| Basic Information | |
|---|---|
| Family ID | F036840 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 169 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MRRNSRLTAIAGFAVAVILLAAGGLLLWGSTYVHNTV |
| Number of Associated Samples | 134 |
| Number of Associated Scaffolds | 169 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.22 % |
| % of genes near scaffold ends (potentially truncated) | 98.22 % |
| % of genes from short scaffolds (< 2000 bps) | 91.12 % |
| Associated GOLD sequencing projects | 127 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.006 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.811 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.627 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.746 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.85% β-sheet: 0.00% Coil/Unstructured: 46.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 169 Family Scaffolds |
|---|---|---|
| PF04972 | BON | 16.57 |
| PF00044 | Gp_dh_N | 15.98 |
| PF02800 | Gp_dh_C | 7.10 |
| PF14691 | Fer4_20 | 4.14 |
| PF00571 | CBS | 3.55 |
| PF12900 | Pyridox_ox_2 | 2.96 |
| PF13560 | HTH_31 | 1.78 |
| PF00561 | Abhydrolase_1 | 1.78 |
| PF01740 | STAS | 1.18 |
| PF00300 | His_Phos_1 | 0.59 |
| PF13185 | GAF_2 | 0.59 |
| PF09206 | ArabFuran-catal | 0.59 |
| PF08240 | ADH_N | 0.59 |
| PF13683 | rve_3 | 0.59 |
| PF13450 | NAD_binding_8 | 0.59 |
| PF06013 | WXG100 | 0.59 |
| PF00406 | ADK | 0.59 |
| PF01558 | POR | 0.59 |
| PF08940 | DUF1918 | 0.59 |
| PF00027 | cNMP_binding | 0.59 |
| PF00440 | TetR_N | 0.59 |
| PF04055 | Radical_SAM | 0.59 |
| PF00582 | Usp | 0.59 |
| COG ID | Name | Functional Category | % Frequency in 169 Family Scaffolds |
|---|---|---|---|
| COG0057 | Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase | Carbohydrate transport and metabolism [G] | 23.08 |
| COG0563 | Adenylate kinase or related kinase | Nucleotide transport and metabolism [F] | 0.59 |
| COG1014 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunit | Energy production and conversion [C] | 0.59 |
| COG4842 | Secreted virulence factor YukE/EsxA, WXG100 family | Defense mechanisms [V] | 0.59 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.01 % |
| Unclassified | root | N/A | 28.99 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459024|GZTSFBX01CI2T8 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 509 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10384177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 570 | Open in IMG/M |
| 3300004082|Ga0062384_100571022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 761 | Open in IMG/M |
| 3300004472|Ga0068974_1058858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 843 | Open in IMG/M |
| 3300005329|Ga0070683_100185373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1975 | Open in IMG/M |
| 3300005332|Ga0066388_107811653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 535 | Open in IMG/M |
| 3300005434|Ga0070709_11731349 | Not Available | 511 | Open in IMG/M |
| 3300005436|Ga0070713_101472683 | Not Available | 660 | Open in IMG/M |
| 3300005436|Ga0070713_102485001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 500 | Open in IMG/M |
| 3300005549|Ga0070704_100126142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1975 | Open in IMG/M |
| 3300005614|Ga0068856_100331019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1540 | Open in IMG/M |
| 3300005712|Ga0070764_10459656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 760 | Open in IMG/M |
| 3300005712|Ga0070764_10532513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 710 | Open in IMG/M |
| 3300006175|Ga0070712_100407247 | Not Available | 1124 | Open in IMG/M |
| 3300006175|Ga0070712_100679621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 876 | Open in IMG/M |
| 3300006175|Ga0070712_101110478 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300006176|Ga0070765_101074323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 761 | Open in IMG/M |
| 3300006572|Ga0074051_11646746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 680 | Open in IMG/M |
| 3300006755|Ga0079222_11351634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 655 | Open in IMG/M |
| 3300009520|Ga0116214_1232296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 698 | Open in IMG/M |
| 3300009698|Ga0116216_10670193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 624 | Open in IMG/M |
| 3300009824|Ga0116219_10136154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1425 | Open in IMG/M |
