| Basic Information | |
|---|---|
| Family ID | F036913 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 169 |
| Average Sequence Length | 47 residues |
| Representative Sequence | VKWKVVLAVGAVAGGAFWYVRRKSRRAEADAELWAEATDPITRFGDA |
| Number of Associated Samples | 128 |
| Number of Associated Scaffolds | 169 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 42.60 % |
| % of genes near scaffold ends (potentially truncated) | 44.97 % |
| % of genes from short scaffolds (< 2000 bps) | 83.43 % |
| Associated GOLD sequencing projects | 120 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.781 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (23.669 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.178 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.746 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 54.67% β-sheet: 0.00% Coil/Unstructured: 45.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 169 Family Scaffolds |
|---|---|---|
| PF02080 | TrkA_C | 38.46 |
| PF00487 | FA_desaturase | 8.88 |
| PF00196 | GerE | 8.28 |
| PF11611 | DUF4352 | 7.10 |
| PF00999 | Na_H_Exchanger | 2.96 |
| PF04237 | YjbR | 2.37 |
| PF13683 | rve_3 | 1.78 |
| PF16859 | TetR_C_11 | 0.59 |
| PF00005 | ABC_tran | 0.59 |
| PF07732 | Cu-oxidase_3 | 0.59 |
| PF07366 | SnoaL | 0.59 |
| PF00400 | WD40 | 0.59 |
| PF06965 | Na_H_antiport_1 | 0.59 |
| PF01028 | Topoisom_I | 0.59 |
| PF01343 | Peptidase_S49 | 0.59 |
| PF01594 | AI-2E_transport | 0.59 |
| PF13191 | AAA_16 | 0.59 |
| PF07731 | Cu-oxidase_2 | 0.59 |
| COG ID | Name | Functional Category | % Frequency in 169 Family Scaffolds |
|---|---|---|---|
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 8.88 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 8.88 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 3.55 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 2.96 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 2.96 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 2.96 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 2.96 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 2.37 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.18 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 1.18 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.59 |
| COG3569 | DNA topoisomerase IB | Replication, recombination and repair [L] | 0.59 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.78 % |
| Unclassified | root | N/A | 27.22 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000363|ICChiseqgaiiFebDRAFT_10790833 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300000443|F12B_11160209 | Not Available | 855 | Open in IMG/M |
| 3300000550|F24TB_11641612 | Not Available | 513 | Open in IMG/M |
| 3300000858|JGI10213J12805_10026819 | Not Available | 504 | Open in IMG/M |
| 3300000956|JGI10216J12902_106392108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1026 | Open in IMG/M |
| 3300001431|F14TB_100323158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1045 | Open in IMG/M |
| 3300001686|C688J18823_10755140 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300002568|C688J35102_120978570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4495 | Open in IMG/M |
| 3300003324|soilH2_10384009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4199 | Open in IMG/M |
| 3300003373|JGI25407J50210_10042242 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300003911|JGI25405J52794_10018682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1385 | Open in IMG/M |
| 3300004463|Ga0063356_101768203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 927 | Open in IMG/M |
| 3300004479|Ga0062595_100019909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2509 | Open in IMG/M |
| 3300004479|Ga0062595_100372891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1007 | Open in IMG/M |
| 3300004480|Ga0062592_102582264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 512 | Open in IMG/M |
| 3300004643|Ga0062591_101703944 | Not Available | 639 | Open in IMG/M |
| 3300004798|Ga0058859_10033493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 540 | Open in IMG/M |
| 3300005093|Ga0062594_101754257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 651 | Open in IMG/M |
| 3300005158|Ga0066816_1008250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 730 | Open in IMG/M |
| 3300005168|Ga0066809_10141329 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300005327|Ga0070658_10459107 | Not Available | 1098 | Open in IMG/M |
| 3300005331|Ga0070670_101225580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium → unclassified Microbacterium → Microbacterium sp. | 686 | Open in IMG/M |
| 3300005339|Ga0070660_100905577 | Not Available | 744 | Open in IMG/M |
| 3300005347|Ga0070668_100751563 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300005353|Ga0070669_101884945 | Not Available | 522 | Open in IMG/M |
