| Basic Information | |
|---|---|
| Family ID | F036858 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 169 |
| Average Sequence Length | 44 residues |
| Representative Sequence | PGQHVGLQTDDAQALYESLGFEQQPEFWSLVVGTWLDNDANR |
| Number of Associated Samples | 161 |
| Number of Associated Scaffolds | 169 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 7.14 % |
| % of genes near scaffold ends (potentially truncated) | 92.90 % |
| % of genes from short scaffolds (< 2000 bps) | 95.86 % |
| Associated GOLD sequencing projects | 157 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.249 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.834 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.036 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.870 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.00% β-sheet: 0.00% Coil/Unstructured: 70.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 169 Family Scaffolds |
|---|---|---|
| PF01872 | RibD_C | 12.43 |
| PF01565 | FAD_binding_4 | 7.10 |
| PF00962 | A_deaminase | 6.51 |
| PF01633 | Choline_kinase | 4.14 |
| PF04029 | 2-ph_phosp | 3.55 |
| PF13673 | Acetyltransf_10 | 2.37 |
| PF00211 | Guanylate_cyc | 1.78 |
| PF02515 | CoA_transf_3 | 1.78 |
| PF00248 | Aldo_ket_red | 1.18 |
| PF12806 | Acyl-CoA_dh_C | 1.18 |
| PF07883 | Cupin_2 | 1.18 |
| PF09348 | DUF1990 | 1.18 |
| PF02979 | NHase_alpha | 1.18 |
| PF01694 | Rhomboid | 1.18 |
| PF00027 | cNMP_binding | 1.18 |
| PF00583 | Acetyltransf_1 | 1.18 |
| PF01520 | Amidase_3 | 1.18 |
| PF00528 | BPD_transp_1 | 0.59 |
| PF00919 | UPF0004 | 0.59 |
| PF13742 | tRNA_anti_2 | 0.59 |
| PF00268 | Ribonuc_red_sm | 0.59 |
| PF12138 | Spherulin4 | 0.59 |
| PF01022 | HTH_5 | 0.59 |
| PF02482 | Ribosomal_S30AE | 0.59 |
| PF03772 | Competence | 0.59 |
| PF00484 | Pro_CA | 0.59 |
| PF13340 | DUF4096 | 0.59 |
| PF08240 | ADH_N | 0.59 |
| PF13193 | AMP-binding_C | 0.59 |
| PF02367 | TsaE | 0.59 |
| PF02882 | THF_DHG_CYH_C | 0.59 |
| PF13185 | GAF_2 | 0.59 |
| PF01039 | Carboxyl_trans | 0.59 |
| PF00817 | IMS | 0.59 |
| PF00440 | TetR_N | 0.59 |
| PF01925 | TauE | 0.59 |
| PF00106 | adh_short | 0.59 |
| PF06441 | EHN | 0.59 |
| PF00196 | GerE | 0.59 |
| PF14698 | ASL_C2 | 0.59 |
| PF00682 | HMGL-like | 0.59 |
| PF13376 | OmdA | 0.59 |
| PF00293 | NUDIX | 0.59 |
| PF08031 | BBE | 0.59 |
| PF13602 | ADH_zinc_N_2 | 0.59 |
| PF01243 | Putative_PNPOx | 0.59 |
| PF13087 | AAA_12 | 0.59 |
| PF02371 | Transposase_20 | 0.59 |
| PF02826 | 2-Hacid_dh_C | 0.59 |
| PF04978 | DUF664 | 0.59 |
| PF13419 | HAD_2 | 0.59 |
| PF04455 | Saccharop_dh_N | 0.59 |
| COG ID | Name | Functional Category | % Frequency in 169 Family Scaffolds |
|---|---|---|---|
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 12.43 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 12.43 |
| COG2045 | Phosphosulfolactate phosphohydrolase or related enzyme | Coenzyme transport and metabolism [H] | 7.10 |
| COG1816 | Adenosine/6-amino-6-deoxyfutalosine deaminase | Nucleotide transport and metabolism [F] | 6.51 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.78 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 1.78 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 1.18 |
| COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 1.18 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.59 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.59 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.59 |
| COG1915 | Uncharacterized conserved protein AF1278, contains saccharopine dehydrogenase N-terminal (SDHN) domain | Function unknown [S] | 0.59 |
| COG1544 | Ribosome-associated translation inhibitor RaiA | Translation, ribosomal structure and biogenesis [J] | 0.59 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.59 |
| COG0802 | tRNA A37 threonylcarbamoyladenosine biosynthesis protein TsaE | Translation, ribosomal structure and biogenesis [J] | 0.59 |
| COG0190 | 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase | Coenzyme transport and metabolism [H] | 0.59 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.59 |
| COG0686 | Alanine dehydrogenase (includes sporulation protein SpoVN) | Amino acid transport and metabolism [E] | 0.59 |
| COG0658 | DNA uptake channel protein ComEC, N-terminal domain | Intracellular trafficking, secretion, and vesicular transport [U] | 0.59 |
| COG0621 | tRNA A37 methylthiotransferase MiaB | Translation, ribosomal structure and biogenesis [J] | 0.59 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.59 |
| COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 0.59 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.59 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.59 |
| COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 0.59 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.25 % |
| Unclassified | root | N/A | 17.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig1324555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 629 | Open in IMG/M |
| 2140918006|ConsensusfromContig71394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 628 | Open in IMG/M |
| 2170459003|FZ032L002JT28D | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 512 | Open in IMG/M |