| 3300010361|Ga0126378_12300872 | Not Available | 615 | Open in IMG/M |
| 3300010371|Ga0134125_13051063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 507 | Open in IMG/M |
| 3300010379|Ga0136449_102469221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 747 | Open in IMG/M |
| 3300010379|Ga0136449_102755708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 696 | Open in IMG/M |
| 3300010379|Ga0136449_103300117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
| 3300010396|Ga0134126_12469098 | Not Available | 565 | Open in IMG/M |
| 3300010400|Ga0134122_10874170 | Not Available | 867 | Open in IMG/M |
| 3300010876|Ga0126361_10386995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2763 | Open in IMG/M |
| 3300011024|Ga0138530_105957 | All Organisms → cellular organisms → Bacteria | 1713 | Open in IMG/M |
| 3300011079|Ga0138569_1093703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 826 | Open in IMG/M |
| 3300011084|Ga0138562_1032803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 583 | Open in IMG/M |
| 3300012351|Ga0137386_10165258 | Not Available | 1586 | Open in IMG/M |
| 3300012507|Ga0157342_1054579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 571 | Open in IMG/M |
| 3300014169|Ga0181531_11101315 | Not Available | 500 | Open in IMG/M |
| 3300014201|Ga0181537_10292291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1119 | Open in IMG/M |
| 3300014493|Ga0182016_10380646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 840 | Open in IMG/M |
| 3300014654|Ga0181525_10380877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 774 | Open in IMG/M |
| 3300016294|Ga0182041_12031519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 535 | Open in IMG/M |
| 3300016341|Ga0182035_10217453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1523 | Open in IMG/M |
| 3300016387|Ga0182040_11965787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 502 | Open in IMG/M |
| 3300016404|Ga0182037_11232676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 658 | Open in IMG/M |
| 3300017924|Ga0187820_1020341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1665 | Open in IMG/M |
| 3300017924|Ga0187820_1035285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1311 | Open in IMG/M |
| 3300017924|Ga0187820_1136363 | Not Available | 730 | Open in IMG/M |
| 3300017926|Ga0187807_1031835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1633 | Open in IMG/M |
| 3300017926|Ga0187807_1092026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 951 | Open in IMG/M |
| 3300017933|Ga0187801_10023795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2104 | Open in IMG/M |
| 3300017937|Ga0187809_10096137 | Not Available | 989 | Open in IMG/M |
| 3300017937|Ga0187809_10350095 | Not Available | 554 | Open in IMG/M |
| 3300017942|Ga0187808_10259735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 778 | Open in IMG/M |
| 3300017961|Ga0187778_11329433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
| 3300017972|Ga0187781_10083487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2208 | Open in IMG/M |
| 3300017972|Ga0187781_10946983 | Not Available | 628 | Open in IMG/M |
| 3300017973|Ga0187780_10044957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3078 | Open in IMG/M |
| 3300017973|Ga0187780_10162900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1549 | Open in IMG/M |
| 3300017973|Ga0187780_10217436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1334 | Open in IMG/M |
| 3300017975|Ga0187782_10093257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2212 | Open in IMG/M |
| 3300018007|Ga0187805_10193748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 928 | Open in IMG/M |
| 3300018037|Ga0187883_10342777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 764 | Open in IMG/M |
| 3300018058|Ga0187766_10860328 | Not Available | 637 | Open in IMG/M |
| 3300018058|Ga0187766_11068264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 578 | Open in IMG/M |
| 3300018058|Ga0187766_11128878 | Not Available | 564 | Open in IMG/M |
| 3300018062|Ga0187784_10099576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2365 | Open in IMG/M |
| 3300018085|Ga0187772_10079806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2071 | Open in IMG/M |
| 3300018086|Ga0187769_11234744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 565 | Open in IMG/M |
| 3300018086|Ga0187769_11307959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 548 | Open in IMG/M |
| 3300018090|Ga0187770_10448486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1017 | Open in IMG/M |