| 3300005356|Ga0070674_100513640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1000 | Open in IMG/M |
| 3300005455|Ga0070663_101409614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 617 | Open in IMG/M |
| 3300005457|Ga0070662_100529228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 986 | Open in IMG/M |
| 3300005457|Ga0070662_100940432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 738 | Open in IMG/M |
| 3300005459|Ga0068867_101268747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 679 | Open in IMG/M |
| 3300005543|Ga0070672_101702863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 566 | Open in IMG/M |
| 3300005545|Ga0070695_101570098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 549 | Open in IMG/M |
| 3300005546|Ga0070696_101989879 | Not Available | 504 | Open in IMG/M |
| 3300005844|Ga0068862_100944832 | Not Available | 850 | Open in IMG/M |
| 3300005937|Ga0081455_10002880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 20248 | Open in IMG/M |
| 3300005937|Ga0081455_10936138 | Not Available | 538 | Open in IMG/M |
| 3300005937|Ga0081455_11017980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 512 | Open in IMG/M |
| 3300005981|Ga0081538_10248059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 681 | Open in IMG/M |
| 3300006049|Ga0075417_10559794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 579 | Open in IMG/M |
| 3300006058|Ga0075432_10001051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8792 | Open in IMG/M |
| 3300006058|Ga0075432_10084221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1156 | Open in IMG/M |
| 3300006169|Ga0082029_1054563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 5276 | Open in IMG/M |
| 3300006196|Ga0075422_10096413 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300006572|Ga0074051_11238134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 697 | Open in IMG/M |
| 3300006844|Ga0075428_100032203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5791 | Open in IMG/M |
| 3300006844|Ga0075428_100062870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 4063 | Open in IMG/M |
| 3300006844|Ga0075428_100675627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1101 | Open in IMG/M |
| 3300006844|Ga0075428_101920333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 615 | Open in IMG/M |
| 3300006845|Ga0075421_101639931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 698 | Open in IMG/M |
| 3300006846|Ga0075430_100968164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 701 | Open in IMG/M |
| 3300006853|Ga0075420_100200798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1741 | Open in IMG/M |
| 3300006876|Ga0079217_10221628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 985 | Open in IMG/M |
| 3300006876|Ga0079217_10762398 | Not Available | 664 | Open in IMG/M |
| 3300006881|Ga0068865_101484909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 607 | Open in IMG/M |
| 3300006894|Ga0079215_10222640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 975 | Open in IMG/M |
| 3300006918|Ga0079216_10580969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 765 | Open in IMG/M |
| 3300007004|Ga0079218_10623008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 991 | Open in IMG/M |
| 3300009098|Ga0105245_10252252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1715 | Open in IMG/M |
| 3300009098|Ga0105245_11492766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 727 | Open in IMG/M |
| 3300009098|Ga0105245_11642939 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300009100|Ga0075418_12719923 | Not Available | 540 | Open in IMG/M |
| 3300009553|Ga0105249_11386488 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300009553|Ga0105249_11626515 | Not Available | 718 | Open in IMG/M |
| 3300009553|Ga0105249_11819473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 682 | Open in IMG/M |
| 3300009789|Ga0126307_11220689 | Not Available | 609 | Open in IMG/M |
| 3300009840|Ga0126313_11014919 | Not Available | 680 | Open in IMG/M |
| 3300010037|Ga0126304_10823893 | Not Available | 630 | Open in IMG/M |
| 3300010038|Ga0126315_10163983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1322 | Open in IMG/M |
| 3300010040|Ga0126308_10011661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4475 | Open in IMG/M |
| 3300010041|Ga0126312_10088267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2109 | Open in IMG/M |
| 3300010041|Ga0126312_10925151 | Not Available | 636 | Open in IMG/M |
| 3300010042|Ga0126314_10429643 | Not Available | 954 | Open in IMG/M |
| 3300010042|Ga0126314_10773376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 706 | Open in IMG/M |
| 3300010045|Ga0126311_10029788 | All Organisms → cellular organisms → Bacteria | 3347 | Open in IMG/M |