| 3300000956|JGI10216J12902_108619961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 556 | Open in IMG/M |
| 3300001538|A10PFW1_10901201 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300002122|C687J26623_10035074 | Not Available | 1344 | Open in IMG/M |
| 3300004480|Ga0062592_102159027 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300005093|Ga0062594_102068021 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300005177|Ga0066690_10537019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 784 | Open in IMG/M |
| 3300005187|Ga0066675_11248077 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300005341|Ga0070691_11031335 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300005345|Ga0070692_10444108 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300005347|Ga0070668_101573146 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300005436|Ga0070713_102384426 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300005458|Ga0070681_11996929 | Not Available | 508 | Open in IMG/M |
| 3300005529|Ga0070741_11135351 | All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Candidatus Omnitrophica bacterium CG11_big_fil_rev_8_21_14_0_20_63_9 | 662 | Open in IMG/M |
| 3300005543|Ga0070672_100123008 | All Organisms → cellular organisms → Bacteria | 2126 | Open in IMG/M |
| 3300005546|Ga0070696_101479842 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005577|Ga0068857_101241493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 722 | Open in IMG/M |
| 3300005578|Ga0068854_100558419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 972 | Open in IMG/M |
| 3300005615|Ga0070702_100841465 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300005616|Ga0068852_101408662 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300005764|Ga0066903_103155624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 892 | Open in IMG/M |
| 3300005994|Ga0066789_10100211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1244 | Open in IMG/M |
| 3300006052|Ga0075029_100924544 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300006059|Ga0075017_101108244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 618 | Open in IMG/M |
| 3300006102|Ga0075015_100095452 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
| 3300006102|Ga0075015_100677729 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300006174|Ga0075014_100545845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 655 | Open in IMG/M |
| 3300006175|Ga0070712_101722049 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300006794|Ga0066658_10124606 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300006806|Ga0079220_10850298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 699 | Open in IMG/M |
| 3300006852|Ga0075433_11032410 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300006904|Ga0075424_100362498 | All Organisms → cellular organisms → Bacteria | 1544 | Open in IMG/M |
| 3300006953|Ga0074063_11920086 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300009012|Ga0066710_103484904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 596 | Open in IMG/M |
| 3300009101|Ga0105247_10567769 | Not Available | 836 | Open in IMG/M |
| 3300009101|Ga0105247_11354881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
| 3300009174|Ga0105241_11178281 | Not Available | 725 | Open in IMG/M |
| 3300009176|Ga0105242_10359910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1346 | Open in IMG/M |
| 3300009177|Ga0105248_11557790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 748 | Open in IMG/M |
| 3300009177|Ga0105248_12018889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 655 | Open in IMG/M |
| 3300009524|Ga0116225_1421598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 593 | Open in IMG/M |
| 3300009801|Ga0105056_1070431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
| 3300009811|Ga0105084_1083101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 592 | Open in IMG/M |
| 3300009824|Ga0116219_10129695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1464 | Open in IMG/M |
| 3300009870|Ga0131092_11485948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
| 3300010040|Ga0126308_10784683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 659 | Open in IMG/M |
| 3300010044|Ga0126310_11700745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
| 3300010048|Ga0126373_12162569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 618 | Open in IMG/M |
| 3300010166|Ga0126306_11534840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 553 | Open in IMG/M |
| 3300010359|Ga0126376_10446539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1180 | Open in IMG/M |
| 3300010373|Ga0134128_12353015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 587 | Open in IMG/M |
| 3300010375|Ga0105239_12154897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 648 | Open in IMG/M |
| 3300010376|Ga0126381_104599601 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300010396|Ga0134126_12397685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
| 3300010399|Ga0134127_12454613 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300010403|Ga0134123_10773266 | Not Available | 950 | Open in IMG/M |