| 3300020582|Ga0210395_11067734 | Not Available | 597 | Open in IMG/M |
| 3300020583|Ga0210401_10453796 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300021088|Ga0210404_10087944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1544 | Open in IMG/M |
| 3300021401|Ga0210393_11667481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 505 | Open in IMG/M |
| 3300021402|Ga0210385_10430126 | Not Available | 994 | Open in IMG/M |
| 3300021403|Ga0210397_10904145 | Not Available | 683 | Open in IMG/M |
| 3300021407|Ga0210383_11436673 | Not Available | 573 | Open in IMG/M |
| 3300021474|Ga0210390_11328230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 575 | Open in IMG/M |
| 3300021479|Ga0210410_10592137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 985 | Open in IMG/M |
| 3300021479|Ga0210410_11825269 | Not Available | 502 | Open in IMG/M |
| 3300021559|Ga0210409_10581681 | Not Available | 987 | Open in IMG/M |
| 3300022720|Ga0242672_1047216 | Not Available | 713 | Open in IMG/M |
| 3300022873|Ga0224550_1029465 | Not Available | 779 | Open in IMG/M |
| 3300022873|Ga0224550_1066172 | Not Available | 520 | Open in IMG/M |
| 3300025627|Ga0208220_1027605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1779 | Open in IMG/M |
| 3300025898|Ga0207692_10257361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1048 | Open in IMG/M |
| 3300025911|Ga0207654_10161904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1446 | Open in IMG/M |
| 3300025911|Ga0207654_11107597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 577 | Open in IMG/M |
| 3300025915|Ga0207693_10981528 | Not Available | 646 | Open in IMG/M |
| 3300025929|Ga0207664_10006809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7898 | Open in IMG/M |
| 3300025939|Ga0207665_10340787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1130 | Open in IMG/M |
| 3300026118|Ga0207675_100187694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1982 | Open in IMG/M |
| 3300026118|Ga0207675_100917487 | Not Available | 892 | Open in IMG/M |
| 3300026118|Ga0207675_100926405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 888 | Open in IMG/M |
| 3300026999|Ga0207949_1001601 | All Organisms → cellular organisms → Bacteria | 1887 | Open in IMG/M |
| 3300027567|Ga0209115_1143977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 535 | Open in IMG/M |
| 3300027590|Ga0209116_1015583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium kansasii | 1542 | Open in IMG/M |
| 3300027895|Ga0209624_10995247 | Not Available | 543 | Open in IMG/M |
| 3300028775|Ga0302231_10347979 | Not Available | 623 | Open in IMG/M |
| 3300028781|Ga0302223_10057769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1309 | Open in IMG/M |
| 3300028789|Ga0302232_10081168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1675 | Open in IMG/M |
| 3300028906|Ga0308309_10179022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1730 | Open in IMG/M |
| 3300028906|Ga0308309_10478824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1074 | Open in IMG/M |
| 3300029951|Ga0311371_10217639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2806 | Open in IMG/M |
| 3300030503|Ga0311370_12123456 | Not Available | 555 | Open in IMG/M |
| 3300030509|Ga0302183_10404933 | Not Available | 522 | Open in IMG/M |
| 3300030580|Ga0311355_10235408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1887 | Open in IMG/M |
| 3300030677|Ga0302317_10076475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium kansasii | 1630 | Open in IMG/M |
| 3300030706|Ga0310039_10041391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2077 | Open in IMG/M |
| 3300030737|Ga0302310_10606464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 577 | Open in IMG/M |
| 3300031231|Ga0170824_122179462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 542 | Open in IMG/M |
| 3300031525|Ga0302326_10244264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2935 | Open in IMG/M |
| 3300031525|Ga0302326_13097185 | Not Available | 564 | Open in IMG/M |
| 3300031544|Ga0318534_10091721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1734 | Open in IMG/M |
| 3300031544|Ga0318534_10477791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 713 | Open in IMG/M |
| 3300031544|Ga0318534_10600209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 626 | Open in IMG/M |
| 3300031544|Ga0318534_10866956 | Not Available | 506 | Open in IMG/M |
| 3300031549|Ga0318571_10173401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 758 | Open in IMG/M |
