDSYEPAYRKTGN* |
| Ga0138564_10218522 | 3300011086 | Peatlands Soil | SDSDLYGKTPGGKFTTQRDAQLDQFEPAARKNCD* |
| Ga0150983_163956941 | 3300011120 | Forest Soil | QVWVDLHTGLYYCQNTDLYGKTPKGKYETQKDAQLDQFESASRKPCP* |
| Ga0137391_111008492 | 3300011270 | Vadose Zone Soil | HTALYYCPGTDLYGKTPKGKYTTQRDAQLDQFEPAYRKACD* |
| Ga0137393_102435841 | 3300011271 | Vadose Zone Soil | NGNPETKVWVDLHTALYYCPGADLYGNTPKGKFTSQRDAQLDQFEPAYRKACD* |
| Ga0137389_106243222 | 3300012096 | Vadose Zone Soil | DLHTALYYCPDAGLYGKTPKGKFTTQRDAQLDQFEPAYRRACD* |
| Ga0137384_109008861 | 3300012357 | Vadose Zone Soil | QVWVDLHTALYYCPGADLYGNTPKGKFTSQREAQLDQFEPANRKVCE* |
| Ga0137398_110517022 | 3300012683 | Vadose Zone Soil | LYYCPGSDLYGKTEKGKMTSQRSAQLDQFEPAYRKACN* |
| Ga0137416_104271652 | 3300012927 | Vadose Zone Soil | ALYYCPGSDLYGKTEKGKMTSQRSAQLDQFEPAYRKACN* |
| Ga0164303_108580492 | 3300012957 | Soil | GNPDVKVWVDLQTGLYYCPNADLYGHTPKGKFTTQRDAQLDQFEPGYRKTCE* |
| Ga0126369_134212641 | 3300012971 | Tropical Forest Soil | TGNPEVKVWVDLRTALYYCPGADLYGRTPKGKYMTQREAQLDQFEAASRKVCE* |
| Ga0164308_106034161 | 3300012985 | Soil | PEDKGNPSTAVWVDLQTGLYYCPNSDPYGKTPKGKYTSQRDAQLDQYAPAYRKVCD* |
| Ga0181519_102990102 | 3300014658 | Bog | WVDLQTALYYCPGADLYGKTAKGKFTSQRDAQLDQFEPAYRKACD* |
| Ga0157379_122123012 | 3300014968 | Switchgrass Rhizosphere | NPEVQVWVDLQTALYYCPASDLYGKTSKGKFTTQRDAQLDQFEPAYRKACD* |
| Ga0132255_1032069733 | 3300015374 | Arabidopsis Rhizosphere | WVDVRTALYYCPDAELYGKTPKGKYLTQREAQLDQFEAASRRVCE* |
| Ga0182036_104339011 | 3300016270 | Soil | DVHTALYYCSGSEQYGKTPGGKIAPQREAQLDQFEPATRKPCE |
| Ga0182034_107712941 | 3300016371 | Soil | TALYYCPGADLYGKTEKGKFSAQRDAQQDQFEPAFRRPCE |
| Ga0181505_106046201 | 3300016750 | Peatland | TALYYCPGADLYGKTPKGKFASQRDAQLDQFEPAYRKACD |
| Ga0187818_100439951 | 3300017823 | Freshwater Sediment | ALYYCPGADLYGKTPSGKFATQRDAQLDQFEPADRKACD |
| Ga0187818_104094761 | 3300017823 | Freshwater Sediment | RVWVDLHTALYYCPGTDLYGKTPKGKFTSQRDAQLDQFEPAYRKACD |
| Ga0187818_104463631 | 3300017823 | Freshwater Sediment | TQVWVDLQTALYYCPGADLYGKTPKGKFSTQHAAQLDKFEPAYRKACN |
| Ga0187801_102768712 | 3300017933 | Freshwater Sediment | NPNTQVWVDLQTALYYCPGADLYGKTPKGKFSTQHAAQLDQFEPAYRKACN |
| Ga0187847_104490362 | 3300017948 | Peatland | CPGADLYGKTAKGKFTSQRDAQLDQFEPAYRKACD |