| 3300010045|Ga0126311_10033067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3198 | Open in IMG/M |
| 3300010375|Ga0105239_11408858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 805 | Open in IMG/M |
| 3300011000|Ga0138513_100013456 | Not Available | 1056 | Open in IMG/M |
| 3300012212|Ga0150985_111256369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 598 | Open in IMG/M |
| 3300012469|Ga0150984_105075129 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300012897|Ga0157285_10351059 | Not Available | 517 | Open in IMG/M |
| 3300012911|Ga0157301_10005096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2393 | Open in IMG/M |
| 3300012938|Ga0162651_100012965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1053 | Open in IMG/M |
| 3300012938|Ga0162651_100057134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 624 | Open in IMG/M |
| 3300013308|Ga0157375_10614855 | Not Available | 1245 | Open in IMG/M |
| 3300015371|Ga0132258_10102907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6735 | Open in IMG/M |
| 3300015371|Ga0132258_10465782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3153 | Open in IMG/M |
| 3300015371|Ga0132258_10576525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2823 | Open in IMG/M |
| 3300015371|Ga0132258_12217228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae | 1379 | Open in IMG/M |
| 3300015372|Ga0132256_102299872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 642 | Open in IMG/M |
| 3300015373|Ga0132257_102459612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 676 | Open in IMG/M |
| 3300015374|Ga0132255_102431449 | Not Available | 800 | Open in IMG/M |
| 3300015374|Ga0132255_105429475 | Not Available | 539 | Open in IMG/M |
| 3300017792|Ga0163161_10057184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae | 2834 | Open in IMG/M |
| 3300017792|Ga0163161_10300700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1263 | Open in IMG/M |
| 3300017792|Ga0163161_11509640 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300017965|Ga0190266_10143655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1061 | Open in IMG/M |
| 3300017965|Ga0190266_10946225 | Not Available | 571 | Open in IMG/M |
| 3300018027|Ga0184605_10424416 | Not Available | 590 | Open in IMG/M |
| 3300018031|Ga0184634_10249818 | Not Available | 813 | Open in IMG/M |
| 3300018061|Ga0184619_10282733 | Not Available | 761 | Open in IMG/M |
| 3300018066|Ga0184617_1023419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1398 | Open in IMG/M |
| 3300018073|Ga0184624_10032025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2037 | Open in IMG/M |
| 3300018076|Ga0184609_10489367 | Not Available | 561 | Open in IMG/M |
| 3300018082|Ga0184639_10088113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1634 | Open in IMG/M |
| 3300018082|Ga0184639_10515082 | Not Available | 601 | Open in IMG/M |
| 3300018429|Ga0190272_11151297 | Not Available | 757 | Open in IMG/M |
| 3300018432|Ga0190275_10592955 | Not Available | 1155 | Open in IMG/M |
| 3300018466|Ga0190268_10054219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1613 | Open in IMG/M |
| 3300018466|Ga0190268_10190082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1106 | Open in IMG/M |
| 3300018466|Ga0190268_11345337 | Not Available | 606 | Open in IMG/M |
| 3300018469|Ga0190270_10093099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2280 | Open in IMG/M |
| 3300018476|Ga0190274_11947800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 683 | Open in IMG/M |
| 3300018481|Ga0190271_10748682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1101 | Open in IMG/M |
| 3300018481|Ga0190271_11238535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 868 | Open in IMG/M |
| 3300018481|Ga0190271_12132810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 668 | Open in IMG/M |
| 3300018481|Ga0190271_13355707 | Not Available | 537 | Open in IMG/M |
| 3300019279|Ga0184642_1554644 | Not Available | 636 | Open in IMG/M |
| 3300019767|Ga0190267_10773843 | Not Available | 633 | Open in IMG/M |
| 3300019767|Ga0190267_10932149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium → unclassified Microbacterium → Microbacterium sp. | 599 | Open in IMG/M |
| 3300019767|Ga0190267_11332837 | Not Available | 539 | Open in IMG/M |
| 3300019869|Ga0193705_1004612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae → Microlunatus → Microlunatus phosphovorus → Microlunatus phosphovorus NM-1 | 3019 | Open in IMG/M |
| 3300019873|Ga0193700_1006706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1802 | Open in IMG/M |
| 3300019873|Ga0193700_1043881 | Not Available | 717 | Open in IMG/M |
| 3300021078|Ga0210381_10219115 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300021510|Ga0222621_1050796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 868 | Open in IMG/M |
