| Basic Information | |
|---|---|
| Family ID | F036778 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 169 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MEEIYCFAGNPLDRVSERRRDAGWIASLLDEPATRLIPLR |
| Number of Associated Samples | 142 |
| Number of Associated Scaffolds | 169 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 64.67 % |
| % of genes near scaffold ends (potentially truncated) | 95.27 % |
| % of genes from short scaffolds (< 2000 bps) | 89.94 % |
| Associated GOLD sequencing projects | 136 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.781 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.728 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.012 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.195 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.41% β-sheet: 0.00% Coil/Unstructured: 70.59% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 169 Family Scaffolds |
|---|---|---|
| PF06965 | Na_H_antiport_1 | 10.65 |
| PF08028 | Acyl-CoA_dh_2 | 10.65 |
| PF09537 | DUF2383 | 7.69 |
| PF05199 | GMC_oxred_C | 7.10 |
| PF00043 | GST_C | 5.92 |
| PF02798 | GST_N | 3.55 |
| PF06202 | GDE_C | 2.37 |
| PF01546 | Peptidase_M20 | 2.37 |
| PF09856 | ScfRs | 1.78 |
| PF01266 | DAO | 1.78 |
| PF07969 | Amidohydro_3 | 1.78 |
| PF01636 | APH | 1.78 |
| PF02472 | ExbD | 1.78 |
| PF00072 | Response_reg | 1.78 |
| PF00496 | SBP_bac_5 | 1.18 |
| PF11157 | DUF2937 | 1.18 |
| PF01408 | GFO_IDH_MocA | 1.18 |
| PF01583 | APS_kinase | 0.59 |
| PF03009 | GDPD | 0.59 |
| PF00171 | Aldedh | 0.59 |
| PF12840 | HTH_20 | 0.59 |
| PF11272 | DUF3072 | 0.59 |
| PF09297 | zf-NADH-PPase | 0.59 |
| PF01618 | MotA_ExbB | 0.59 |
| PF01148 | CTP_transf_1 | 0.59 |
| PF13452 | MaoC_dehydrat_N | 0.59 |
| PF00313 | CSD | 0.59 |
| PF01850 | PIN | 0.59 |
| PF03170 | BcsB | 0.59 |
| PF06831 | H2TH | 0.59 |
| PF09084 | NMT1 | 0.59 |
| PF02771 | Acyl-CoA_dh_N | 0.59 |
| PF07859 | Abhydrolase_3 | 0.59 |
| PF00293 | NUDIX | 0.59 |
| PF14833 | NAD_binding_11 | 0.59 |
| COG ID | Name | Functional Category | % Frequency in 169 Family Scaffolds |
|---|---|---|---|
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 11.24 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 10.65 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 7.10 |
| COG0435 | Glutathionyl-hydroquinone reductase | Energy production and conversion [C] | 5.92 |
| COG0625 | Glutathione S-transferase | Posttranslational modification, protein turnover, chaperones [O] | 5.92 |
| COG3408 | Glycogen debranching enzyme (alpha-1,6-glucosidase) | Carbohydrate transport and metabolism [G] | 2.37 |
| COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 1.78 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.59 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.59 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.59 |
| COG2816 | NADH pyrophosphatase NudC, Nudix superfamily | Nucleotide transport and metabolism [F] | 0.59 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.59 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.59 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.59 |
| COG0584 | Glycerophosphoryl diester phosphodiesterase | Lipid transport and metabolism [I] | 0.59 |
| COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 0.59 |
| COG0272 | NAD-dependent DNA ligase | Replication, recombination and repair [L] | 0.59 |
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 0.59 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.78 % |
| Unclassified | root | N/A | 27.22 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_113899279 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 839 | Open in IMG/M |
| 3300000956|JGI10216J12902_118166692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 589 | Open in IMG/M |
| 3300002568|C688J35102_119280892 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 666 | Open in IMG/M |
| 3300003570|Ga0007418J51697_1009387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 708 | Open in IMG/M |