| 3300031573|Ga0310915_10419932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 950 | Open in IMG/M |
| 3300031668|Ga0318542_10257689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 888 | Open in IMG/M |
| 3300031668|Ga0318542_10772446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 503 | Open in IMG/M |
| 3300031680|Ga0318574_10779003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 560 | Open in IMG/M |
| 3300031681|Ga0318572_10278603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 986 | Open in IMG/M |
| 3300031682|Ga0318560_10020374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3025 | Open in IMG/M |
| 3300031708|Ga0310686_101072537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1291 | Open in IMG/M |
| 3300031708|Ga0310686_110705661 | Not Available | 989 | Open in IMG/M |
| 3300031718|Ga0307474_11425768 | Not Available | 546 | Open in IMG/M |
| 3300031723|Ga0318493_10794521 | Not Available | 533 | Open in IMG/M |
| 3300031724|Ga0318500_10114725 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300031736|Ga0318501_10303970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 852 | Open in IMG/M |
| 3300031771|Ga0318546_10272304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1168 | Open in IMG/M |
| 3300031771|Ga0318546_10392756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 968 | Open in IMG/M |
| 3300031778|Ga0318498_10045174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1945 | Open in IMG/M |
| 3300031779|Ga0318566_10042012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2148 | Open in IMG/M |
| 3300031782|Ga0318552_10139924 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300031782|Ga0318552_10553794 | Not Available | 587 | Open in IMG/M |
| 3300031796|Ga0318576_10502610 | Not Available | 572 | Open in IMG/M |
| 3300031798|Ga0318523_10093850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1466 | Open in IMG/M |
| 3300031805|Ga0318497_10251750 | Not Available | 980 | Open in IMG/M |
| 3300031831|Ga0318564_10067707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1570 | Open in IMG/M |
| 3300031831|Ga0318564_10359991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 638 | Open in IMG/M |
| 3300031879|Ga0306919_11177817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 583 | Open in IMG/M |
| 3300031890|Ga0306925_10863611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 934 | Open in IMG/M |
| 3300031890|Ga0306925_11070175 | Not Available | 817 | Open in IMG/M |
| 3300031896|Ga0318551_10113701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1452 | Open in IMG/M |
| 3300031896|Ga0318551_10765012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 561 | Open in IMG/M |
| 3300031910|Ga0306923_11426908 | Not Available | 728 | Open in IMG/M |
| 3300031912|Ga0306921_12542679 | Not Available | 530 | Open in IMG/M |
| 3300031941|Ga0310912_11228739 | Not Available | 570 | Open in IMG/M |
| 3300031942|Ga0310916_10235601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1540 | Open in IMG/M |
| 3300031945|Ga0310913_10819947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 656 | Open in IMG/M |
| 3300032010|Ga0318569_10614445 | Not Available | 506 | Open in IMG/M |
| 3300032039|Ga0318559_10219963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 875 | Open in IMG/M |
| 3300032041|Ga0318549_10370241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 646 | Open in IMG/M |
| 3300032052|Ga0318506_10447434 | Not Available | 573 | Open in IMG/M |
| 3300032089|Ga0318525_10305715 | Not Available | 817 | Open in IMG/M |
| 3300032160|Ga0311301_10681654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1451 | Open in IMG/M |
| 3300032205|Ga0307472_101283498 | Not Available | 704 | Open in IMG/M |
| 3300032261|Ga0306920_100797775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1386 | Open in IMG/M |
| 3300032770|Ga0335085_12514826 | Not Available | 510 | Open in IMG/M |
| 3300032783|Ga0335079_11743843 | Not Available | 607 | Open in IMG/M |
| 3300032805|Ga0335078_10567305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1440 | Open in IMG/M |
| 3300032805|Ga0335078_11639612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 709 | Open in IMG/M |
| 3300032893|Ga0335069_10116881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 3346 | Open in IMG/M |
| 3300032895|Ga0335074_10007701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 14941 | Open in IMG/M |
| 3300032896|Ga0335075_10688848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 986 | Open in IMG/M |