| 3300011439|Ga0137432_1217953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 617 | Open in IMG/M |
| 3300011969|Ga0120166_1003792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2810 | Open in IMG/M |
| 3300012206|Ga0137380_10169087 | All Organisms → cellular organisms → Bacteria | 1991 | Open in IMG/M |
| 3300012351|Ga0137386_11017247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 589 | Open in IMG/M |
| 3300012359|Ga0137385_11057516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 669 | Open in IMG/M |
| 3300012469|Ga0150984_107796620 | Not Available | 590 | Open in IMG/M |
| 3300012668|Ga0157216_10200169 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300012897|Ga0157285_10217578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 610 | Open in IMG/M |
| 3300012903|Ga0157289_10155151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 710 | Open in IMG/M |
| 3300012955|Ga0164298_10915971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 639 | Open in IMG/M |
| 3300012986|Ga0164304_10681595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 778 | Open in IMG/M |
| 3300012987|Ga0164307_11001252 | Not Available | 680 | Open in IMG/M |
| 3300013296|Ga0157374_12112451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 590 | Open in IMG/M |
| 3300013297|Ga0157378_12747170 | Not Available | 545 | Open in IMG/M |
| 3300013306|Ga0163162_12696317 | Not Available | 572 | Open in IMG/M |
| 3300014157|Ga0134078_10229291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 770 | Open in IMG/M |
| 3300015189|Ga0167667_1112342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
| 3300015371|Ga0132258_11852383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1520 | Open in IMG/M |
| 3300015371|Ga0132258_12744935 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
| 3300015372|Ga0132256_100399642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1476 | Open in IMG/M |
| 3300015372|Ga0132256_101937694 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300015373|Ga0132257_102528786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 667 | Open in IMG/M |
| 3300015374|Ga0132255_102236492 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Mucilaginibacter → unclassified Mucilaginibacter → Mucilaginibacter sp. L294 | 834 | Open in IMG/M |
| 3300017959|Ga0187779_10132690 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
| 3300018054|Ga0184621_10092379 | Not Available | 1063 | Open in IMG/M |
| 3300018058|Ga0187766_11482725 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300018060|Ga0187765_11081251 | Not Available | 555 | Open in IMG/M |
| 3300018073|Ga0184624_10041166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1834 | Open in IMG/M |
| 3300018089|Ga0187774_11266781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 532 | Open in IMG/M |
| 3300018431|Ga0066655_10707014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 682 | Open in IMG/M |
| 3300018432|Ga0190275_10978355 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300018465|Ga0190269_10280729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 958 | Open in IMG/M |
| 3300018469|Ga0190270_12268225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 604 | Open in IMG/M |
| 3300018476|Ga0190274_10827828 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300018476|Ga0190274_13887373 | Not Available | 506 | Open in IMG/M |
| 3300020005|Ga0193697_1076491 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300020016|Ga0193696_1164433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 539 | Open in IMG/M |
| 3300020069|Ga0197907_11137615 | Not Available | 640 | Open in IMG/M |
| 3300020082|Ga0206353_10990024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1029 | Open in IMG/M |
| 3300021078|Ga0210381_10392111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 3300021358|Ga0213873_10005812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2391 | Open in IMG/M |
| 3300021372|Ga0213877_10000273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8396 | Open in IMG/M |
| 3300021559|Ga0210409_10703538 | Not Available | 882 | Open in IMG/M |
| 3300022915|Ga0247790_10216168 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300025159|Ga0209619_10458339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 642 | Open in IMG/M |
| 3300025703|Ga0208357_1035828 | Not Available | 1720 | Open in IMG/M |
| 3300025907|Ga0207645_10882498 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300025917|Ga0207660_10452856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1038 | Open in IMG/M |
| 3300025925|Ga0207650_11035507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 698 | Open in IMG/M |
| 3300025928|Ga0207700_11356909 | Not Available | 633 | Open in IMG/M |
| 3300025937|Ga0207669_10295262 | Not Available | 1229 | Open in IMG/M |
| 3300025945|Ga0207679_11415691 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300025994|Ga0208142_1008996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 989 | Open in IMG/M |
| 3300026021|Ga0208140_1046895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 572 | Open in IMG/M |
| 3300026095|Ga0207676_10123649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2186 | Open in IMG/M |