| 3300003572|Ga0007424J51698_1006991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 754 | Open in IMG/M |
| 3300004080|Ga0062385_10061283 | Not Available | 1676 | Open in IMG/M |
| 3300004091|Ga0062387_100971900 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300004092|Ga0062389_100844756 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300004463|Ga0063356_103194610 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300005167|Ga0066672_10311266 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1025 | Open in IMG/M |
| 3300005171|Ga0066677_10363987 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 828 | Open in IMG/M |
| 3300005176|Ga0066679_10744250 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 631 | Open in IMG/M |
| 3300005180|Ga0066685_10509328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 833 | Open in IMG/M |
| 3300005181|Ga0066678_10385968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 927 | Open in IMG/M |
| 3300005184|Ga0066671_10592250 | Not Available | 718 | Open in IMG/M |
| 3300005445|Ga0070708_101088272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 749 | Open in IMG/M |
| 3300005546|Ga0070696_100412294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1059 | Open in IMG/M |
| 3300005560|Ga0066670_10092924 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1673 | Open in IMG/M |
| 3300005561|Ga0066699_10071710 | All Organisms → cellular organisms → Bacteria | 2205 | Open in IMG/M |
| 3300005764|Ga0066903_107974651 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
| 3300005985|Ga0081539_10270779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 744 | Open in IMG/M |
| 3300006028|Ga0070717_11455986 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 622 | Open in IMG/M |
| 3300006032|Ga0066696_10423764 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 870 | Open in IMG/M |
| 3300006194|Ga0075427_10087651 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300006794|Ga0066658_10459660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 693 | Open in IMG/M |
| 3300006796|Ga0066665_11618488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
| 3300007004|Ga0079218_13654841 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300007265|Ga0099794_10421051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 699 | Open in IMG/M |
| 3300009093|Ga0105240_12162341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300009143|Ga0099792_10169917 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1217 | Open in IMG/M |
| 3300009162|Ga0075423_11184331 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 815 | Open in IMG/M |
| 3300009177|Ga0105248_13108398 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 528 | Open in IMG/M |
| 3300009777|Ga0105164_10245291 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 901 | Open in IMG/M |
| 3300009804|Ga0105063_1061571 | Not Available | 561 | Open in IMG/M |
| 3300009821|Ga0105064_1022737 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300010038|Ga0126315_11061939 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 545 | Open in IMG/M |
| 3300010039|Ga0126309_11134898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300010040|Ga0126308_10458460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 857 | Open in IMG/M |
| 3300010048|Ga0126373_10935047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 931 | Open in IMG/M |
| 3300010333|Ga0134080_10265084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_1_20CM_3_64_12 | 762 | Open in IMG/M |
| 3300010335|Ga0134063_10533328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_1_20CM_3_64_12 | 591 | Open in IMG/M |
| 3300010359|Ga0126376_12431672 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 571 | Open in IMG/M |
| 3300010360|Ga0126372_11796709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 656 | Open in IMG/M |