| 3300022694|Ga0222623_10207852 | Not Available | 759 | Open in IMG/M |
| 3300022694|Ga0222623_10222000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 731 | Open in IMG/M |
| 3300022756|Ga0222622_10212028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1292 | Open in IMG/M |
| 3300022756|Ga0222622_10216785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae | 1279 | Open in IMG/M |
| 3300022756|Ga0222622_10376839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 994 | Open in IMG/M |
| 3300023058|Ga0193714_1063526 | Not Available | 519 | Open in IMG/M |
| 3300025935|Ga0207709_10400916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1049 | Open in IMG/M |
| 3300025935|Ga0207709_10514832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 936 | Open in IMG/M |
| 3300025937|Ga0207669_10140926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1674 | Open in IMG/M |
| 3300025961|Ga0207712_11087019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 712 | Open in IMG/M |
| 3300025961|Ga0207712_11772472 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300027560|Ga0207981_1048547 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300027873|Ga0209814_10176259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 920 | Open in IMG/M |
| 3300027907|Ga0207428_10004597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13081 | Open in IMG/M |
| 3300028597|Ga0247820_11010085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium → unclassified Microbacterium → Microbacterium sp. | 594 | Open in IMG/M |
| 3300028608|Ga0247819_10332438 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300028707|Ga0307291_1004097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3112 | Open in IMG/M |
| 3300028707|Ga0307291_1049474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1009 | Open in IMG/M |
| 3300028716|Ga0307311_10229775 | Not Available | 548 | Open in IMG/M |
| 3300028718|Ga0307307_10002077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5031 | Open in IMG/M |
| 3300028719|Ga0307301_10005883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3422 | Open in IMG/M |
| 3300028722|Ga0307319_10023796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae → environmental samples → uncultured Propionibacteriaceae bacterium | 1879 | Open in IMG/M |
| 3300028778|Ga0307288_10036595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1647 | Open in IMG/M |
| 3300028875|Ga0307289_10096395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1205 | Open in IMG/M |
| 3300028876|Ga0307286_10369626 | Not Available | 535 | Open in IMG/M |
| 3300030496|Ga0268240_10089675 | Not Available | 709 | Open in IMG/M |
| 3300030903|Ga0308206_1073994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 722 | Open in IMG/M |
| 3300030905|Ga0308200_1130093 | Not Available | 564 | Open in IMG/M |
| 3300030989|Ga0308196_1073782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 507 | Open in IMG/M |
| 3300031082|Ga0308192_1070088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
| 3300031091|Ga0308201_10170625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 697 | Open in IMG/M |
| 3300031092|Ga0308204_10251149 | Not Available | 573 | Open in IMG/M |
| 3300031092|Ga0308204_10254265 | Not Available | 571 | Open in IMG/M |
| 3300031114|Ga0308187_10078756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 979 | Open in IMG/M |
| 3300031184|Ga0307499_10027379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1273 | Open in IMG/M |
| 3300031454|Ga0272427_1015277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6117 | Open in IMG/M |
| 3300031731|Ga0307405_10001131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10944 | Open in IMG/M |
| 3300031731|Ga0307405_10143582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1668 | Open in IMG/M |
| 3300031740|Ga0307468_101411632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 640 | Open in IMG/M |
| 3300031852|Ga0307410_10000531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 15580 | Open in IMG/M |
| 3300031901|Ga0307406_10306887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1222 | Open in IMG/M |
| 3300032004|Ga0307414_10016431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4498 | Open in IMG/M |
| 3300032126|Ga0307415_101054835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 758 | Open in IMG/M |