| 3300026118|Ga0207675_101664027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 658 | Open in IMG/M |
| 3300026121|Ga0207683_10571125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 1046 | Open in IMG/M |
| 3300026515|Ga0257158_1104992 | Not Available | 560 | Open in IMG/M |
| 3300027497|Ga0208199_1017993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1591 | Open in IMG/M |
| 3300027560|Ga0207981_1037858 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300027765|Ga0209073_10312495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 625 | Open in IMG/M |
| 3300027843|Ga0209798_10326498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 730 | Open in IMG/M |
| 3300027894|Ga0209068_10875087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 531 | Open in IMG/M |
| 3300028380|Ga0268265_12516697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 521 | Open in IMG/M |
| 3300028381|Ga0268264_11713685 | Not Available | 639 | Open in IMG/M |
| 3300028590|Ga0247823_10933840 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300028592|Ga0247822_10471810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 989 | Open in IMG/M |
| 3300028597|Ga0247820_10511666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 819 | Open in IMG/M |
| 3300028744|Ga0307318_10146577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. VF16 | 809 | Open in IMG/M |
| 3300028790|Ga0307283_10015166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1545 | Open in IMG/M |
| 3300028807|Ga0307305_10134428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1142 | Open in IMG/M |
| 3300028812|Ga0247825_10214821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1331 | Open in IMG/M |
| 3300028819|Ga0307296_10632779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 585 | Open in IMG/M |
| 3300028875|Ga0307289_10099926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1184 | Open in IMG/M |
| 3300028876|Ga0307286_10128666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 900 | Open in IMG/M |
| 3300028878|Ga0307278_10268143 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300028889|Ga0247827_10187092 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300028889|Ga0247827_10903130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 593 | Open in IMG/M |
| 3300029945|Ga0311330_10346223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1257 | Open in IMG/M |
| 3300030225|Ga0302196_10031790 | Not Available | 3786 | Open in IMG/M |
| 3300030336|Ga0247826_11557078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
| 3300031170|Ga0307498_10107120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 870 | Open in IMG/M |
| 3300031548|Ga0307408_101667610 | Not Available | 607 | Open in IMG/M |
| 3300031549|Ga0318571_10265962 | Not Available | 635 | Open in IMG/M |
| 3300031562|Ga0310886_10106622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1407 | Open in IMG/M |
| 3300031640|Ga0318555_10368155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 779 | Open in IMG/M |
| 3300031670|Ga0307374_10518226 | Not Available | 634 | Open in IMG/M |
| 3300031672|Ga0307373_10271389 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300031726|Ga0302321_102206164 | Not Available | 641 | Open in IMG/M |
| 3300031781|Ga0318547_10848148 | Not Available | 570 | Open in IMG/M |
| 3300031832|Ga0318499_10399218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 526 | Open in IMG/M |
| 3300031942|Ga0310916_10989953 | Not Available | 702 | Open in IMG/M |
| 3300032000|Ga0310903_10566413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
| 3300032002|Ga0307416_100410886 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
| 3300032013|Ga0310906_10109391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1534 | Open in IMG/M |
| 3300032017|Ga0310899_10247986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. VF16 | 808 | Open in IMG/M |
| 3300032075|Ga0310890_10788762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 751 | Open in IMG/M |
| 3300032160|Ga0311301_10445606 | Not Available | 1953 | Open in IMG/M |
| 3300032177|Ga0315276_12399685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 530 | Open in IMG/M |
| 3300032401|Ga0315275_12320670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 559 | Open in IMG/M |
| 3300032515|Ga0348332_11467888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 550 | Open in IMG/M |
| 3300032782|Ga0335082_10898323 | Not Available | 749 | Open in IMG/M |
| 3300032829|Ga0335070_10878130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 831 | Open in IMG/M |
| 3300033289|Ga0310914_11442107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 591 | Open in IMG/M |
| 3300033417|Ga0214471_10482640 | Not Available | 993 | Open in IMG/M |
| 3300033550|Ga0247829_11339770 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300033550|Ga0247829_11620452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
| 3300033982|Ga0371487_0210422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 923 | Open in IMG/M |
| 3300033983|Ga0371488_0110671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1503 | Open in IMG/M |