| 3300010376|Ga0126381_102835060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 691 | Open in IMG/M |
| 3300010376|Ga0126381_102878960 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300011269|Ga0137392_11096715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 653 | Open in IMG/M |
| 3300011432|Ga0137428_1236715 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300012177|Ga0153943_1103324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 608 | Open in IMG/M |
| 3300012205|Ga0137362_11239403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 631 | Open in IMG/M |
| 3300012205|Ga0137362_11395971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300012212|Ga0150985_102882024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_1_20CM_3_64_12 | 668 | Open in IMG/M |
| 3300012362|Ga0137361_10156015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2044 | Open in IMG/M |
| 3300012362|Ga0137361_11954418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_1_20CM_3_64_12 | 503 | Open in IMG/M |
| 3300012404|Ga0134024_1125489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_1_20CM_3_64_12 | 535 | Open in IMG/M |
| 3300012922|Ga0137394_11209437 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 619 | Open in IMG/M |
| 3300012930|Ga0137407_10887981 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300012948|Ga0126375_10413965 | Not Available | 978 | Open in IMG/M |
| 3300012955|Ga0164298_11420550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_1_20CM_3_64_12 | 538 | Open in IMG/M |
| 3300013102|Ga0157371_11167456 | Not Available | 592 | Open in IMG/M |
| 3300013306|Ga0163162_12398010 | Not Available | 606 | Open in IMG/M |
| 3300016270|Ga0182036_10085741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2099 | Open in IMG/M |
| 3300016270|Ga0182036_10143596 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1690 | Open in IMG/M |
| 3300016294|Ga0182041_12310037 | Not Available | 503 | Open in IMG/M |
| 3300016319|Ga0182033_10065388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2536 | Open in IMG/M |
| 3300016319|Ga0182033_10091598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2210 | Open in IMG/M |
| 3300016319|Ga0182033_11409031 | Not Available | 628 | Open in IMG/M |
| 3300016341|Ga0182035_10093557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2183 | Open in IMG/M |
| 3300016357|Ga0182032_10622137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 900 | Open in IMG/M |
| 3300016357|Ga0182032_10674005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 866 | Open in IMG/M |
| 3300016357|Ga0182032_11137514 | Not Available | 670 | Open in IMG/M |
| 3300016387|Ga0182040_10627305 | Not Available | 873 | Open in IMG/M |
| 3300016404|Ga0182037_11526668 | Not Available | 593 | Open in IMG/M |
| 3300016422|Ga0182039_10963168 | Not Available | 764 | Open in IMG/M |
| 3300016445|Ga0182038_10253047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1417 | Open in IMG/M |
| 3300016445|Ga0182038_10307909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1298 | Open in IMG/M |
| 3300017657|Ga0134074_1150640 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 813 | Open in IMG/M |
| 3300017924|Ga0187820_1208672 | Not Available | 612 | Open in IMG/M |
| 3300018007|Ga0187805_10499127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 570 | Open in IMG/M |
| 3300018052|Ga0184638_1340450 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 503 | Open in IMG/M |
| 3300018060|Ga0187765_11228378 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300018088|Ga0187771_10010808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 6615 | Open in IMG/M |
| 3300018422|Ga0190265_13141465 | Not Available | 551 | Open in IMG/M |
| 3300018433|Ga0066667_11135981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 677 | Open in IMG/M |
| 3300018482|Ga0066669_12063490 | Not Available | 536 | Open in IMG/M |
| 3300019786|Ga0182025_1286449 | Not Available | 1637 | Open in IMG/M |