| 3300034673|Ga0314798_104014 | Not Available | 604 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 23.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.28% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 6.51% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.73% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.14% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.55% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.96% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.78% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.78% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.18% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.18% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.18% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.18% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.59% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.59% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.59% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 0.59% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.59% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.59% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.59% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.59% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.59% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005158 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAA | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300019873 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023058 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1 | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030989 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031082 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031454 | Rock endolithic microbial communities from Victoria Land, Antarctica - Siegfried Peak sud | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300034673 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiFebDRAFT_107908332 | 3300000363 | Soil | VKWKVVLAVGAVTGGALWFVRRRSRRAAADAELWAEATDPIARFGDT* |
| F12B_111602092 | 3300000443 | Soil | VKWKEVLAVGAVAGGAVWFARRKSRRAAAEAELWAEATDPIARFGES* |
| F24TB_116416121 | 3300000550 | Soil | VKWKVVLAVGAVAGGAVWFARRKSRRAAAEAELWAEATDPI |
| JGI10213J12805_100268191 | 3300000858 | Soil | VKWKVVLAIGAVAGSAVWFARRKSRRAVEEAELWAEATDPIARFGES* |
| JGI10216J12902_1063921083 | 3300000956 | Soil | VKWKVVLAVGAVAGSALWFVRRRSRRVAADAELWAEATDPITRFGDA* |
| F14TB_1003231582 | 3300001431 | Soil | MVDRVKWKVVLAVGAVAGGAILFARHKSRRAAADAELWAEATDPIARFGDS* |
| C688J18823_107551401 | 3300001686 | Soil | KVVLAAGAIAGGAFWFVRRKSRRAAEDAELWSEATDPIARFGES* |
| C688J35102_1209785703 | 3300002568 | Soil | VKWKVVLAAGAIAGGAFWFVRRKSRRAAEDAELWSEATDPIARFGES* |
| soilH2_103840094 | 3300003324 | Sugarcane Root And Bulk Soil | VKWKVVLAAGAIAGGAFWFVRRKSRRAAEDAELWSEATDPIVRFGES* |
| JGI25407J50210_100422422 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MALAVGAIAGGALWLVRRRSRRAAEDAELWAEATDPIARFGES* |
| JGI25405J52794_100186822 | 3300003911 | Tabebuia Heterophylla Rhizosphere | VKWKVVLAVGAVAGGAVWFARRKSRRAAAEAELWAEATDPIARFGES* |
| Ga0063356_1017682031 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VKWKVALAIGAVAGGAVWYVRRKSRRAEADAELWAEATDP |
| Ga0062595_1000199093 | 3300004479 | Soil | LASAAINTAAKVDRVKWKVVVAVGAVAGGAFWYVRRKSRRTAADAELWAEATDPVTRFGES* |
| Ga0062595_1003728912 | 3300004479 | Soil | MVDRVKWKVVLAVGAVAGGTLWYVRRKSRRAASDAELWAEATDPITRFGDA* |
| Ga0062592_1025822641 | 3300004480 | Soil | VKWKVVLAAGAIAGGALWFVRRRSRRAEADAELWAEATDPIARFGDS* |
| Ga0062591_1017039441 | 3300004643 | Soil | MAAMVDRVKWKVVLAVGAVAGGTLWYVRRKSRRAASDAELWAEATDPITRFGDA* |
| Ga0058859_100334932 | 3300004798 | Host-Associated | VKWKLWLAVGALAGGAYWVARRRNRVNADAELWAEATDPVARFGDA* |
| Ga0062594_1017542571 | 3300005093 | Soil | MVDRVKWKVVLAVGAVAGGTLWYVRRKSRRAAADAELWAEATDPITRFGDA* |
| Ga0066816_10082502 | 3300005158 | Soil | VKWKVVLAVGAVAGGAFWYVRRKSRRAEADAELWAEATDPISRFGDA* |
| Ga0066809_101413291 | 3300005168 | Soil | VGAVAGGAFWYVRRKSRRAEADAELWAEATDPITRFGDA* |
| Ga0070658_104591072 | 3300005327 | Corn Rhizosphere | VNWKLWIAVGALAGGAFWAARRRNNRVNADAELWADATDPVARFGDA* |
| Ga0070670_1012255802 | 3300005331 | Switchgrass Rhizosphere | VNWKLWIAVGALAGGAFWAARRRNNRVNADAERWAAATDPVARFGDV* |
| Ga0070660_1009055771 | 3300005339 | Corn Rhizosphere | MVERVKWKVALAVGAVAGGTLWYVRRKSRRAASDAELWAEATDPITRFGDA* |
| Ga0070668_1007515632 | 3300005347 | Switchgrass Rhizosphere | VKWKVVLAVGAVAGGAFWYVRRKSRRAEADAELWAEATDPITRFGDA* |
| Ga0070669_1018849451 | 3300005353 | Switchgrass Rhizosphere | VKWKVALAIGAVAGGAVWYVRRKSRRAEADAELWAEATDPITRFGNV* |
| Ga0070674_1005136402 | 3300005356 | Miscanthus Rhizosphere | VKWKVALAIGAVAGGAVWYVRRKSRRAEADAELWAEATDPIIRFGNA* |
| Ga0070663_1014096142 | 3300005455 | Corn Rhizosphere | VPPDGYGGPVKWKLWLAVGALAGGAYWVARRRNRVNADAELWADATDPVARFGEV* |
| Ga0070662_1005292283 | 3300005457 | Corn Rhizosphere | GGCSVVRESDRSANSLAGGRVKWKVALAIGAVAGGAVWYVRRKSRRAEADAELWAEATDPIIRFGNA* |
| Ga0070662_1009404321 | 3300005457 | Corn Rhizosphere | VVLAVGAVAGGTLWYVRRKSRRAAADAELWAEATDPITRFGDA* |
| Ga0068867_1012687471 | 3300005459 | Miscanthus Rhizosphere | VKWTLWLAVGALAGGAYWVARRRNRVNADAELWADATDPVARFGDS* |
| Ga0070672_1017028632 | 3300005543 | Miscanthus Rhizosphere | VKWKVALAIGAVAGGAVWYVRRKSRRAEADAELWAEATD |