| 3300032954|Ga0335083_10272513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1501 | Open in IMG/M |
| 3300032954|Ga0335083_10274770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1493 | Open in IMG/M |
| 3300033134|Ga0335073_11808441 | Not Available | 570 | Open in IMG/M |
| 3300034163|Ga0370515_0067071 | Not Available | 1564 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.81% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 8.88% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.10% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.51% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.96% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.78% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.18% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.18% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.18% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.18% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.59% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.59% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.59% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.59% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.59% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.59% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.59% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.59% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.59% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.59% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.59% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.59% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.59% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004472 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011024 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 8 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011079 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 54 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011084 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
| 3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026999 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028781 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FD1_07065010 | 2170459024 | Grass Soil | MRRNSHLTAIAGFALAAILLAAGGLLLWGSTYTHNMVHN |
| JGIcombinedJ51221_103841771 | 3300003505 | Forest Soil | MRRNSSHLTVIAGFAVAVILLVAGGLLTWGSAYVHNTVQGQLSAQ |
| Ga0062384_1005710222 | 3300004082 | Bog Forest Soil | MRRNSRSIFSLAATAVAVILLAAGGLLVWGSAYVHNTVQNQ |
| Ga0068974_10588581 | 3300004472 | Peatlands Soil | MRRNSRLSVLAGFAVAVILLAAGGLLLWGSTYVHNTVQGQ |
| Ga0070683_1001853731 | 3300005329 | Corn Rhizosphere | MRRNSHLTAIAGFVLSAILLAAGGLLLWGSTYTHNMIHNQLAA |
| Ga0066388_1078116531 | 3300005332 | Tropical Forest Soil | MRRNTHLATIAGFVLSAILLAAGGLLLWGSTYTHNMVHNQLA |
| Ga0070709_117313491 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRNTHLTVIAGFVLSAILLAAGGLLLWGSTYTHNMVHNQLAAQ |
| Ga0070713_1014726832 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRNSHLTAIAGFVLSAILLAAGGLLLWGSTYTHNMIHNQLAAQ |
| Ga0070713_1024850012 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRNSHLTAIAGFVLAAILLAAGGMLLWGSAYVHNTVQGQLSA |
| Ga0070704_1001261421 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRNSHLTVIAGFVLSAILLAAGGLLLWGSTYTHNMVHNQLAA |
| Ga0068856_1003310193 | 3300005614 | Corn Rhizosphere | MRRSVTAFVGFALAGVLLVAGGLLLWGSTYSHNMVHNQLAA |
| Ga0070764_104596561 | 3300005712 | Soil | MRRNSRSISAIAATAVAGILLAAGGMLLWGSAYVHNTVQGQLA |
| Ga0070764_105325131 | 3300005712 | Soil | MRRYSSHLTAIAGLAVAVILLVAGGLLTWGSAYVHNTVQ |
| Ga0070712_1004072471 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRNSHLTAIAGFVLSAILLAAGGLLLWGSTYTHNMI |
| Ga0070712_1006796212 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRNSHLTAIAGLALAAILLAAGGMLLWGSAYVHNTVQGQLSA |
| Ga0070712_1011104782 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRSTPLAAIVGFALAGILFVAGGLLLWGSTYSHNMVHNQL |
| Ga0070765_1010743232 | 3300006176 | Soil | MRRNSSHLTVIVGFAVAAILLVAGGLLTWGSAYVHNTVQGQ |
| Ga0074051_116467461 | 3300006572 | Soil | MRRNSHLTVIAGFVMAAILFVAGGLLLWGSTYTHNMVHN |
| Ga0079222_113516343 | 3300006755 | Agricultural Soil | MRRNSHLTAIAGFVLAAILLAAGGLLLWGSTYTHNMVHNQLA |
| Ga0116214_12322961 | 3300009520 | Peatlands Soil | MRRNSRLSVLAGFAVAVILLAAGGLLLWGSTYVHNTV |
| Ga0116216_106701932 | 3300009698 | Peatlands Soil | MRRNSRFTLAIAGFAAAVLLAVAGGLLLWGSTYVHNTVQ |
| Ga0116219_101361542 | 3300009824 | Peatlands Soil | MGGITMRRNSRLSVLAGFAVAVILLAAGGLLLWGS |