| Ga0187817_100139137 | 3300017955 | Freshwater Sediment | TQVWVDSHTALYYCPGADLYGKTPNGKFATQRDAQLDQFEPADRKACD |
| Ga0187817_101841411 | 3300017955 | Freshwater Sediment | TALYYCPGADLYGKTPKGRFSTQRDAQLDQFEPAYRKACN |
| Ga0187781_112699432 | 3300017972 | Tropical Peatland | YCPGTELYGKSPKGKLATQRDAQLDQYEPAYQKACE |
| Ga0187780_102251001 | 3300017973 | Tropical Peatland | HTALYYCPGTDLYGKTPKGKFTTQRDAQLDQFEPAYRKACD |
| Ga0187782_104307233 | 3300017975 | Tropical Peatland | ALYYCSGSEAYGKTDGGKMASQKDAQLDQFKPAALKACE |
| Ga0187782_111929982 | 3300017975 | Tropical Peatland | VWVDTHTALYYCPGAELYGKTQQGKMTTQRDAQLDQYEPALRRACD |
| Ga0187782_112069371 | 3300017975 | Tropical Peatland | YCPGTELYGKTPKGKLATQRDAQLDQYEPAYQKACE |
| Ga0187805_101166691 | 3300018007 | Freshwater Sediment | DMHTALYYCAGSDLYGKTPGGNYTTQRDAQLDQFEPAYRRACD |
| Ga0187884_102611801 | 3300018009 | Peatland | LHTALYYCPGSELYGKTPKGKFTSQREAQLDQFEPASNKICD |
| Ga0187863_108410641 | 3300018034 | Peatland | YCPGADLYGKTPKGRYATQRDAQLDQFEPAYRKTCD |
| Ga0187859_101726122 | 3300018047 | Peatland | DLHTALYYCPGSELYGKTPKGKFTSQREAQLDQFEPASNKICD |
| Ga0187766_105841652 | 3300018058 | Tropical Peatland | HTALYYCSGSEQYGKTPGGKIAAQHEAQLDQFEPATRKPCE |
| Ga0187765_109408251 | 3300018060 | Tropical Peatland | YKGNPSTQVWVDLQSALYYCPGADLYGKTAKGKYSSQQDAQLDQYEPASRKACE |
| Ga0187769_109816961 | 3300018086 | Tropical Peatland | KGNPQTQVWVDLHTALYYCPGTDLYGKTPKGKFTTQRDAQLDQFEPAYQKACE |
| Ga0187771_111989332 | 3300018088 | Tropical Peatland | LYYCPGTDLYGKTPKGKFAKQRDAQLDQFEPAYQKACD |
| Ga0187771_115696662 | 3300018088 | Tropical Peatland | VQVWEDLHTGLYYCPGTDLYGKTRDGKVTNQRDAQLDQFEPAGHKTCE |
| Ga0187798_16159103 | 3300019275 | Peatland | LYYCPGADLYGKTPKGKFTTQRDAQLDQFEPAYRKACE |
| Ga0187800_10936641 | 3300019278 | Peatland | QTQVWVDLHTALYYCPGTDLYGKTPKGKFTTQQDAQLDQFEPAYQKACD |
| Ga0210407_105417121 | 3300020579 | Soil | ENRGNPAAQVWEDLHTGLYYCPGTDLYGKTPKGKYTLQRDAQLDRFEPAYRKTCD |
| Ga0210403_103788212 | 3300020580 | Soil | YYCPGTDLYGKTPKGKYTLQRDAQLDRFEPAYRKTCD |
| Ga0210399_105183192 | 3300020581 | Soil | LENRGNPAAQVWEDLHTGLYYCPGTDLYGKTPKGKYTLQRDAQLDRFEPAYRKTCD |
| Ga0210396_103228371 | 3300021180 | Soil | HTALYYCPGADLYGKTPKGKFTSQRDAQLDQFEPAYRKACD |
| Ga0210393_107913082 | 3300021401 | Soil | EAQVWVDLHTALYYCAGADLYGKTPKGRFTSQREAQLDQFEPAYRKACD |
| Ga0210385_115098632 | 3300021402 | Soil | ALYYCADSDLYGKTSGGKFTTQRDAQLDQFEPAARKNCD |