| Ga0070695_1015700981 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VKWKVALAIGAVAGGAVWYVRRKSRRAEADAELWAEATDPITRFGN |
| Ga0070696_1019898792 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MVDRVKWKVVLAVGAVAGGTLWYVRRKSPRAASDAELWAEATDPITRFGDA* |
| Ga0068862_1009448321 | 3300005844 | Switchgrass Rhizosphere | GALAGGAFWAARRRNNRVNADAERWADAADPVARFGDA* |
| Ga0081455_1000288014 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VKWKVVLAVGAVAGGAVWFARRKSRRAAAEAELWAEATDPIVRFGES* |
| Ga0081455_109361381 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VKWKVVLAIGAIAGSAVWFARRKSRRASEEAELWAEATDPIARFGES* |
| Ga0081455_110179802 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MVDRVKWKVVLAVGAVAGGAILFARRKSRRAAADAELWAEATDPIARFGES* |
| Ga0081538_102480592 | 3300005981 | Tabebuia Heterophylla Rhizosphere | VKWKVVLAVGAVAGGALWFVRRRSRRAEEDAELWAEATDPITRFGES* |
| Ga0075417_105597942 | 3300006049 | Populus Rhizosphere | AGGAVWYVRRKSRRAEADAELWAEATDPITRFGNA* |
| Ga0075432_100010511 | 3300006058 | Populus Rhizosphere | VKWKVVLAAGAIAGGAFWFVRRKSRRAAEDAELWS |
| Ga0075432_100842212 | 3300006058 | Populus Rhizosphere | VKWKVALAIGAVAGGAVWYVRRKSRRAEADAELWAEATDPITRFGNA* |
| Ga0082029_10545634 | 3300006169 | Termite Nest | MVDRVKWKVVLAVGAVAGGAILFARRKSRRAAADAELWAEATDPIARFGDS* |
| Ga0075422_100964133 | 3300006196 | Populus Rhizosphere | AGAIAGGAFWFVRRKSRRAAEDAELWSEATDPIVRFGES* |
| Ga0074051_112381342 | 3300006572 | Soil | MVLAVGAVAGGAVWFVRRKSRRAVAEAELWAEATDPIARFGET* |
| Ga0075428_1000322037 | 3300006844 | Populus Rhizosphere | VKWKVVLAAGAIAGGAFWFVRRKSRRAAEDAELWSEATDPIERFGES* |
| Ga0075428_1000628704 | 3300006844 | Populus Rhizosphere | MVLAVGAVAGGAVWFARRKSRRAAAEAELWAEATDPIVRFGES* |
| Ga0075428_1006756273 | 3300006844 | Populus Rhizosphere | MVDRVKWKVAIAVGAVAGGALWFARRKSRRAAADAELWAEATDPIARFGET* |
| Ga0075428_1019203332 | 3300006844 | Populus Rhizosphere | AAMVDRVKWKVVLAVGAVAGGAILFARRKSRRAAADAELWAEATDPIARFGDS* |
| Ga0075421_1016399312 | 3300006845 | Populus Rhizosphere | AMVDRVKWKVVLAVGAVAGGAILFARRKSRRAAADAELWAEATDPIARFGDS* |
| Ga0075430_1009681641 | 3300006846 | Populus Rhizosphere | VGAVAGGAVWFARRKSRRAAAEAELWAEATDPIVRFGES* |
| Ga0075420_1002007983 | 3300006853 | Populus Rhizosphere | GCSVVRESDRSASSLAGGRVKWKVALAIGAVAGGAVWYVRRKSRRAEADAELWAEATDPITRFGNA* |
| Ga0079217_102216282 | 3300006876 | Agricultural Soil | VDRVKWKVVLAVGAAAGGAFWFVRRKSRRSEADAELWAEATDPIARFGDG* |
| Ga0079217_107623982 | 3300006876 | Agricultural Soil | VKWKVVLAVGAAAGGAYWYVWRKARRAESDAELWAEATDPIGRFGDPDLSESS* |
| Ga0068865_1014849092 | 3300006881 | Miscanthus Rhizosphere | VKWKLWLAVGALAGGAYWVARRRNRVNADAELWADATDPVARFGEV* |
| Ga0079215_102226402 | 3300006894 | Agricultural Soil | VKWKVVLAVGAAAGGAYWYVWRKARRAESDAELWAEATDPIARFGDPDLSESS* |
| Ga0079216_105809692 | 3300006918 | Agricultural Soil | VKWKVVLAIGAVAGGAVWFARRKSRRAADEAELWAEATDPIARFGES* |
| Ga0079218_106230083 | 3300007004 | Agricultural Soil | VKWKVVLAVGAAAGGAYWYVWRKARQAESDAELWAEATDPIARFGDPDL* |
| Ga0105245_102522522 | 3300009098 | Miscanthus Rhizosphere | MVERVKWKVVLAVGAVAGGTLWYVRRKSRRAAADAELWAEATDPITRFGDA* |
| Ga0105245_114927661 | 3300009098 | Miscanthus Rhizosphere | RVKWKVVLAVGAVAGGTLWYVRRKSRRAASDAELWAEATDPITRFGDA* |
| Ga0105245_116429393 | 3300009098 | Miscanthus Rhizosphere | LPRYGGRVKWKVALAIGAVAGGAVWYVRRKSRRAEADAELWAEATDPITRFGNV* |
| Ga0075418_127199231 | 3300009100 | Populus Rhizosphere | MVDVVKWKVVLAVGALAGGALWFVRRKSRQAAEDAELWSEATDPVTRFGES* |
| Ga0105249_113864881 | 3300009553 | Switchgrass Rhizosphere | DRPTNSVAKVGRVKWKVVLAVGAVAGGAFWYVRRKSRRAEADAELWAEATDPITRFGDA* |
| Ga0105249_116265151 | 3300009553 | Switchgrass Rhizosphere | VKWKVALAIGAVAGGAVWYVRRKSRRAEADAELWAEATDPI |
| Ga0105249_118194732 | 3300009553 | Switchgrass Rhizosphere | VDRVKWKVVLAVGAVAGGTLWYVRRKSRRAAADAELWAEATDPITRFGDA* |
| Ga0126307_112206891 | 3300009789 | Serpentine Soil | VKWKVVLAVGAAAGGAYWYVWRKARRAESDAELWAEATDPIARFGDPDL |
| Ga0126313_110149191 | 3300009840 | Serpentine Soil | MVDVVKWKVALAVGALAGGAMWFVRRKSRRAAEDAELWSEATDPVTRFGES* |
| Ga0126304_108238932 | 3300010037 | Serpentine Soil | MVDRVKWKVVVAVGAVAGGALWFARRKSRRAAADAELWAEATDPIARFGES* |
| Ga0126315_101639831 | 3300010038 | Serpentine Soil | VKWKVVLAVGAAAGGAMWFARRKSRRAAADAELWAEATDPIARFGDS* |
| Ga0126308_100116613 | 3300010040 | Serpentine Soil | MALAVGAIAGGALWFVRRRSRRAEEDAELWAEATDPITRFGDT* |
| Ga0126312_100882671 | 3300010041 | Serpentine Soil | MVDRVKWKVVVAVGAVAGGAVWFARRKSRRAAADAELWAEATDPIARFGDS* |
| Ga0126312_109251511 | 3300010041 | Serpentine Soil | MVDRVKWKVVVAVGAVAGGALWFARRKSRRAAADAELWAEATDPIARFGDS* |
| Ga0126314_104296432 | 3300010042 | Serpentine Soil | MVDRVKWKVVLAVGAAAGGAMWFARRKSRRAAADAELWAEATDPIARFGDS* |
| Ga0126314_107733762 | 3300010042 | Serpentine Soil | RYGGRVKWKVVLAVGAIAGGALWFVRRRSRRAEQDAELWAEATDPIARFGES* |
| Ga0126311_100297883 | 3300010045 | Serpentine Soil | MVDVVKWKVALAVGALAGGALWFVRRKSRRAAEDAELWSEATDPVTRFGES* |