| 3300034149|Ga0364929_0122739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 830 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 8.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.73% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.14% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.55% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.37% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.37% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.37% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.78% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.78% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.78% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.78% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.18% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.18% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.18% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.18% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.18% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.18% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.18% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.18% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.18% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.18% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.18% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.18% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.18% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.18% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.18% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.18% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.18% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.18% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.18% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.59% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.59% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.59% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.59% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.59% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.59% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.59% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.59% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.59% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.59% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.59% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.59% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.59% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2140918006 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1 | Environmental | Open in IMG/M |
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002122 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
| 3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
| 3300011969 | Permafrost microbial communities from Nunavut, Canada - A23_80cm_12M | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015189 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb2a, glacial moraine) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
| 3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
| 3300025703 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F52-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025994 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 (SPAdes) | Environmental | Open in IMG/M |
| 3300026021 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030225 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031672 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-2 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033982 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction | Environmental | Open in IMG/M |
| 3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_08196990 | 2124908045 | Soil | GQHVGLQTDNAQDFYASLGFQPQPEFWSIVVGSWLDNAANRDAL |
| P1_C_00690050 | 2140918006 | Soil | MVRLLLDQVPGQHVGLQTDEARQLYESLGFRAQPEFSSLVVGTWLDNDANR |
| E4A_10823240 | 2170459003 | Grass Soil | HIGLQTDDSQDFYRSLRYAPQPEFWSLVVGRWLDNDANR |
| JGI10216J12902_1086199612 | 3300000956 | Soil | APEFYASLGFAPQPEFWSIIVGTWLDNEANRASA* |
| A10PFW1_109012012 | 3300001538 | Permafrost | GIASAMVRLLLDCVPGQHVGLQTDEARQLYESLAFRAQPEFWSRVSGTWLDNGA |
| C687J26623_100350744 | 3300002122 | Soil | MIRRLLDEVPGQHVGLQTHDAQALYESLGFRPQPEFWSLVVGSWLDNDANR* |
| Ga0062592_1021590271 | 3300004480 | Soil | RVPGQHVGLQTDDMQDFYASLGFEHQPQFWSLVVGEWLENEANR* |
| Ga0062594_1020680211 | 3300005093 | Soil | QHIGLQTDNAQAFYASLGFRAQPEFLSLVVGEWLGNNANR* |
| Ga0066690_105370191 | 3300005177 | Soil | PGQHIGLQTDDQQAFYAALGYERQPEFWSLVSGRWLDNEANRRA* |
| Ga0066675_112480772 | 3300005187 | Soil | ADAVPGQHIGLQTDDQQAFYAALGYEPQPEFWSLVVGRWLDNDANR* |
| Ga0070691_110313351 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | HIGLQTDDARAFYASLGFEPQPEFLALVVGEWLDNDANR* |
| Ga0070692_104441081 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | VPGQHVGLQTDDMQPFYASLGFEHQPEFWSLVVGEWLDNEANR* |
| Ga0070668_1015731461 | 3300005347 | Switchgrass Rhizosphere | PGQHIGLQTDDAQELYAAVGFEPQPEFWSLVSGRWLDNDANRL* |
| Ga0070713_1023844262 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | PGQHIGLQTDEAQDFYRSLGYEPQPEFWSLVVGRWLDNDANR* |