| Ga0210386_115710072 | 3300021406 | Soil | QVWVDLRTALYYCPGTDLYGKTPQGKFTTQREAQLDQFEPAYRKACN |
| Ga0210391_115334281 | 3300021433 | Soil | DPPVYKGNPRTQVWVDLHTALYYCPGTDLYGKTPKGRFSSQREAQLDQYEPAYRKACD |
| Ga0210392_104873282 | 3300021475 | Soil | YCPGEDLYGKTPKGKFTSQRDAQLDQYEPAARKPCN |
| Ga0242647_10194101 | 3300022505 | Soil | MKHALYYCSDSDLYGKTPGGKFTTQRDAQLDQFEPAARKNCD |
| Ga0242648_10062581 | 3300022506 | Soil | DTKVWVDLHTALYYCPGSDLYGKTTKGRFVTQRDAQLDQFEPASRKACD |
| Ga0242652_10035384 | 3300022510 | Soil | HTALYYCAGADLYGKTPKGRFTSQREAQLDQFEPAYRKACD |
| Ga0242664_10419121 | 3300022527 | Soil | GNPDAQVWVDLHTALYYCPGADLYGKTPKGKFTSQRDAQLDQFEPAYRKACD |
| Ga0242662_100782271 | 3300022533 | Soil | ALYYCAGADLYGKTPKGRFTSQREAQLDQFEPAYRKACD |
| Ga0242662_100956942 | 3300022533 | Soil | WVDLHTALYYCADSDLYGKTSGGKFTTQRDAQLDQFEAAAHKNCD |
| Ga0242666_11728621 | 3300022721 | Soil | LYYCPGSDLYGKGPKGKFVSQRDAQLDQFEPAYRKAFD |
| Ga0242657_10708542 | 3300022722 | Soil | MKHALYYCSDSDLYGKTPGGKYTTQRDAQLDQFEPAARKNCD |
| Ga0224570_1006644 | 3300022730 | Rhizosphere | HSALYYCPGADLYGKTPQGKYSSQRDAQLGQFEPAYRKPCN |
| Ga0224550_10449522 | 3300022873 | Soil | CPGSDLYGKTPKGKFSTQREAQLDQFEPAYRKPCD |
| Ga0207699_101597731 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LQTGLYYCPNSDPYGKTPKGKYTSQRDAQLDQYAPAYRKVCD |
| Ga0207646_106102641 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | NPETQVWVDLHTALYYCPGADLYGKTPKGKFTTQRDAQLDQFEPAYRRACD |
| Ga0207664_118445902 | 3300025929 | Agricultural Soil | LYYCPNADPYGKTPKGKYTSQRDAQLDQYAPAYRKVCD |
| Ga0209838_10589231 | 3300026214 | Soil | GNADTQVWVDLHTALYYCPGSDLYGKTPKGKFTSQRDAQLDQFEPAYRKACE |
| Ga0209871_10367041 | 3300026217 | Permafrost Soil | YHGNPDAQVWVDLHTALYYCPGADLYGKTPKGRITTQRSAQLDQFEPAYRKACD |
| Ga0209687_12486641 | 3300026322 | Soil | LYYCPNADPYGKTPKGKYTSQRDAQLDQFAPAYRKVCD |
| Ga0209152_102344582 | 3300026325 | Soil | VWVDLQTGLYYCPNADPYGKTPKGKYTSQRDAQLDQFAPAYRKVCD |
| Ga0209267_11620551 | 3300026331 | Soil | QTGLYYCSGSDPYGNTPKGKFTSQRDAQMDQFEPAYRKACD |
| Ga0209158_12317681 | 3300026333 | Soil | WVDLQTGLYYCSGSDPYGNTPKGKFTSQRDAQMDQFEPAYRKACD |
| Ga0209806_13352762 | 3300026529 | Soil | GNPETKVWVDTHTALYYCPGTDLYGKTPQGKYTTQRDAQLDQFEPAYRKACN |
| Ga0207821_10264411 | 3300026869 | Tropical Forest Soil | HTALYYCSGADLYGKTPTGKFATQRDAQLDQYEPAYRKACE |