| Ga0126311_100330674 | 3300010045 | Serpentine Soil | VKWKVVLAVGAAAGGAYWYVWRKARRAESDAELWAEATDPIARFGDPDT* |
| Ga0105239_114088581 | 3300010375 | Corn Rhizosphere | AMVDRVKWKVVLAVGAVAGGTLWYVRRKSRRAAADAELWAEATDPITRFGDA* |
| Ga0138513_1000134561 | 3300011000 | Soil | LASDAINTAAKVDRVKWKVVLAVGAVAGGTFWYVRRKSRRAAADAELWAEATDPITRFGNA* |
| Ga0150985_1112563691 | 3300012212 | Avena Fatua Rhizosphere | VNWKLWVAVGALAGGAFWAARRRNNRVNADAERWAAATDPVARFGDV* |
| Ga0150984_1050751293 | 3300012469 | Avena Fatua Rhizosphere | GGAFWFVRRKSRRAAEDAELWSEATDPIARFGES* |
| Ga0157285_103510592 | 3300012897 | Soil | AKVDRVKWKVVLAVGAVAGGAFWYVRRKSRRTASEAELWAEATDPVTRFGES* |
| Ga0157301_100050963 | 3300012911 | Soil | KVVLAVGAVAGGAFWYVRRKSRRTASEAELWAEATDPVTRFGDS* |
| Ga0162651_1000129651 | 3300012938 | Soil | GGRVKWKVVVAVGAIAGGALWFVRRRSRRAEADAELWAEATDPIARFGDS* |
| Ga0162651_1000571342 | 3300012938 | Soil | VLAAGAVAGGALWFVRRRSRRAADEAELWAEATDPIARFGES* |
| Ga0157375_106148552 | 3300013308 | Miscanthus Rhizosphere | VKWKLWLAVGALAGGVYWVARRRNRVNADAELWADATDPVARFGDS* |
| Ga0132258_101029071 | 3300015371 | Arabidopsis Rhizosphere | VKWKVVLAIGAVAGGAFWYVRRKSRRAEADAELWAEATDPITRFGDA* |
| Ga0132258_104657822 | 3300015371 | Arabidopsis Rhizosphere | VKWKEVLAIGAVAGGAFWYVRRKSRRAEADAELWAEATDPITRFGDA* |
| Ga0132258_105765252 | 3300015371 | Arabidopsis Rhizosphere | LASAAINTAAKVDRVKWKVVFAVGAVAGGAFWYVRRKSRRTAAEAELWAEATDPVTRFGES* |
| Ga0132258_122172281 | 3300015371 | Arabidopsis Rhizosphere | MVDRVRWKVVLAVGAVAGGALWYVRRKSRRTAADAEL |
| Ga0132256_1022998721 | 3300015372 | Arabidopsis Rhizosphere | IGAVAGGAFWYVRRKSRRAEADAELWAEATDPITRFGDA* |
| Ga0132257_1024596121 | 3300015373 | Arabidopsis Rhizosphere | RVKWKVVLAIGAVAGGAFWYVRRKSRRAEADAELWAEATDPITRFGDA* |
| Ga0132255_1024314493 | 3300015374 | Arabidopsis Rhizosphere | ALAIGAVAGGAVWYVRRKSRRAEADAELWAEATDPITRFGNA* |
| Ga0132255_1054294751 | 3300015374 | Arabidopsis Rhizosphere | KVVLAIGAVAGGAFWYVRRKSRRAEADAELWAEATDPITRFGDA* |
| Ga0163161_100571843 | 3300017792 | Switchgrass Rhizosphere | VKWKVALAIGAVAGGAVWYVRRKSRRAEADAELWAE |
| Ga0163161_103007002 | 3300017792 | Switchgrass Rhizosphere | KWKVALAIGAVAGGAVWYVRRKSRRAEADAELWAEATDPITRFGNA |
| Ga0163161_115096402 | 3300017792 | Switchgrass Rhizosphere | WKVALAIGAVAGGAVWYVRRKSRRAEADAELWAEATDPIIRFGNA |
| Ga0190266_101436553 | 3300017965 | Soil | MVDVVKWKVALAVGALAGGALWFVRRKSRQAAEDAELWSEATDPVTRFGDT |
| Ga0190266_109462251 | 3300017965 | Soil | MVLAVGAVAGGALWFVRRKARRAAAEAELWEEATDPIARFGET |
| Ga0184605_104244161 | 3300018027 | Groundwater Sediment | VKWKVVLAVGAVAGGAFWYVRRKSRRAEADAELWAEATDPITRFGDA |
| Ga0184634_102498181 | 3300018031 | Groundwater Sediment | MVDRVKWKVVLAVGAVAGGTLWYVRRKSRRAAADAELWA |
| Ga0184619_102827331 | 3300018061 | Groundwater Sediment | VKWKVMLAVGAVAGGAFWYVRRKSRRAEADAELWAEATDPITRFGDA |
| Ga0184617_10234193 | 3300018066 | Groundwater Sediment | VKWKVVLAVGAVAGGAFWFVRRKSRRAADEAELWAEATDPIARFGES |
| Ga0184624_100320252 | 3300018073 | Groundwater Sediment | MVERVKWKVVVAVGAVAGGALWFVRRKSRQAAADAELWAEATDPIARFGES |
| Ga0184609_104893672 | 3300018076 | Groundwater Sediment | MAAMVDRVKWKVVLAVGAVAGGTLWYVRRKSRRAAADAELWAEATDPITRFGDA |
| Ga0184639_100881132 | 3300018082 | Groundwater Sediment | VKWKVVLAVGAVAGGALWFVRRKSRRAADEAELWAEATDPIARFGES |
| Ga0184639_105150822 | 3300018082 | Groundwater Sediment | VDRVKWKVVVAVGAVAGGALWFVRRKSRQAAADAELWAEATDPIARFGES |
| Ga0190272_111512972 | 3300018429 | Soil | VKWKLWIAIGALTSGAFWIARRKNKINADAELWAEATDPVARFGDA |
| Ga0190275_105929552 | 3300018432 | Soil | VKWKLWVAVGALAGGAIWVARRKNKVNADAELWAEATDPVARFGDA |
| Ga0190268_100542192 | 3300018466 | Soil | MVDLVKWKMAVAVGALAGGALWFVRRKSRRAAEDAELWSEATDPVTRFGES |
| Ga0190268_101900822 | 3300018466 | Soil | MVDRVKWKVAIAVGAVAGGALWFARRKSRRAAADAELWAEATDPIARFGDA |
| Ga0190268_113453372 | 3300018466 | Soil | MVLAVGAVAGGAVWFARRKSRRAAAEAELWAEATDPIARFGES |
| Ga0190270_100930992 | 3300018469 | Soil | VKWKVVVAVGAVAGGALWFVRRKSRQAAADAELWAEATDPIARFGES |
| Ga0190274_119478002 | 3300018476 | Soil | VKWKVWLAVGALAGGAYWVARRRNRVNADAELWAEATDPVARFGDA |
| Ga0190271_107486822 | 3300018481 | Soil | AVGAVAGGALWFARRKSRRAAADAELWAEATDPIARFGDA |
| Ga0190271_112385353 | 3300018481 | Soil | VDRVKWKVAVAVGAIAGGALWFVRRKSRQAAADAELWAEATDPIARFGES |
| Ga0190271_121328102 | 3300018481 | Soil | VKWKLWLAVGALAGGAYWVARRRNRVNADAELWAEATDPVARFGEA |
| Ga0190271_133557072 | 3300018481 | Soil | VKWKLWVAVGALAGGAFWVARRKNKVNADAELWAEATDPVARFGDA |
| Ga0184642_15546442 | 3300019279 | Groundwater Sediment | VAVGAIAGGALWFVRRRSRRAEADAELWAEATDPIARFGDS |
| Ga0190267_107738432 | 3300019767 | Soil | MVLAVGAVAGGALWFVRRKSRRAAAEAELWAEATDPIARFGET |
| Ga0190267_109321492 | 3300019767 | Soil | VKWKLWVAVGALAGGAVWVARRRNRVNDGAELWASATDPVTRFGDADDS |
| Ga0190267_113328372 | 3300019767 | Soil | AGGALWFVRRRSRRVADEAELWAEATDPIARFGES |
| Ga0193705_10046122 | 3300019869 | Soil | MVDRVKWKVVLAVGAVAGGTLWYVRRKSRRAAADAELWAEATDPITRFGDA |