| 3300020018|Ga0193721_1041420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1216 | Open in IMG/M |
| 3300020583|Ga0210401_10296526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1477 | Open in IMG/M |
| 3300021405|Ga0210387_10111332 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2301 | Open in IMG/M |
| 3300021406|Ga0210386_11115856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 669 | Open in IMG/M |
| 3300022529|Ga0242668_1131647 | Not Available | 536 | Open in IMG/M |
| 3300025910|Ga0207684_11705546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300025915|Ga0207693_10950991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 658 | Open in IMG/M |
| 3300025939|Ga0207665_10923189 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 693 | Open in IMG/M |
| 3300025944|Ga0207661_11235162 | Not Available | 687 | Open in IMG/M |
| 3300025945|Ga0207679_11353875 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300026088|Ga0207641_11047692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 813 | Open in IMG/M |
| 3300026121|Ga0207683_10813088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 868 | Open in IMG/M |
| 3300026308|Ga0209265_1052361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1256 | Open in IMG/M |
| 3300026317|Ga0209154_1083229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1377 | Open in IMG/M |
| 3300026322|Ga0209687_1174109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 677 | Open in IMG/M |
| 3300026335|Ga0209804_1059088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1847 | Open in IMG/M |
| 3300026475|Ga0257147_1081891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300026538|Ga0209056_10460852 | Not Available | 706 | Open in IMG/M |
| 3300026542|Ga0209805_1068040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1739 | Open in IMG/M |
| 3300027076|Ga0208860_1026444 | Not Available | 601 | Open in IMG/M |
| 3300027633|Ga0208988_1146271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_1_20CM_3_64_12 | 570 | Open in IMG/M |
| 3300027768|Ga0209772_10021134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1849 | Open in IMG/M |
| 3300028047|Ga0209526_10492100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_1_20CM_3_64_12 | 801 | Open in IMG/M |
| 3300031234|Ga0302325_12477142 | Not Available | 620 | Open in IMG/M |
| 3300031543|Ga0318516_10420560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → unclassified Reyranella → Reyranella sp. CPCC 100927 | 769 | Open in IMG/M |
| 3300031543|Ga0318516_10524221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 679 | Open in IMG/M |
| 3300031561|Ga0318528_10236478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 979 | Open in IMG/M |
| 3300031561|Ga0318528_10375438 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 763 | Open in IMG/M |
| 3300031640|Ga0318555_10035161 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2467 | Open in IMG/M |
| 3300031668|Ga0318542_10724889 | Not Available | 520 | Open in IMG/M |
| 3300031680|Ga0318574_10251392 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1022 | Open in IMG/M |
| 3300031681|Ga0318572_10207635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1145 | Open in IMG/M |
| 3300031681|Ga0318572_10542442 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 693 | Open in IMG/M |
| 3300031681|Ga0318572_10801710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 560 | Open in IMG/M |
| 3300031713|Ga0318496_10104496 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1522 | Open in IMG/M |
| 3300031720|Ga0307469_10395818 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1177 | Open in IMG/M |
| 3300031736|Ga0318501_10584452 | Not Available | 612 | Open in IMG/M |
| 3300031747|Ga0318502_10353002 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 870 | Open in IMG/M |
| 3300031747|Ga0318502_10371553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 848 | Open in IMG/M |
| 3300031747|Ga0318502_10563297 | Not Available | 685 | Open in IMG/M |