| Ga0070681_119969291 | 3300005458 | Corn Rhizosphere | MVRHLLEMVPGQHVGLQADDAERFYESLGFKRQPEFWSCVVGSWLDNVANS* |
| Ga0070741_111353511 | 3300005529 | Surface Soil | GQHVGLQTDGGEALYASLGFKPQPEFWSTVVGSWLDNSANGR* |
| Ga0070672_1001230083 | 3300005543 | Miscanthus Rhizosphere | EAVPGQHVGLQTDDAQALYESVGFRQQPEFWSLVSGRWLDNDANRL* |
| Ga0070696_1014798422 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | PGQHVGLQTDDAQALYESLGFEQQPEFWSLVVGTWLDNDANR* |
| Ga0066670_108776572 | 3300005560 | Soil | RVPGQHIGLQTDDAVAFYTSLGFRPQPAFLSLVVGGWLDNEANR* |
| Ga0068857_1012414931 | 3300005577 | Corn Rhizosphere | VGLQTDDAQELYRSLGFEHQPEFWSQVVGTWLDNDANR* |
| Ga0068854_1005584192 | 3300005578 | Corn Rhizosphere | HIGLQTDDAQALYASLGFTPQPEFWSLVVGRWLDNDANR* |
| Ga0070702_1008414651 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | LLDDVPGQHVGLQTDDAQALYASLGFEPQPEFWSQVVGTWLDNDANT* |
| Ga0068852_1014086623 | 3300005616 | Corn Rhizosphere | HVGLQTDDRPDFYASLGFNPQPEFWSTVVGSWLDNAANRGAR* |
| Ga0066903_1031556243 | 3300005764 | Tropical Forest Soil | PGQHVGLQTDDAQRFYESLGFASQPEFWSCVEGSWLDNDANR* |
| Ga0066789_101002111 | 3300005994 | Soil | HLMGSVPGQHIGLQTDDAEHFYAGLGFHLQPQFMGLVVGGWLNNAGNR* |
| Ga0075029_1009245441 | 3300006052 | Watersheds | GLQTDDAQAFYRALGFRPQPEFMSMVVGTWLDNDANRG* |
| Ga0075017_1011082441 | 3300006059 | Watersheds | VEALCAAVPGQHVGLQTDESAFYESLGFRPQPEFMSRVVGGWLDNAANRP* |
| Ga0075015_1000954524 | 3300006102 | Watersheds | VVHLLDQVPGQHGGLQTDDAQPFYVSLGFDPRREFWSRVVGSWLENDANR* |
| Ga0075015_1006777291 | 3300006102 | Watersheds | IGLQTDDAEAFYESLGFRPQPTFMSAVVGRWLDNEANREPG* |
| Ga0075014_1005458451 | 3300006174 | Watersheds | GQHIGLQTDDARQFYASLGFRPQPEFWSYVVGEWLDNDANR* |
| Ga0070712_1017220492 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | TDDQAAFYTSLGFEPQPAFMSLVVGRWLDNDANR* |
| Ga0066658_101246062 | 3300006794 | Soil | GLQTDDAQALYETLGFRPQPEFWSLVVGQWLDNDANR* |
| Ga0079220_108502981 | 3300006806 | Agricultural Soil | HVGLQTDDAQALYETLGFHVQPEFWSTIVGAWLDNDGNRSDAG* |
| Ga0075433_110324101 | 3300006852 | Populus Rhizosphere | IASGMLRTLLDEVPGQHVGLQTDDAQELYRSLGFEPQPEFWSVVVGSWLDNDSNR* |
| Ga0075424_1003624983 | 3300006904 | Populus Rhizosphere | GMLRTLLDEVPGQHVGLQTDDAQELYRSLGFEPQPEFWSVVVGSWLDNDSNR* |
| Ga0074063_119200862 | 3300006953 | Soil | GIASSMVRLLLAAVPGQHVGLQTEDETDFYPSLGFQPQPAFWRTIVGTWLDNDANR* |
| Ga0066710_1034849043 | 3300009012 | Grasslands Soil | IGLQTDHAQALYQSLGYKPQPEFWSLVVGRWLDNDANR |
| Ga0105247_105677693 | 3300009101 | Switchgrass Rhizosphere | GLQTDDAQGFYARLGFRPQPEFLSLVVGEWLDNDANR* |
| Ga0105247_113548812 | 3300009101 | Switchgrass Rhizosphere | PGQHVGLQTDDMQAFYASLGFEHQPEFWSVVVGTWLGNEANR* |
| Ga0105241_111782811 | 3300009174 | Corn Rhizosphere | IGLQTDDQAAFYTSLGFEPQPAFMSLVVGRWLDNDANL* |
| Ga0105242_103599103 | 3300009176 | Miscanthus Rhizosphere | VGLQTDDRPDFYASLGFNPQPEFWSTVVGSWLDNAANRRAP* |
| Ga0105248_115577902 | 3300009177 | Switchgrass Rhizosphere | MMRHLLDRVPGQHVGLQTDDMQAFYASLGFEHQPEFWSVVVGRWLGNEANR* |
| Ga0105248_120188891 | 3300009177 | Switchgrass Rhizosphere | PGQHIGLQTDDAQELYRSLGYQPQPEFWSTVVGRWLDNDANR* |
| Ga0116225_14215981 | 3300009524 | Peatlands Soil | GQHIGLQTDDAGDFYRTLGFAPQPEFLSTVVGRWLDNPANR* |
| Ga0105056_10704311 | 3300009801 | Groundwater Sand | LQTNDAQALYESLGFRPQPEFWSVTSGTWLDNDANR* |
| Ga0105084_10831012 | 3300009811 | Groundwater Sand | MPGQHIGLQTNDAQALYESLGFRPQPEFWSVTSGTWLDNDANR* |
| Ga0116219_101296951 | 3300009824 | Peatlands Soil | ARVPGQHIGLQTNDTQPFYVALGFRTQPEFMSLVVGKWLDNEENGP* |
| Ga0131092_114859482 | 3300009870 | Activated Sludge | RRLLEQVPGQHVGLQTDDAQALYASLGFTPQPEFWSTVVGAWLENDANR* |
| Ga0126308_107846831 | 3300010040 | Serpentine Soil | QTDDAQALYASLGFQPQPEFWSLVPGRWLDNDGNR* |
| Ga0126310_117007452 | 3300010044 | Serpentine Soil | GLQTDDAQALYASLGFQPQPEFWSLVPGRWLDNDGNR* |
| Ga0126373_121625692 | 3300010048 | Tropical Forest Soil | PGQHIGLQTDDAQDFYRALGYAPQPEFWSLVVGHWLDNDANR* |
| Ga0126306_115348401 | 3300010166 | Serpentine Soil | NAVPGQHIGLQTDDAQALYASIGFRPQPEFWSLVSGRWLDNDANR* |
| Ga0126376_104465391 | 3300010359 | Tropical Forest Soil | ASAMIRALLDAVPGQHVGLQTDDAQELYRSLGFAPPPEFWSLVVGSWLDNDANR* |
| Ga0134128_123530153 | 3300010373 | Terrestrial Soil | GLQTDDAQALYESLGFKPQPEFWSLVVGRWLDNDANR* |
| Ga0105239_121548971 | 3300010375 | Corn Rhizosphere | MIRRLLAEVPGQHVGLQTDAAQALYESLGFREQPEFWSLIVGSWLDNDANR* |
| Ga0126381_1045996011 | 3300010376 | Tropical Forest Soil | HLLEQVPGQHVGLQTDHGRDFYTSLGFKPQPEFWSIVVGRWLDNPANRDPS* |
| Ga0134126_123976853 | 3300010396 | Terrestrial Soil | IGLQTDDAQALYESLGFKPQPEFWSLVVGRWLDNDANR* |
| Ga0134127_124546132 | 3300010399 | Terrestrial Soil | GLQTDDAQELYAAVGFEPQPEFWSLVSGRWLDNDANRL* |
| Ga0134123_107732661 | 3300010403 | Terrestrial Soil | IGLQTDDAQELYRSLGFRPQPEFWSLVVGGWLDNDANR* |
| Ga0137432_12179531 | 3300011439 | Soil | LDQVPGQHVGLQTDSAPELYRSLGFAPQPEFWSVVVGSWLDNEANRESA* |
| Ga0120166_10037922 | 3300011969 | Permafrost | MVRLLLDRVPGQHVGLQTDEARQLYESLAFRAQPEFWSRVSGTWLDNGANR* |
| Ga0137380_101690871 | 3300012206 | Vadose Zone Soil | VTSTGIPGQHVGLQTDQAQSFYAALGFQRQPHFMSVIVGAWLDNDANC* |
| Ga0137386_110172472 | 3300012351 | Vadose Zone Soil | GLQTDDAQRLYESLGFRPQPEFWSRVVGAWLDNDANR* |
| Ga0137385_110575161 | 3300012359 | Vadose Zone Soil | VPGQHIGLQTNNAQDFYRSLGYEPQPEFWSTVVGRWLDNDANR* |