| Ga0209115_10600062 | 3300027567 | Forest Soil | CPDSDLYGKTPKGKLASQREAQLDQFEPANRKPCD |
| Ga0209329_11304642 | 3300027605 | Forest Soil | EYKGNPATQVWVDLQTALYYCPGADLYGKTPKGRFSSQRAARLDQFEPAYRKACD |
| Ga0208991_10078911 | 3300027681 | Forest Soil | LYYCPGAELYGKTPKGKVTSQRDAQLDQFEPAYRKACN |
| Ga0209040_102407322 | 3300027824 | Bog Forest Soil | QRTALYYCPGADLYGKTPKGKFTTQHEAQLDQFEPAYRKPCN |
| Ga0209580_101152512 | 3300027842 | Surface Soil | VDLHTALYYCPGTDLYGKTESGKYTTQREAQLDQFEPAYRKVCN |
| Ga0209580_104206322 | 3300027842 | Surface Soil | RTALYYCPGTDLYGKTPQGKFATQREAQLDQFQPAYRKACN |
| Ga0209166_103718531 | 3300027857 | Surface Soil | VWVDLHTALYYCPGADLYGKTARGKYTTQRDAQLDQFQPAYRKVCK |
| Ga0209701_101743961 | 3300027862 | Vadose Zone Soil | CPGSDPYGNTPKGKFTSQRDAQMDQFEPAYRKACD |
| Ga0209465_104149291 | 3300027874 | Tropical Forest Soil | EPTPDKGNPGAQVWVDLHTALYYCSGADLYGKTPKGKFTTQREAQLDQFEPAYRKTCD |
| Ga0209169_101515002 | 3300027879 | Soil | TALYYCAGDDLYNRTPKGKFTTQRDAQLDRYEPAYRKACD |
| Ga0209624_106396991 | 3300027895 | Forest Soil | QVWIDPHTALYYCPGSELYGKTPKGKFASQQDAQLDQFEPASRRACN |
| Ga0209624_108327731 | 3300027895 | Forest Soil | TALYYCPGTDLYGKTPKGKFTSQREAQLDQFEPAYRKACD |
| Ga0209488_107859912 | 3300027903 | Vadose Zone Soil | NPDTQVWVDLHSALYYCPGSDLYGKTEKGKMTSQRSAQLDQFEPAYRKACN |
| Ga0137415_101426121 | 3300028536 | Vadose Zone Soil | QVWVDLHTALYYCPGADLYGKTEKGKLTSQRSAQLDQFEPAYRKACD |
| Ga0257175_11193321 | 3300028673 | Soil | NPDTQVWVDLHTALYYCPGSDLYGKTEKGKITSQRSAQLDQFEPAYRKACN |
| Ga0308309_112867362 | 3300028906 | Soil | EYKGNPETQVWVDLHTALYYCPGADLYGKTPKGRFASQREAQLDQFEPAYRKACD |
| Ga0311338_113366782 | 3300030007 | Palsa | QVWLDLHTALYYCPGADLYGKTPKGRYATQRDAQLDQFEPAYRKACE |
| Ga0311353_103958561 | 3300030399 | Palsa | NPETQVWVDLHTALYYCPGADLYGKTPKGKYTNQRDAQMDRFEPAYRKVCD |
| Ga0311353_105343831 | 3300030399 | Palsa | CPGSDLYGKTPKGKFASQRDAQLDQFEPAYRKTCD |
| Ga0310037_104296971 | 3300030494 | Peatlands Soil | CPGADLYGKTPKGKFASQRDAQLDQFEPAYRKACD |
| Ga0311355_102585431 | 3300030580 | Palsa | NPSTQVWVDLHTALYYCPGADLYGKTSTGKFTTQREAQLDQFEPAYRKTCN |
| Ga0310038_100404841 | 3300030707 | Peatlands Soil | QVWVDLHTALYYCPGADLYGKTPKGKLTTQRDAQLDQFEPAYRKACD |
| Ga0307482_10895561 | 3300030730 | Hardwood Forest Soil | RTALYYCPGTDLYGKTPQGKFATQREAQLDQFEPAYRKACD |