| 3300031763|Ga0318537_10052836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1477 | Open in IMG/M |
| 3300031765|Ga0318554_10329792 | Not Available | 868 | Open in IMG/M |
| 3300031768|Ga0318509_10730323 | Not Available | 549 | Open in IMG/M |
| 3300031771|Ga0318546_10038484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2905 | Open in IMG/M |
| 3300031777|Ga0318543_10008800 | All Organisms → cellular organisms → Bacteria | 3446 | Open in IMG/M |
| 3300031781|Ga0318547_10346429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → unclassified Reyranella → Reyranella sp. CPCC 100927 | 907 | Open in IMG/M |
| 3300031792|Ga0318529_10417838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 624 | Open in IMG/M |
| 3300031797|Ga0318550_10449898 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300031805|Ga0318497_10019014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3309 | Open in IMG/M |
| 3300031845|Ga0318511_10390894 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300031845|Ga0318511_10440295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 600 | Open in IMG/M |
| 3300031846|Ga0318512_10751382 | Not Available | 501 | Open in IMG/M |
| 3300031860|Ga0318495_10195913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 909 | Open in IMG/M |
| 3300031893|Ga0318536_10049072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2034 | Open in IMG/M |
| 3300031894|Ga0318522_10080241 | Not Available | 1191 | Open in IMG/M |
| 3300031897|Ga0318520_10625490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 670 | Open in IMG/M |
| 3300031912|Ga0306921_11637411 | Not Available | 698 | Open in IMG/M |
| 3300031912|Ga0306921_11766384 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 666 | Open in IMG/M |
| 3300031942|Ga0310916_10183421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1744 | Open in IMG/M |
| 3300031942|Ga0310916_10441461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1108 | Open in IMG/M |
| 3300031942|Ga0310916_10839418 | Not Available | 772 | Open in IMG/M |
| 3300031942|Ga0310916_10914434 | Not Available | 735 | Open in IMG/M |
| 3300031945|Ga0310913_11130054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 547 | Open in IMG/M |
| 3300031959|Ga0318530_10330674 | Not Available | 631 | Open in IMG/M |
| 3300031962|Ga0307479_11753395 | Not Available | 574 | Open in IMG/M |
| 3300031981|Ga0318531_10162418 | Not Available | 1002 | Open in IMG/M |
| 3300031981|Ga0318531_10299819 | Not Available | 726 | Open in IMG/M |
| 3300031981|Ga0318531_10521826 | Not Available | 538 | Open in IMG/M |
| 3300032010|Ga0318569_10306491 | Not Available | 739 | Open in IMG/M |
| 3300032010|Ga0318569_10466684 | Not Available | 589 | Open in IMG/M |
| 3300032035|Ga0310911_10307893 | Not Available | 912 | Open in IMG/M |
| 3300032039|Ga0318559_10058804 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1629 | Open in IMG/M |
| 3300032043|Ga0318556_10311476 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300032059|Ga0318533_10079519 | Not Available | 2235 | Open in IMG/M |
| 3300032063|Ga0318504_10032319 | Not Available | 2089 | Open in IMG/M |
| 3300032063|Ga0318504_10555769 | Not Available | 551 | Open in IMG/M |
| 3300032066|Ga0318514_10703708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300032090|Ga0318518_10490847 | Not Available | 629 | Open in IMG/M |
| 3300032094|Ga0318540_10157815 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1088 | Open in IMG/M |
| 3300032180|Ga0307471_100345095 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1596 | Open in IMG/M |
| 3300032261|Ga0306920_100679812 | Not Available | 1518 | Open in IMG/M |