| Ga0193700_10067062 | 3300019873 | Soil | VKWKVVLAVGAVAGGTLWYVRRKSRRAASDAELWAEATDPITRFGDA |
| Ga0193700_10438811 | 3300019873 | Soil | MVDRVKWKVVLAVGAVAGGTLWYVRRKSRRAASDAELWAKA |
| Ga0210381_102191151 | 3300021078 | Groundwater Sediment | SVAKVGRVKWKVVLAVGAVAGGAFWYVRRKSRRAETDAELWAEATDPITRFGDA |
| Ga0222621_10507961 | 3300021510 | Groundwater Sediment | WKVVLAVGAVAGGALWFVRRKSRRAADEAELWAEATDPIARFGES |
| Ga0222623_102078521 | 3300022694 | Groundwater Sediment | VKWKVVLAVGAVAGGAFWYVRRKSRRAETDAELWAEATDPITRFGDA |
| Ga0222623_102220001 | 3300022694 | Groundwater Sediment | AGGALWFVRRKSRRAADEAELWAEATDPIARFGES |
| Ga0222622_102120281 | 3300022756 | Groundwater Sediment | VVLAVGAVAGGAFWYVRRKSRRAETDAELWAEATDPITRFGDS |
| Ga0222622_102167853 | 3300022756 | Groundwater Sediment | MVDRVKWKVVLAVGAVAGGTLWYVRRKSRRAASDAELWAEATDPITRFGDA |
| Ga0222622_103768391 | 3300022756 | Groundwater Sediment | NHRTAMVDRVKWKVAVAVGAVAGGALWFARRKSRRAAADAELWAEATDPIARFGDS |
| Ga0193714_10635261 | 3300023058 | Soil | MAAMVDRVKWKVVLAVGAVAGGTLWYVRRKSRRAASDAELWAEATDPITRFGDA |
| Ga0207709_104009163 | 3300025935 | Miscanthus Rhizosphere | VKWKVALAIGAVAGGAVWYVRRKSRRAEADAELWAEATDPIIRFGNA |
| Ga0207709_105148321 | 3300025935 | Miscanthus Rhizosphere | AVAGGAVWYVRRKSRRAEADAELWAEATDPIIRFGNA |
| Ga0207669_101409262 | 3300025937 | Miscanthus Rhizosphere | VKWKLWLAVGALAGGAYWVARRRNRVNADAELWAEATDPVARFGDA |
| Ga0207712_110870191 | 3300025961 | Switchgrass Rhizosphere | LAVGAVAGGTLWYVRRKSRRAAADAELWAEATDPITRFGDA |
| Ga0207712_117724722 | 3300025961 | Switchgrass Rhizosphere | TNSVAKVGRVKWKVVLAVGAVAGGAFWYVRRKSRRAEADAELWAEATDPITRFGDA |
| Ga0207981_10485471 | 3300027560 | Soil | TVAKVGRVKWKVVLAVGAVAGGAFWYVRRKSRRAEADAELWAEATDPITRFGDA |
| Ga0209814_101762591 | 3300027873 | Populus Rhizosphere | AGGAVWYVRRKSRRAEADAELWAEATDPITRFGNA |
| Ga0207428_100045973 | 3300027907 | Populus Rhizosphere | VKWKVVLAAGAIAGGAFWFVRRKSRRAAEDAELWSEATDPIVRFGES |
| Ga0247820_110100852 | 3300028597 | Soil | VPADGYGGPVKWKLWLAVGALAGGAFWVARRRNNRVNADAELWAEATDPVARFGDA |
| Ga0247819_103324383 | 3300028608 | Soil | GRVKWKVALAIGAVAGGAVWYVRRKSRRAEADAELWAEATDPITRFGNA |
| Ga0307291_10040971 | 3300028707 | Soil | CRYGGRVKWKVVVAVGAIAGGALWFVRRRSRRAEADAELWAEATDPIARFGDS |
| Ga0307291_10494741 | 3300028707 | Soil | WKVVLAVGAVAGGTLWYVRRKSRRAASDAELWAEATDPITRFGDA |
| Ga0307311_102297751 | 3300028716 | Soil | VLAVGAVAGGTLWYVRRKSRRAASDAELWAEATDPITRFGDA |
| Ga0307307_100020771 | 3300028718 | Soil | VVVAVGAIAGGALWFVRRRSRRAEADAELWAEATDPIARFGDS |
| Ga0307301_100058834 | 3300028719 | Soil | AAPASPATPSIQAAMVDRVKWKVVLAVGAVAGGTLWYVRRKSRRAAADAELWAEATDPITRFGDA |
| Ga0307319_100237962 | 3300028722 | Soil | MALAVGAIAGGALWFVRRRSRRAEEDAELWAEATDPITRFGDT |
| Ga0307288_100365953 | 3300028778 | Soil | PTKSVAKVGRVKWKVVLAVGAVAGGAFWYVRRKSRRAETDAELWAEATDPITRFGDA |
| Ga0307289_100963951 | 3300028875 | Soil | VDRVKWKVVLAVGAVAGGTLWYVRRKSRRAAADAELWAEATDPITRFGDA |
| Ga0307286_103696262 | 3300028876 | Soil | MAAMVDRVKWKVVLAVGAVAGGTLWYVRRKSRRAASDAELWA |
| Ga0268240_100896752 | 3300030496 | Soil | MVDVVKWKVVLAVGALAGGALWFVRRKSRQAAEDAELWSEATDPVTRFGES |
| Ga0308206_10739941 | 3300030903 | Soil | RVKWKVVVAVGAIAGGALWFVRRRSRRAEADAELWAEATDPIARFGDS |
| Ga0308200_11300931 | 3300030905 | Soil | LAVGAVAGGTLWYVRRKSRRAASDAELWAEATDPITRFGDA |
| Ga0308196_10737821 | 3300030989 | Soil | AGGTLWYVRRKSRRAASDAELWAEATDPITRFGDA |
| Ga0308192_10700881 | 3300031082 | Soil | AVAGGTLWYVRRKSRRAASDAELWAEATDPITRFGDA |
| Ga0308201_101706252 | 3300031091 | Soil | RLGAVAGGALWFVRRKSRRAADEAELWAEATDPIARFGES |
| Ga0308204_102511492 | 3300031092 | Soil | RYCGRVKWKVVVAAGAIAGGALWFVRRRSRRAEADAELWAEATDPIARFGDS |
| Ga0308204_102542652 | 3300031092 | Soil | MALAVGAIAGGALWFVRRRSRRAEEDAELWAEATDSITRFGDT |
| Ga0308187_100787562 | 3300031114 | Soil | RVKWKMALAVGAIAGGALWFVRRRSRRAEEDAELWAEATDPITRFGDT |
| Ga0307499_100273791 | 3300031184 | Soil | TPSIQAAMVDRVKWKVVLAVGAVAGGTLWYVRRKSRRAASDAELWAEATDPITRFGDA |
| Ga0272427_10152776 | 3300031454 | Rock | MNWKVLLAVGAVAGGVVLAARHRSRRDDAEGAQWAEATDPVARFGDA |
| Ga0307405_100011314 | 3300031731 | Rhizosphere | VKWKMALAVGAIAGGALWFVRRRSRRAEEDAELWAEATDPITRFGDT |
| Ga0307405_101435822 | 3300031731 | Rhizosphere | VKWKVVLAVGAAAGGAYWYVWRKARRAESDAELWAEATDPIARFGDPDT |
| Ga0307468_1014116321 | 3300031740 | Hardwood Forest Soil | DRVKWKVVLAVGAVAGGTLWYVRRKSRRAAADAELWAEATDPITRFGDA |
| Ga0307410_100005315 | 3300031852 | Rhizosphere | VKWKVVLAVGAIAGGALWFVRRRSRRAEQDAELWAEATDPIARFGES |
| Ga0307406_103068872 | 3300031901 | Rhizosphere | MVDVVKWKVALAVGALAGGAMWFVRRKSRRAAEDAELWSEATDPVTRFGES |
| Ga0307414_100164318 | 3300032004 | Rhizosphere | WKVVLAVGAIAGGALWFVRRRSRRAEQDAELWAEATDPIARFGES |
| Ga0307415_1010548351 | 3300032126 | Rhizosphere | YGGRVKWKVVLAVGAIAGGALWFVRRRSRRAEQDAELWAEATDPIARFGES |
| Ga0314798_104014_95_262 | 3300034673 | Soil | VPADGYGGPVKWKLWLAVGALAGGAYWVARRRNRVNADAELWAEATDPVARFGEA |
| ⦗Top⦘ |