| Ga0265460_100104503 | 3300030740 | Soil | FFFLFLDPHTALYYCPGSELYGKTPKGKFASQQDAQLDQFEPASRRACN |
| Ga0170834_1018707121 | 3300031057 | Forest Soil | KGNPDTQVWVDLRTALYYCPGDDLYGKTAKGKITSQRDAQLDQFEPAYRKTCD |
| Ga0265760_102464671 | 3300031090 | Soil | LYYCPGDDLYGKTAKGKITSQRDAQLDQFEPAYRKTCD |
| Ga0170824_1169497371 | 3300031231 | Forest Soil | ALYYCPGTDLYGKTPKGKFTTQRDAQLDQFEPAYRKACE |
| Ga0170824_1206387081 | 3300031231 | Forest Soil | TALYYCPGDDLYGKTAKGKITSQRDAQLDQFEPAYRKTCD |
| Ga0170819_136861991 | 3300031469 | Forest Soil | DLHTALYYCPGTDLYGKTPKGKFTTQRDAQLDQFEPAYRKACE |
| Ga0302326_1001145416 | 3300031525 | Palsa | GNPETQVWVDLHTALYYCPGTDFYGKTPKGKFTSQRDAQLDQFEPAYRKACD |
| Ga0310686_1077406241 | 3300031708 | Soil | GNPDTQVWVDLQTALYYCPGSDLYGKTPKGKVSSQRDAQLDQFEPANRKPCD |
| Ga0308175_1003633911 | 3300031938 | Soil | AQDKGNPSAAVWVDLQTGLYYCSGTDLYGKTPRGKYTGQRDAQLDRFEPAYRQPCK |
| Ga0310916_115643222 | 3300031942 | Soil | LHTAQYYCPGADLYGKTPTGKFATQREAQMDQFEPAYRKPCN |
| Ga0310910_110244342 | 3300031946 | Soil | VDLHTALYYCRGTDLYGKTPQGKFTTQRAAQLDQFEPAYRKACK |
| Ga0307479_104788032 | 3300031962 | Hardwood Forest Soil | KGNPATQDWVDLHTALYYCPGTDLYGKTPKGKFTTQRDAQLDAFEPAYRKACE |
| Ga0307479_105694592 | 3300031962 | Hardwood Forest Soil | VWVDLRTALYYCPGSDLYGKTDKGKLTSQRSAQLDQFEPAYRKACD |
| Ga0307479_106954031 | 3300031962 | Hardwood Forest Soil | ALYYCPGTDLYGKTPLGKFTTQRDAQLDQFEPAYRKACN |
| Ga0318533_108830932 | 3300032059 | Soil | TAQYYCPGADLYGKTPTGKFATQREAQMDQFEPAYRKPCN |
| Ga0311301_110647962 | 3300032160 | Peatlands Soil | ENKGGNPDVKVWVDLRSGQYYCPGADVYGKTLKGKFTTQREAQLDQFEPASRKTCD |
| Ga0307470_112481912 | 3300032174 | Hardwood Forest Soil | CPGSDLYGKTAKGKTTSQRDAQLDQFEPASRKACD |
| Ga0307471_1004541151 | 3300032180 | Hardwood Forest Soil | TALYYCPGADLYGKTEGGKFVLQHEAQLDQFQPAARKNCE |
| Ga0307471_1027284342 | 3300032180 | Hardwood Forest Soil | TQVWLDLHTALYYCPGTDLYGKTANGRYTTQREAQLDQFQPAYRKTCN |
| Ga0335079_111281101 | 3300032783 | Soil | AQVWVDQHTALYYCPGADLYGKTPKGKYTTQKDAQLDQFEPAYGKACE |
| Ga0335078_107577752 | 3300032805 | Soil | DKGNPSAQVWVDTHTGLYYCLGADLYGKTPKGNFTTQREAQLDQFQPAYRKACN |
| Ga0335070_113257351 | 3300032829 | Soil | VWIDVQTALYYCPGADLYGKTPKGRLSSQRNAQLDQYEPAARKACD |
| Ga0314865_022325_94_255 | 3300033806 | Peatland | MGNPNVKVWVDLQTALYYCPGTDLYGTTPKGKYASQGDAQQDSFEPAYRKPCE |
| ⦗Top⦘ |