| 3300033289|Ga0310914_10159611 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1995 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.65% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.55% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.37% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.37% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.78% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.78% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.78% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.78% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.18% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.18% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.18% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.18% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.18% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.18% |
| Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.59% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.59% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.59% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.59% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.59% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.59% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.59% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.59% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.59% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.59% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003570 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Bulk_34 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300003572 | Grassland soil microbial communities from Hopland, California, USA - Sample H3_Bulk_40 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
| 3300009804 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 | Environmental | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
| 3300012177 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ027 MetaG | Host-Associated | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012404 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027076 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1138992791 | 3300000956 | Soil | MEDIYCFAGNALDRVSARRNDTEWITALLADPATRLLA |
| JGI10216J12902_1181666922 | 3300000956 | Soil | MEDIYCFAGNPLDRVSERRDDRDWITSLLGDPQTRILA |
| C688J35102_1192808921 | 3300002568 | Soil | MEEIYCFAGNPLDRASERRRDTAWIATLLGDPAARVLPLSELRPLLR |
| Ga0007418J51697_10093872 | 3300003570 | Avena Fatua Rhizosphere | MEEIYCFAGNPLDRASERRRDGEWIRSLLDDPVARVLPLHD |
| Ga0007424J51698_10069912 | 3300003572 | Avena Fatua Rhizosphere | MEEIYCFAGNPLDRASERRRDGEWIRSLLDDPVARVLPLHDLRPATRGS |
| Ga0062385_100612835 | 3300004080 | Bog Forest Soil | MEEIYCFAGNPLDRVSERRRDTAWIASLLDDPRSRLIPLR |
| Ga0062387_1009719001 | 3300004091 | Bog Forest Soil | MEEIYCFAGNPLDRASERRRDTAWVRSLLDDPAARILPLSDL |
| Ga0062389_1008447561 | 3300004092 | Bog Forest Soil | MEEIYCFAGNPLDRASERRRDTAWVRSLLDDPAARILPLSDLRP |
| Ga0063356_1031946101 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MEDIYCFAGNPLDRVSERRRDTAWIDGLLADPEARILPLR |
| Ga0066672_103112662 | 3300005167 | Soil | MEEIYCFAGNPLDRVSQRRQDAAWVASLLDDPATRVLPLHGLKPQ |
| Ga0066677_103639872 | 3300005171 | Soil | MEEIYCFAGNPLDRVSQRRQDAAWVASLLDEPATRVLPLHGLKPQIRHS |
| Ga0066679_107442502 | 3300005176 | Soil | MEEVYCFAGNPLDRVSQRRQDAGWVASLLEDPATQVLPLHGLKPQIRH |
| Ga0066685_105093281 | 3300005180 | Soil | MEEIYCFAGNPLDRVSERRRDAGWISSLLDEPSTRLIPLRD |
| Ga0066678_103859681 | 3300005181 | Soil | MEEIYCFAGNPLDRVSERRRDAAWVSSLLDEPDTRLIPLR |
| Ga0066671_105922502 | 3300005184 | Soil | MEEIYCFAGNPLDRASERRRDREWIRSLLDDPAARVLPLH |
| Ga0070708_1010882721 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDIYCFAGNALDRVSARRNDTEWVAALLADPGTRLLALR |
| Ga0070696_1004122942 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MEEIYCFAGNPLDRVSQRRQDAGWVLSLLDDPQTRLLPLHGLKPQIR |
| Ga0066670_100929243 | 3300005560 | Soil | MEEIYCFAGNPLDRASERRRDGEWIRSLLDDPAARILP |
| Ga0066699_100717101 | 3300005561 | Soil | MEDIYCFGGNPLDRASERRGDREWIAKLLADPETRIL |
| Ga0066903_1079746511 | 3300005764 | Tropical Forest Soil | MEEIYCFGGNPLDRVSQRRQDAGWVASLLEDPESR |
| Ga0081539_102707791 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MEEIYCFAGNPLDRASERRRDSAWIEGLLADPEARIL |