| Ga0150984_1077966202 | 3300012469 | Avena Fatua Rhizosphere | TDAAQRLYESLGFRPQPEFWSAVAGTWLDNDANR* |
| Ga0157216_102001693 | 3300012668 | Glacier Forefield Soil | IASAMMRRLLDQVPGQHVGLQTDSAQELYRSLGFAPQPEFWSVVVGSWLDNDANRESA* |
| Ga0157285_102175782 | 3300012897 | Soil | VPGQHVGLQTDDMQAFYASLGFEHQPEFWSLVVGRWLDNDANR* |
| Ga0157289_101551512 | 3300012903 | Soil | LQTDDAQELYRALGFELQPEFWSFVVGRWLDNDANR* |
| Ga0164298_109159712 | 3300012955 | Soil | IGRLLEQVPGEHVGLQTDDAPAFYASLGFRPQPEFWSIVVGGWLENDANR* |
| Ga0164304_106815951 | 3300012986 | Soil | ASAMIGRLLEQVPGEHVGLQTDDAPAFYASLGFRPQPEFWSIVVGGWLENDANR* |
| Ga0164307_110012522 | 3300012987 | Soil | TDDQAAFYTALGFEPQPAFMSLVVGRWLDNDANR* |
| Ga0157374_121124512 | 3300013296 | Miscanthus Rhizosphere | GLQTDDMQAFYASLGFEHQPEFWSVVVGTWLGNDANR* |
| Ga0157378_127471701 | 3300013297 | Miscanthus Rhizosphere | HIGLQTDDQQAFYAALGFAPQPEFMALVVGDWLDNDANR* |
| Ga0163162_126963171 | 3300013306 | Switchgrass Rhizosphere | AVPGQHIGLQTDDAQALYASLGFKPQPEFWSLVVGTWLDNDANR* |
| Ga0134078_102292912 | 3300014157 | Grasslands Soil | EVPGQHVGLQTESAQDLYASLGFKPQPEFWSIVVGSWLDNAANRVAT* |
| Ga0167667_11123422 | 3300015189 | Glacier Forefield Soil | PGQHIALQTDDAQALYTGLGFRPQPELMSIVVGTWLDNDANRRIPTPRGDD* |
| Ga0132258_118523831 | 3300015371 | Arabidopsis Rhizosphere | VPGQHIGLQTDDAQALYESIGFRPQPEFWSLVSGRWLDNEANR* |
| Ga0132258_127449352 | 3300015371 | Arabidopsis Rhizosphere | MIQALLDEVPGQHVGLQTDDAQELYRSLGFEPQPEFWSLVVGSWLDNDANR* |
| Ga0132256_1003996422 | 3300015372 | Arabidopsis Rhizosphere | PGQHIGLQTDDAQALYESVGFRRQPEFWSLVSGRWLDNDANRL* |
| Ga0132256_1019376942 | 3300015372 | Arabidopsis Rhizosphere | LPEQVPGQHIGLQTDDAQRFYASLDFRPQPEFWSLVAGGWLDNDANR* |
| Ga0132257_1025287862 | 3300015373 | Arabidopsis Rhizosphere | VGLQTEDAQELYRSLGFAPQPEFWSLVVGSWLGNDANR* |
| Ga0132255_1022364923 | 3300015374 | Arabidopsis Rhizosphere | GLQADDRQDFYASLGFTPQPEFWSIVVGSSLDNAANHDAR* |
| Ga0187779_101326901 | 3300017959 | Tropical Peatland | IGLQTDDAESFYLSLGFRPQPRFFSRVVGSWLDNPANATEPGGTGPRHE |
| Ga0184621_100923792 | 3300018054 | Groundwater Sediment | QHVGLQTDDAQKLYESVGFRAQPEFWSLVVGSCLDNDANRGAT |
| Ga0187766_114827251 | 3300018058 | Tropical Peatland | PGQHIGLQTDDAESFYLSLGFRPQPRFFSRVVGSWLDNPANATEPGGTGPRHE |
| Ga0187765_110812511 | 3300018060 | Tropical Peatland | VAGQHVGLQTSEAQGLYEALGFRPQPEFWSTVVGTWLDNDGNRSR |
| Ga0184624_100411666 | 3300018073 | Groundwater Sediment | QTDDAQKLYESIGFRAQPEFWSLVVGSWLDNDASRGET |
| Ga0187774_112667811 | 3300018089 | Tropical Peatland | TRLVEMLAAEVPGQHVGLQTDDSQAFYAALGFAPQPEFWARVSGRWPENDANG |
| Ga0066655_107070141 | 3300018431 | Grasslands Soil | MLCDAVPGQHVGLQTNDAQALYKSLGFEPQPEFWSLVVGRWLDNDANRA |
| Ga0190275_109783552 | 3300018432 | Soil | LQTDAAQELYRSLGFHPQPEFWSRVSGAWLDNEGNR |
| Ga0190269_102807293 | 3300018465 | Soil | RLVEAVPGQHVGLQTDSAQDLYRGLGFRPQPEFLSLVSGRWLDNEANR |
| Ga0190270_122682251 | 3300018469 | Soil | VRFLADQVPGQHIGLQTDDAQALYASLGFRAQPEFLSLVVGEWLGNNANR |
| Ga0190274_108278281 | 3300018476 | Soil | LADQVPGQHIGLQTDDAQAFYATLGFRAQPEFLSLVVGEWLGNNANR |
| Ga0190274_138873731 | 3300018476 | Soil | GQHIGLQTADAQALSESVGFRPQPEFWALVSGRWLDNDANRL |
| Ga0193697_10764913 | 3300020005 | Soil | TDSAPKFYKSLGFAPQPEFWSLVVGSWLDNDANREAS |
| Ga0193696_11644332 | 3300020016 | Soil | LQTDSAPAFYKSLGFAPQPEFWSLVVGSWLDNDANRGAS |
| Ga0197907_111376151 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | EKVPGQHVGLQTDDMQVVYASMGFRRQPEFMSRVVGSWLRNDAND |
| Ga0206353_109900243 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | QHVGLQTDDMQVVYASMGFRRQPEFMSRVVGSWLRNDAND |
| Ga0210381_103921112 | 3300021078 | Groundwater Sediment | GQHVGLQTDDAQPLYESLGFRPQPEFWSLVSGSWLDNEGNRS |
| Ga0213873_100058122 | 3300021358 | Rhizosphere | MEQVPGQHIGLQTDDAQPLYRSLGFRPQPEFMSVVVGTWLDNQANRD |
| Ga0213877_100002731 | 3300021372 | Bulk Soil | RRRGIASELVRRLVAEVPGQHVGLQTDNAQALYRSLGFDFQPDFMSIVSGRWLEGG |
| Ga0210409_107035382 | 3300021559 | Soil | HVGLQADDARGFYESLGFRPQPEFLSLVAGVWLRNDANR |
| Ga0247790_102161681 | 3300022915 | Soil | QHIGLQTDDAQELYASVGFEPQPEFWSLVSGRWLDNDANRL |
| Ga0209619_104583393 | 3300025159 | Soil | MIRRLLDEVPGQHVGLQTDDAQPLYQSLGFKPQPEFWSVVVG |
| Ga0208357_10358281 | 3300025703 | Arctic Peat Soil | SRTVRMLAEQVPGQHIGVQTDEAADFYRSLEFRPQPEFMSLVVGNWLDNEANSS |
| Ga0207645_108824981 | 3300025907 | Miscanthus Rhizosphere | RVPGQHVGLQTDEAAELYASLGFRPQPEFWSAVSGTWLDNDANRG |
| Ga0207660_104528563 | 3300025917 | Corn Rhizosphere | VGLQTDDMQAVYASMEFRTQPEFMSRVIGTWLDNDANR |
| Ga0207650_110355072 | 3300025925 | Switchgrass Rhizosphere | GLQTDDAQELYSSLGFSLQPEFWSIVSGRWLDNDANR |
| Ga0207700_113569091 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ERVPGQHIGLQTSEAQAFYDSLGFRPQPEFWSLVAGRWLDNDANG |
| Ga0207669_102952621 | 3300025937 | Miscanthus Rhizosphere | VPGQHVGLQTDDAQALYESVGFRQQPEFWSLVSGRWLDNDANRL |
| Ga0207679_114156912 | 3300025945 | Corn Rhizosphere | QHVGLQTDDAQALYESVGFRQQPEFWSLVSGRWLDNDANRL |
| Ga0208142_10089961 | 3300025994 | Rice Paddy Soil | IGLLVDAVPGQHVGLQTDEAQELYASLGFRPQPEFWSRISGRWLEGGETP |
| Ga0208140_10468951 | 3300026021 | Rice Paddy Soil | PGQHVGLQTDDAQAFYEALGFEPQPEFWSRVSGRWLDNDGNR |
| Ga0207676_101236493 | 3300026095 | Switchgrass Rhizosphere | DRVPGQHVGLQTDDMQAFYASLGFEHQPEFWSVVVGTWLGNEANR |