| Ga0126378_123008722 | 3300010361 | Tropical Forest Soil | MRRNSHLAAIMGFALSAVLLVSGGLLLWGSTYTHNMVHNQLA |
| Ga0134125_130510631 | 3300010371 | Terrestrial Soil | MRRNSHLTAVAGFALAAILLAAGGMLLWGSAYVHNTVQGQLSA |
| Ga0136449_1024692212 | 3300010379 | Peatlands Soil | MRRNYRLTAIAGFAVAVILLAAGGLLLWGSTYVHN |
| Ga0136449_1027557081 | 3300010379 | Peatlands Soil | MRRNSHFTLAIAGFAVAVLLAVAGGLLLWGSTYVHNTVTN |
| Ga0136449_1033001172 | 3300010379 | Peatlands Soil | MRRNSHFTLAIAGFAVAVLLAVAGGLLLWGSTYVH |
| Ga0134126_124690982 | 3300010396 | Terrestrial Soil | MRRNSHLTAIAGLALAAILLAAGGMLLWGSAYVHNTVQGQLS |
| Ga0134122_108741701 | 3300010400 | Terrestrial Soil | MRRNSPLTAIAGFALAAILLAAGGLLLWGSTYTHNMVHNQLAAQ |
| Ga0126361_103869954 | 3300010876 | Boreal Forest Soil | MRRNSHFTLAIAGFATAVLLAVAGGLLLWGSAYVHNSVTNQLVA |
| Ga0138530_1059574 | 3300011024 | Peatlands Soil | MRRNSRLTAIAGFAVAVILLAAGGLLLWGSTYVHNTV* |
| Ga0138569_10937031 | 3300011079 | Peatlands Soil | MRRNYRLTAIAGFAVAVILLAAGGLLLWGSTYVHNTVQGQLASQ* |
| Ga0138562_10328032 | 3300011084 | Peatlands Soil | MRRNSRLTAIVGFAAAAILLVAGGLLLWGSAYVHNTVQGQLSA |
| Ga0137386_101652582 | 3300012351 | Vadose Zone Soil | MRRNSHLTAIAGFVMAAILLAAGGLLLWGSTYTHNMVHNQLAAQ |
| Ga0157342_10545792 | 3300012507 | Arabidopsis Rhizosphere | MRRNSHLAVIAGFVMSAILLAAGGLLLWGSTYTHN |
| Ga0181531_111013151 | 3300014169 | Bog | MRRYSSHLTVIAGLAVAVLLLAAGGLLTWGSAYVHNTVQGQ |
| Ga0181537_102922911 | 3300014201 | Bog | MRRYSSHLTVIAGFAVAVILLAAGGLLTWGSAYVHNTVQGQ |
| Ga0182016_103806462 | 3300014493 | Bog | MRRNSRLTVIAGFAVAVILLVAGGLLTWGSAYVHN |
| Ga0181525_103808772 | 3300014654 | Bog | MRRSSSRFIAGFVAGAFLLVAGGLLTWGSAYVHNTV |
| Ga0182041_120315191 | 3300016294 | Soil | MRRNRLVAFAGIALSAILLACGGLLLWGSTYVHNTVQNQLAAQQI |
| Ga0182035_102174533 | 3300016341 | Soil | MRRNSHFVLTIAGFASAVLLAVAGGLLLWGSAYVHNT |
| Ga0182040_119657871 | 3300016387 | Soil | MRRNSHLTLTIAGFAAAVLLAVAGGLLLWGSAYVHNTVTNQ |
| Ga0182037_112326762 | 3300016404 | Soil | MTMRRNSRFTLAVAGFAAAVLLAVTGGMLLWGSAYVHNTVQNQLAAQQI |
| Ga0187820_10203411 | 3300017924 | Freshwater Sediment | MRRNSRFTLAIAGFAAAVLLAVAGGLLLWGSTYVHNTVQNQ |
| Ga0187820_10352851 | 3300017924 | Freshwater Sediment | MRRNSHFTLAIAGFAAAVLLAVAGGLLLWGSAYVHNTVQN |
| Ga0187820_11363632 | 3300017924 | Freshwater Sediment | MRRNSHFTAAIAGFAVAAVLLVAGGLLLWGSTYVHNTVT |
| Ga0187807_10318353 | 3300017926 | Freshwater Sediment | MRRNSHFTLAIAGFVAAVLLAAAGGLLLWGSTYVHNTVTNQLSA |
| Ga0187807_10920262 | 3300017926 | Freshwater Sediment | MRRNSHFTAAIAGFAVAAVLLVAGGLLLWGSTYVHNTVTSQLAAQQ |
| Ga0187801_100237953 | 3300017933 | Freshwater Sediment | MRRNSRFTLAIAGFAAAVLLAVAGGLLLWGSAYVHNT |
| Ga0187809_100961372 | 3300017937 | Freshwater Sediment | MRRNSHFVLVIAGFAAAVLLAVAGGLLLWGSAYVHNTVT |
| Ga0187809_103500952 | 3300017937 | Freshwater Sediment | MRRNSHFTAAIAGFAVAAVLLVAGGLLLWGSTYVHN |
| Ga0187808_102597351 | 3300017942 | Freshwater Sediment | MRRNSHFPLAIAGFAAAVLLAVAGGLLLWGSTYVHNT |
| Ga0187778_113294332 | 3300017961 | Tropical Peatland | MRRNSHFTAAVAGFAVAAVLLVAGGLLLWGSTYVHNTVTNQLAA |
| Ga0187781_100834874 | 3300017972 | Tropical Peatland | MRRNSHLVLVIAGFAAAVLLAVAGGLLLWGSTYVH |
| Ga0187781_109469831 | 3300017972 | Tropical Peatland | MRRNSHLTLALAGLAAAVLLAVAGGLLLWGSAYVHNT |
| Ga0187780_100449574 | 3300017973 | Tropical Peatland | MRRNSHFTAAVAGFAVAAVLLVAGGLLLWGSTYVHN |
| Ga0187780_101629003 | 3300017973 | Tropical Peatland | MRRKSHFVLVIAGFAAAVLLAVAGGLLLWGSAYVHNTVQNQLAAQ |
| Ga0187780_102174363 | 3300017973 | Tropical Peatland | MRRNSHFVLVIAGFAAAVLLAVAGGLLLWGSAYVHNTVQNQLAAQ |
| Ga0187782_100932574 | 3300017975 | Tropical Peatland | MRRNSHLVLVIAGFAAAVLLAVAGGLLLWGSTYVHN |
| Ga0187805_101937482 | 3300018007 | Freshwater Sediment | MRRNSHFTLAIAGFAAAVLLAVAGGLLLWGSTYVHNTVQN |
| Ga0187883_103427772 | 3300018037 | Peatland | MRRNYSRLAVIGVLAVAAILLVAGGLLTWGSAYVHNTVQG |
| Ga0187766_108603282 | 3300018058 | Tropical Peatland | MRRNSHFVLVIAGFAAAVLLAVAGGLLLWGSAYVHNTV |
| Ga0187766_110682642 | 3300018058 | Tropical Peatland | MRRKSHFVLVIAGFAAAVLLAVAGGLLLWGSAYVHNTV |
| Ga0187766_111288782 | 3300018058 | Tropical Peatland | MRRNSHFTLAVAGFVAAALLAVAGGLLLWGSAYVHNTV |
| Ga0187784_100995764 | 3300018062 | Tropical Peatland | MRRNSHFTLALVGFAAAVILAVAGGLLLWGSTYVHNTVHS |
| Ga0187772_100798061 | 3300018085 | Tropical Peatland | MRRNSHFTLALVGFAAAVILAVAGGLLLWGSTYVHNTVQS |
| Ga0187769_112347442 | 3300018086 | Tropical Peatland | MRRSYSLWAVIAGFALSAVLLISGGLLLWGSAYVHNTVQNQLAAQQ |
| Ga0187769_113079592 | 3300018086 | Tropical Peatland | MRRNSHFTLAIVGFAAAALLAVAGGLLLWGSTYVHNTVQN |
| Ga0187770_104484862 | 3300018090 | Tropical Peatland | MRRSYSLWAVIAGFALSAVLLISGGLLLWGSAYVHNTVQNQLSEQQIY |