| Ga0207675_1016640271 | 3300026118 | Switchgrass Rhizosphere | LQTDDAQELYSSLGFSLQPEFWSIVSGRWLDNDANR |
| Ga0207683_105711253 | 3300026121 | Miscanthus Rhizosphere | ASAMVRRLVESVPGQHVGLQTDDAGELYSALGFRRQPEFWSLLSGRWLGTAGARA |
| Ga0257158_11049922 | 3300026515 | Soil | LQTGDAGAFYASLGFRPQPEFMSLVVGAWLEAGSGS |
| Ga0208199_10179931 | 3300027497 | Peatlands Soil | VPGQHIGLQTNDTQPFYVALGFRTQPEFMSLVVGKWLDNEENGP |
| Ga0207981_10378582 | 3300027560 | Soil | MVRRLADQVPGQHIGLQTDDAEDFYASLGFRPQPAFLSAVIGRWLENDANRFAR |
| Ga0209073_103124951 | 3300027765 | Agricultural Soil | HVGLQTDDAQALYETLGFHVQPEFWSTIVGAWLDNDGNRSDAG |
| Ga0209798_103264983 | 3300027843 | Wetland Sediment | GQHVGLQTNDARDLYASLGFRPQPEFWSAVSGTWLDNDANR |
| Ga0209068_108750872 | 3300027894 | Watersheds | MTAEAVRHLIAKVPGQHIGLQTDDAQELYRSLGYQPQPEFWATVVGRWLDNDANR |
| Ga0268265_125166971 | 3300028380 | Switchgrass Rhizosphere | RHLLDRVPGQHVGLQADDRQDFYAALGFEVQPEFLSLVVGTWLDNDANR |
| Ga0268264_117136851 | 3300028381 | Switchgrass Rhizosphere | HIGLQTDDARAFYASLGFEPQPEFLALVVGEWLDNDANR |
| Ga0247823_109338401 | 3300028590 | Soil | GLQTDDAQALYQSLGFRQQPEFWSLVSGRWLDNDANRF |
| Ga0247822_104718101 | 3300028592 | Soil | PGQHVGLQTDDMQAFYASLGFEHQPEFWSVVVGTWLGNEANR |
| Ga0247820_105116663 | 3300028597 | Soil | MRELLAHVPGQHVGLQTDDAQVLYKSLGFEHQPEFWSLVVGSWLDNDANR |
| Ga0307318_101465772 | 3300028744 | Soil | HVGLQTDDAQQLYESVGFEPQPEFWSLVAGRWLDNDANRL |
| Ga0307283_100151664 | 3300028790 | Soil | QGIASAMVRLLVERVPGQHVGLQTDEAQELYSTLGFRPQPEFWSIVSGRWLDNDANR |
| Ga0307305_101344283 | 3300028807 | Soil | LQTDDAQAFYDSLGFRPQPEFRSFVVGSWLDNDANR |
| Ga0247825_102148214 | 3300028812 | Soil | ERLHIVGLQTDDMQAFYASLGFGPQPEFLSRVVGTWLDNDANRPG |
| Ga0307296_106327791 | 3300028819 | Soil | IRRLLDEVPGQHVGLQTDDAQKLYESVGFRAQPEFWSLVVGSWLDNDANRGAT |
| Ga0307289_100999263 | 3300028875 | Soil | LLDEVPGQHVGLQTDDAQKLYESVGFRAQPELWSLVVGSWLDNDANRGAT |
| Ga0307286_101286662 | 3300028876 | Soil | VPGQHVGLQTDDAQPLYESLGFRPQPEFWSLVSGSWLDNEGNRS |
| Ga0307278_102681431 | 3300028878 | Soil | LQTAADAHAFYESLGFRAQPEFWSTVVDSWLDNDANRA |
| Ga0247827_101870921 | 3300028889 | Soil | QGIASAMMRRLLDQVPGQHVGLQTDSAPELYASLGFAPQPEFWSIIVGTWLDNAANRASA |
| Ga0247827_109031302 | 3300028889 | Soil | RMMRHLLDRVPGQHVGLQTDDMQDFYASLGFEHQPEFWSLVVGEWLDNEANR |
| Ga0311330_103462233 | 3300029945 | Bog | IGLQTDDAQPFYTGLGFRPQPEFMSMVVGEWLDNEANA |
| Ga0302196_100317901 | 3300030225 | Bog | DYLLEQVPGQHVGLQSDDAGPFYAGLGFTAQPEFFSRVVGTWLDNDGNR |
| Ga0247826_115570782 | 3300030336 | Soil | IASAMMQRLLDQVPGQHVGLQTDSAPELYASLGFAPQPEFWSIIVGTWLDNDANRTSA |
| Ga0307498_101071201 | 3300031170 | Soil | LRALLDEVPGQHVGLQTDDAQELYRSLGFEPQPEFWSLVVGSWLDNDANR |
| Ga0307408_1016676103 | 3300031548 | Rhizosphere | QTEDAQAFYASLGFVPEPEFHSRVVGRWLGNEANS |
| Ga0318571_102659621 | 3300031549 | Soil | VGLQTDNGQAFYASLGFRAQPDFWSIVAGTWLENDANR |
| Ga0310886_101066222 | 3300031562 | Soil | VPGQHIGLQTDDAQELYASVGFEPQPEFWSLVSGRWLDNDANRL |
| Ga0318555_103681551 | 3300031640 | Soil | MVRHLLDQVPGQHVGLQTEDAATFYESLGFGPQPEFLSTVVGEWLGNE |
| Ga0307374_105182262 | 3300031670 | Soil | QHVGLQTSDARAFYRTLGFHPQPEFLSAVVGVWLDPTSTRS |
| Ga0307373_102713892 | 3300031672 | Soil | VPGQHIGLQVDSEGARRLYQSLGFRPQPEFMSVVVGTWLDNAANR |
| Ga0302321_1022061642 | 3300031726 | Fen | QHIGLQTDDAQQFYETFGFRVQPQFMSRVVGSWLANDANG |
| Ga0318547_108481482 | 3300031781 | Soil | HIGLQTDDAAAFYEGLGFRPQPQFLSAVVGAWLDNEANH |
| Ga0318499_103992181 | 3300031832 | Soil | VPGQHIGLQTDDATDLYRSLGFTPQPEFMSLVVGEWLDNEANR |
| Ga0310916_109899532 | 3300031942 | Soil | LQTDDAAAFYEGLGFRPQPQFLSAVVGAWLDNEANH |
| Ga0310903_105664132 | 3300032000 | Soil | SAMMRELLAHVPGQHVGLQTDDAQVLYKSLGFEHQPEFWSLVVGSWLDNDANR |
| Ga0307416_1004108861 | 3300032002 | Rhizosphere | IGLQTNDGQALYASLGFRPQPEFWSIVSGTWLDNDANR |
| Ga0310906_101093913 | 3300032013 | Soil | DRVPGQHVGLQTDDMQAFYASLGFEHQPEFWSLVVGRWLDNDANR |
| Ga0310899_102479862 | 3300032017 | Soil | TDDAQALYQSVGFRQQPEFWSLVSGRWLDNDANRF |
| Ga0310890_107887621 | 3300032075 | Soil | VGLQTDDMQAFYGSLGFGPQPEFLSRVVGTWLDNDANRPG |
| Ga0311301_104456061 | 3300032160 | Peatlands Soil | MIRHLIARVPGQHIGLQTDDAGDLYRSLGFTPQPEFMSLVVRDWLDN |
| Ga0315276_123996852 | 3300032177 | Sediment | SAMVRLLLDAVPGQHVGLQTDDLQQLYASLGFREQPAFLSTIVGQWLDNDANRSA |
| Ga0315275_123206702 | 3300032401 | Sediment | QHIGLQTDDAHAFYESLGFRPQPSFMSLVVGDWLDNDANR |
| Ga0348332_114678881 | 3300032515 | Plant Litter | GIGSRMVRSLAEAVPGQHIGLQTDEATDFYLGLGFRPQPAFMSLIVGDWLGNDANRS |
| Ga0335082_108983231 | 3300032782 | Soil | SEQVPGQHIGLQTDDAQAFYESLGFGPQPEFWSTVVGEWLGNDANRA |
| Ga0335070_108781303 | 3300032829 | Soil | VGLQTDNAQALYESLGFRPEPEFWSRVSGRWLENAANEESIG |
| Ga0310914_114421072 | 3300033289 | Soil | HIGLQTDDATDLYRSLGFTPQPEFMSLVVGEWLDNEANR |
| Ga0214471_104826401 | 3300033417 | Soil | PGQHVGLQTSDAQTLYESLGFEPQPEFWSVVVGRWLDNDANR |
| Ga0247829_113397702 | 3300033550 | Soil | QTRDAQALYESVGFRAQPEFWSLVSGRWLDNDANRL |
| Ga0247829_116204522 | 3300033550 | Soil | GQHVGLQTDDAQKLYESVGFRAQPEFWSLVVGSWLDNDANRGAT |
| Ga0371487_0210422_742_873 | 3300033982 | Peat Soil | MVRFLLAQVPGQHVGLQTDEAQGFYASLGFQPQPEFWSRVVTW |
| Ga0371488_0110671_2_154 | 3300033983 | Peat Soil | ADLVPGQHIGLQTDGAEQFYASLGFRPQPSFMSLVVGEWLDNEANRSETA |
| Ga0364929_0122739_26_142 | 3300034149 | Sediment | VGLQTDDAQPLYESLGFRPQPEFWSLVSGSWLDNDGNR |
| ⦗Top⦘ |