| Ga0210395_110677341 | 3300020582 | Soil | MRRNSHLTAIAGFALAAILLAAGGMLLWGSAYVHNT |
| Ga0210401_104537961 | 3300020583 | Soil | MRRNSHLTLAIAGFATAVLLAVAGGLLLWGSAYVHN |
| Ga0210404_100879443 | 3300021088 | Soil | MRRNSHLTAIAGFVLAAILLAAGGLLLWGSTYTHNMVH |
| Ga0210393_116674811 | 3300021401 | Soil | MRRNSHLTAIAGFALAAILLAAGGMLLWGSAYVHNTVQGQLSAQ |
| Ga0210385_104301262 | 3300021402 | Soil | MRRNSSHLTVIAGFAVTVILLVAGGLLTWGSAYVHNTV |
| Ga0210397_109041451 | 3300021403 | Soil | MRRNSHLAAIAGFALAAILFVAGGLLLWGSTYTHNMV |
| Ga0210383_114366732 | 3300021407 | Soil | MTMRRNSHFVLVIAGFAAAVLLAVAGGLLLWGSTYVHN |
| Ga0210390_113282302 | 3300021474 | Soil | MRRSSRLTAIVGFALAAVLLIAGGLLLWGSTYVHNTVQGQLTS |
| Ga0210410_105921372 | 3300021479 | Soil | MRRNSSHLTVIAGFAVAVILLVAGGLLTWGSAYVHNTVQ |
| Ga0210410_118252691 | 3300021479 | Soil | MRRNSSRLTVIAGFAVAVILLVAGGLLTWGSAYVHNTVQG |
| Ga0210409_105816812 | 3300021559 | Soil | MRRNSHLTAIAGFALAAILLAAGGMLLWGSAYVHNTVQGQLSAQQIF |
| Ga0242672_10472161 | 3300022720 | Soil | QGGITMRRNSHLTLAIAGFATAVLLAVAGGLLLWGSAYVHNTVHNQLAAQKKRN |
| Ga0224550_10294652 | 3300022873 | Soil | MRRNSLTLTLAGFAAAVLLAVAGGLLLWGSTYVHNTVTNQLSAQ |
| Ga0224550_10661721 | 3300022873 | Soil | MRRNSRFTLTLAGFAAAVLLAVAGGLLLWGSTYVHNTVTNQLSAQQ |
| Ga0208220_10276053 | 3300025627 | Arctic Peat Soil | VSHLILTQRALAAVLLIVGGLTLWGSAYVHNTVQSQ |
| Ga0207692_102573613 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRNSHLTAIAGLVLAAILLAAGGLLLWGSAYTHNMVRNQL |
| Ga0207654_101619041 | 3300025911 | Corn Rhizosphere | MRRNSHLTAIAGFVLSAILLAAGGLLLWGSTYTHNMIHNQLAAQQ |
| Ga0207654_111075972 | 3300025911 | Corn Rhizosphere | MRRSTPLAAIAGFALAAVLFVAGGLLLWGSTYSHNMVHNQ |
| Ga0207693_109815281 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRSTPLAAIVGFALAGILFVAGGLLLWGSTYSHNMVHNQ |
| Ga0207664_100068091 | 3300025929 | Agricultural Soil | MRRSVTAIVGFALAAVLLVAGGLLLWGSTYSHNMVHNQLA |
| Ga0207665_103407871 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRNSHVTVIAGFVLSAILLAAGGLLLWGSTYTHNMIHNQLA |
| Ga0207675_1001876941 | 3300026118 | Switchgrass Rhizosphere | MRRNSPLTAIAGFALAAILLAAGGLLLWGSTYTHNMVHN |
| Ga0207675_1009174871 | 3300026118 | Switchgrass Rhizosphere | MRRNSHLTAIAGFVLSAILLAAGGLLLWGSTYTHNM |
| Ga0207675_1009264052 | 3300026118 | Switchgrass Rhizosphere | MRRNSHLTVIAGFVLAAVLLAAGGLLLWGSTYTHNMVHNQLAAQ |
| Ga0207949_10016011 | 3300026999 | Forest Soil | MRRNSHLTAIAGFALAAILLAAGGMLLWGSAYVHNTVQG |
| Ga0209115_11439771 | 3300027567 | Forest Soil | MRRTSTRSIIATVTTGVAVILLAAGGLLMWGSAYVHNTVQG |
| Ga0209116_10155832 | 3300027590 | Forest Soil | MRRYSSHLTVIAGFAVAVILLAAGGLLTWGSAYVHNTVQG |
| Ga0209624_109952471 | 3300027895 | Forest Soil | MRRYSSHLTIIAGFAVAVILLAAGGLLTWGSAYVHNTVQGQLSAQQIF |
| Ga0302231_103479791 | 3300028775 | Palsa | MRRYSSHLTAIAGLAVAVILLAAGGLLTWGSAYVHNT |
| Ga0302223_100577692 | 3300028781 | Palsa | MRRNSSHLTAIVGLAVAVILLAAGGLLTWGSAYVH |
| Ga0302232_100811683 | 3300028789 | Palsa | MRRNSLTLTLAGFAAAVLLAVAGGLLLWGSTYVHNTVTNQLS |
| Ga0308309_101790222 | 3300028906 | Soil | MRRNSSHLTVIAGFAVAVILLVAGGLLTWGSAYVHNT |
| Ga0308309_104788242 | 3300028906 | Soil | MRRNSSHLTVIVGFAVAVILLVAGGLLTWGSAYVHNTVQGQLSAQ |
| Ga0311371_102176394 | 3300029951 | Palsa | MRRNSLTLTLAGFAAAVLLAVAGGLLLWGSTYVHNTVTNQLSA |
| Ga0311370_121234562 | 3300030503 | Palsa | MRRYSSHLTAIAGLAVAVILLAAGGLLTWGSAYVHNTVQGQLA |
| Ga0302183_104049331 | 3300030509 | Palsa | MRRYSSHLTAIAGLAVAVILLAAGGLLTWGSAYVH |
| Ga0311355_102354084 | 3300030580 | Palsa | MRRNSRFTLTLAGFAAAVLLAVAGGLLLWGSTYVHN |
| Ga0302317_100764752 | 3300030677 | Palsa | MRRYSSHLTAIAGLAVAVILLAAGGLLTWGSAYVHNTVQ |
| Ga0310039_100413913 | 3300030706 | Peatlands Soil | MRRNSRLSVLAGFAVAVILLAAGGLLLWGSTYVHNTVQGQL |
| Ga0302310_106064642 | 3300030737 | Palsa | MRRNSRFTLTLAGFAAAVLLAVAGGLLLWGSTYVHNTVTNQL |
| Ga0170824_1221794621 | 3300031231 | Forest Soil | MRRNSHLTAIAGFALAAILLAAGGLLLWGSTYTHNMVHNQL |
| Ga0302326_102442641 | 3300031525 | Palsa | MRRYSSHLTVIAGLAVAVILLAAGGLLTWGSAYVHNTVQGQLAS |
| Ga0302326_130971852 | 3300031525 | Palsa | MRRNSSHLTAIVGLAVAVILLAAGGLLTWGSAYVHN |
| Ga0318534_100917213 | 3300031544 | Soil | MRRNSHFVLTIAGFVSAVLLAVAGGLLLWGSAYVHNTVQN |
| Ga0318534_104777912 | 3300031544 | Soil | MRRSSHLTLVIAGFAAAVLLAVAGGLLLWGSAYVHNTVQN |
| Ga0318534_106002092 | 3300031544 | Soil | MRRNSHLTLVIAGFAAAVLLAVAGGLLLWGSAYVHNT |
| Ga0318534_108669561 | 3300031544 | Soil | MRRNSHFKLALAGLAATVVLAVSGGLLLWGSTYVHNTVQN |
| Ga0318571_101734011 | 3300031549 | Soil | MRRNSHLAVIAGFALSAVLFVAGGLLLWGSTYTHNMVH |
| Ga0310915_104199321 | 3300031573 | Soil | MRRNSHLTLTIAGFAAAVLLAVAGGLLLWGSAYVHNTVTNQLAA |
| Ga0318542_102576892 | 3300031668 | Soil | MRRNSHLAAIVGFALSAVLLVSGGLLLWGSTYTHNMV |
| Ga0318542_107724462 | 3300031668 | Soil | MRRNSHLAAIAGFALSAILFVAGGLLLWGSTYTHNMVHNQLAAQQI |
| Ga0318574_107790032 | 3300031680 | Soil | MRRNSHFVLTIAGFVSAVLLAVAGGLLLWGSAYVHNTVQNQLA |
| Ga0318572_102786031 | 3300031681 | Soil | MRRNSHLAVIAGFALSAVLFVAGGLLLWGSTYTHN |
| Ga0318560_100203741 | 3300031682 | Soil | MRRNSHLAAIVGFALSAVLLVSGGLLLWGSTYTHN |
| Ga0310686_1010725371 | 3300031708 | Soil | MRRTSVLSLVGVAVAVVLAAAGGLLMWGSAYVHNTVQGQLASQQI |
| Ga0310686_1107056612 | 3300031708 | Soil | MHRNSSRITAIAGFAVAVILLVAGGLLTWGSAYVH |
| Ga0307474_114257681 | 3300031718 | Hardwood Forest Soil | MRRNSHLTAIAGFVLSAILLAAGGLLLWGSTYTHNMVHNQL |
| Ga0318493_107945211 | 3300031723 | Soil | MRRNSHFILVIAGFAAAVLLAVGGGLLLWGSAYVHNTVQNQLAAQQ |
| Ga0318500_101147253 | 3300031724 | Soil | MRRSSHLTLVIAGFAAAVLLAVAGGLLLWGSAYVHNTVQNQLAAQ |
| Ga0318501_103039702 | 3300031736 | Soil | MRRNSHFTAAVAGFAVAAVLLVAGGLMLWGSTYVHN |
| Ga0318546_102723043 | 3300031771 | Soil | MRRNSHFKLALAGLAATLTLGLAGGLMLWGSTYVHNTVTNQLAAQQIY |
| Ga0318546_103927562 | 3300031771 | Soil | MRRSSHLTLVIAGFAAAVLLAVAGGLLLWGSAYVHNTVQNQLSAQQ |
| Ga0318498_100451743 | 3300031778 | Soil | MRRNSHFTAAVAGFAVAAVLLVAGGLMLWGSTYVHNTVT |
| Ga0318566_100420123 | 3300031779 | Soil | MRRNSHFILVIAGFAAAVLLAVGGGLLLWGSAYVHNT |
| Ga0318552_101399241 | 3300031782 | Soil | MRRNSHFVLVIAGFAAAVLLAMAGGLLLWGSAYVHNTVQNQ |
| Ga0318552_105537942 | 3300031782 | Soil | MRRNSHFKLALAGLAATVTLAVSGGLLLWGSTYVHNTVKDQLAARLGVRERG |
| Ga0318576_105026101 | 3300031796 | Soil | MRRNSHFKLALAGLAATVTLAVSGGLLLWGSTYVHNTVKDQIEKR |
| Ga0318523_100938502 | 3300031798 | Soil | MRRNSHFKLALAGLAATVTLAVSGGLLLWGSTYAHNTVKDQ |
| Ga0318497_102517502 | 3300031805 | Soil | MRRNSRIFAYAGFALSAILLVSGGLLLWGSAYVHNTVQSQLAAQ |
| Ga0318564_100677072 | 3300031831 | Soil | MRRNSHLTLTIAGFAAAVLLAVAGGLLLWGSAYVPSTPGSSC |
| Ga0318564_103599912 | 3300031831 | Soil | MRRNHLAALAGFALSAILLVSGGLLLWGSAYVHNTVQSQ |
| Ga0306919_111778172 | 3300031879 | Soil | MRRNSHFTAAVAGFAVAAVLLVAGGLMLWGSTYVHNTVTNQ |
| Ga0306925_108636111 | 3300031890 | Soil | MRRSSHLTLVIAGFAAAVLLAVAGGLLLWGSAYVHNTVQNQLAAQQ |
| Ga0306925_110701752 | 3300031890 | Soil | MRRNSHLAVIVGFVLSAFLFVAGGLLLWGSTYTHNMVHNQL |
| Ga0318551_101137013 | 3300031896 | Soil | MRRNSHFTAAVAGFAVAAVLLVAGGLMLWGSTYVHNT |
| Ga0318551_107650121 | 3300031896 | Soil | MRRNSHLAAIAGFALSAILFVAGGLLLWGSTYTHN |
| Ga0306923_114269082 | 3300031910 | Soil | MRRNSHLTLVIAGFAAAVLLAVAGGLLLWGSAYVHNTVQ |
| Ga0306921_125426792 | 3300031912 | Soil | MRRNSHLAVIAGFALSAILFVAGGLLLWGSTYTHNMVHNQL |
| Ga0310912_112287392 | 3300031941 | Soil | MRRNSHLAVIVGFVLSAFLFVAGGLLLWGSTYTHNMVHNQ |
| Ga0310916_102356011 | 3300031942 | Soil | MRRNSHFKLALAGLAAALTLGLAGGLMLWGSTYVHNTVT |
| Ga0310913_108199471 | 3300031945 | Soil | MRRNSHLAAIAGFALSAILFVAGGLLLWGSTYTHNMV |
| Ga0318569_106144451 | 3300032010 | Soil | MRRSSHLTLVIAGFAAAVLLAVAGGLLLWGSAYVHN |
| Ga0318559_102199632 | 3300032039 | Soil | MRRNTHLAAIVGFALSAVLLVSGGLLLWGSTYIHNT |
| Ga0318549_103702412 | 3300032041 | Soil | MRRNSHLAAIAGFALSAILFVAGGLLLWGSTYTHNMVHNQLAAQQ |
| Ga0318506_104474341 | 3300032052 | Soil | MRRNSHFKLALAGLAATVTLAVSGGLLLWGSTYVH |
| Ga0318525_103057152 | 3300032089 | Soil | MRRNSRFAALAGFALAAILLAAGGLLLWGSTYVHN |
| Ga0311301_106816542 | 3300032160 | Peatlands Soil | MRRNSRLSVLAGFAVAVILLAAGGLLLWGSTYVHNTVQ |
| Ga0307472_1012834981 | 3300032205 | Hardwood Forest Soil | MRRNSHLAAIAGFALAAILLAAGGLLLWGSTYTHNM |
| Ga0306920_1007977751 | 3300032261 | Soil | MRRNSHLAAIAGFALSAILFVAGGLLLWGSTYTHNMVHDQ |
| Ga0335085_125148261 | 3300032770 | Soil | MRRSTPLAAIAGFALAAVLFVAGGLLLWGSTYSHNMVHN |
| Ga0335079_117438431 | 3300032783 | Soil | MRRNSRLFAYAGFALSAILLVAGGLLLWGSTYVHNTV |
| Ga0335078_105673051 | 3300032805 | Soil | MRRNSHLAAIIGFALSAVLFVAGGLLLWGSTYTHNMVHNQ |
| Ga0335078_116396122 | 3300032805 | Soil | MRRNSRLFAYAGFALSAILLIAGGLLLWGSAYVHNTVQG |
| Ga0335069_101168811 | 3300032893 | Soil | MRRNSRLFAIAGFTLSAVLLIAGGLLLWGSAYVHNTVQS |
| Ga0335074_100077011 | 3300032895 | Soil | MRRTPRFYVSLASAALAVLLLAAGGLLLWGSAYVHNTV |
| Ga0335075_106888481 | 3300032896 | Soil | MRRSSSLTAIAGFALAAILFVAGGLLLWGSTYVHNEV |
| Ga0335083_102725133 | 3300032954 | Soil | MRRSTPLAAIAGFALAAVLFVAGGLLLWGSTYSHNMVHNQL |
| Ga0335083_102747704 | 3300032954 | Soil | MRRNSHLAVIVGFALSAVLLVAGGLLLWGSTYTHNMVHNQLAAQQ |
| Ga0335073_118084411 | 3300033134 | Soil | MRRNSRFTLAIAGFAAAVLLAVAGGLLIWGSAYVHNT |
| Ga0370515_0067071_1449_1562 | 3300034163 | Untreated Peat Soil | MRRNSLTLTLAGFAAAVLLAVAGGLLLWGSTYVHNTVT |
| ⦗Top⦘ |