| Ga0070717_114559861 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MEEIYCFAGNPLDRVSQRRQDAGWVASLLEDPATQVLPLHGLKPQ |
| Ga0066696_104237641 | 3300006032 | Soil | MEEIYCFAGNPLDRVSQRRQDAAWVASLLDEPATRVLPLH |
| Ga0075427_100876511 | 3300006194 | Populus Rhizosphere | MEEIYCFGGNPLDRVSERRDDREWITKLLDDPETRVLALRDLK |
| Ga0066658_104596601 | 3300006794 | Soil | MEEIYCFGGNPLDRASERRRDTAWIQSLLDNPAARI |
| Ga0066665_116184881 | 3300006796 | Soil | MEEIYCFAGNPLDRASERRRDAAWIAALLGDAAAR |
| Ga0079218_136548411 | 3300007004 | Agricultural Soil | MEEICCFAGNPLDRVSERRRDTAWIAGLLADPEARILP |
| Ga0099794_104210513 | 3300007265 | Vadose Zone Soil | MEEIYCFAGNPLDRVSQRRQDAGWVATLLDDPESRLLPLH |
| Ga0105240_121623412 | 3300009093 | Corn Rhizosphere | MEEICCFAGNPLDRASERRRDSAWVAGLLEDPAARLLPLRDLRPLTR |
| Ga0099792_101699173 | 3300009143 | Vadose Zone Soil | MEEIYCFAGNPLDRASERRRDGEWVRSLLDDPAAR |
| Ga0075423_111843311 | 3300009162 | Populus Rhizosphere | MSMEDIYRFAGNPLDRVSERRDHAEWVAGLLGAPETRVLAL |
| Ga0105248_131083981 | 3300009177 | Switchgrass Rhizosphere | MEDIYCFAGNPLDRVSERRRDTAWIASLLIARDARILPL |
| Ga0105164_102452912 | 3300009777 | Wastewater | MEDIYCFGGNPLDRASERRDDGGWITKLLGSANYFWTS* |
| Ga0105063_10615711 | 3300009804 | Groundwater Sand | MEDIYCFAGNPLDRVSERRRDTAWIAGLLADPEARILPLRELRPL |
| Ga0105064_10227373 | 3300009821 | Groundwater Sand | MDDIYCFGGNPLDRASERRDDREWIAALLGDPLAVVPALAGSR* |
| Ga0126315_110619392 | 3300010038 | Serpentine Soil | MEEIYCFAGNPLDRVSERRRDSAWIAALLDHSEARILPLDDLR |
| Ga0126309_111348982 | 3300010039 | Serpentine Soil | MEDIYCFAGNPLDRASERRRDTEWVASLLSDPAARILPLRDL |
| Ga0126308_104584601 | 3300010040 | Serpentine Soil | MEEIYCFAGNPLDRASERRRDSEWIRSLLDDPAAR |
| Ga0126373_109350471 | 3300010048 | Tropical Forest Soil | MEEIYCFAGNPLDRADERRRDAGWIASLLDETSSRLLPLRDLKP |
| Ga0134080_102650842 | 3300010333 | Grasslands Soil | MEEIYCFAGNPLDRASERRRDAAWIAALLGDAAARILPLSDLR |
| Ga0134063_105333282 | 3300010335 | Grasslands Soil | MEEIYCFGGNPLDRASERRRDTVWIQSLLDDPAARILALCELRPLIRGGAVPE |
| Ga0126376_124316721 | 3300010359 | Tropical Forest Soil | MEDIYCFAGNPLDRVSERRDDRDWIASLLGDSQTRI |
| Ga0126372_117967091 | 3300010360 | Tropical Forest Soil | MEEIYCFAGNPLDRVSQRRQDAGWVASLLEDPATRVLPLHGLKPRIRH |
| Ga0126381_1028350602 | 3300010376 | Tropical Forest Soil | MEEIYCFAGNPLDRVSQRRQDAGWVASLLEDPATRVLP |
| Ga0126381_1028789602 | 3300010376 | Tropical Forest Soil | MEEIYCFAGNPLDRVSERRRDGAWIVSLLEEPETRLIPLRDLKPSIRNGS |
| Ga0137392_110967152 | 3300011269 | Vadose Zone Soil | MEEIYCFAGNPLDRASERRRDTAWIGSLLDDPAARI |
| Ga0137428_12367151 | 3300011432 | Soil | MFAFAGNPLDRASEKRSDAAWLAAARADSGARVLP |
| Ga0153943_11033242 | 3300012177 | Attine Ant Fungus Gardens | MEDIYCFAGNPLDRASERRRDTAWIASLIDDPAARILPLREL |
| Ga0137362_112394032 | 3300012205 | Vadose Zone Soil | MEEIYCFAGNPLDRASERRRDTAWIRSLLDDPTARILPL |
| Ga0137362_113959712 | 3300012205 | Vadose Zone Soil | MEEIYCFAGNPLDRVSQRRQDAGWVASLLDDPESRLLLLHDLKPRVRHASAV |
| Ga0150985_1028820241 | 3300012212 | Avena Fatua Rhizosphere | MEEIYCFAGNPLDRVSERRRDTAWIGEVLPRLAARPLPPPAL |
| Ga0137361_101560154 | 3300012362 | Vadose Zone Soil | MEEIYCFAGNPLDRASERRRDTAWVRALLDDPAAQIL |
| Ga0137361_119544182 | 3300012362 | Vadose Zone Soil | MEEIYCFGGNPLDRASERRRDTLWIQSLLDDPAARILPLCELRP |
| Ga0134024_11254891 | 3300012404 | Grasslands Soil | MEEIYCFAGNPLDRASERRRDTAWIGELLADPAARLLPLSELRP |
| Ga0137394_112094372 | 3300012922 | Vadose Zone Soil | MEDVSASAAIPLDRVSERRDDGDWITTLLGDPATHRLGLS* |
| Ga0137407_108879812 | 3300012930 | Vadose Zone Soil | MEEIYCFGGNPLDRAAERRQDTSWIRSLLDDPAARLLPLRELKPAV |
| Ga0126375_104139652 | 3300012948 | Tropical Forest Soil | MSTLEEIYCFGGNPLDRMSERRDDATWIAALLDDPSTRMLPL |
| Ga0164298_114205501 | 3300012955 | Soil | MEEIYCFAGNPLDRASERRRDTAWIASLLGDPAARV |
| Ga0157371_111674561 | 3300013102 | Corn Rhizosphere | MEDIYCFAGNPLDRVSERRRDTSWIASLLLAPEARILPLRDLRP |
| Ga0163162_123980102 | 3300013306 | Switchgrass Rhizosphere | MEDIYCFAGNPLDRVSERRRDTAWIASLLIARDARILPLRDLRPLTRGGA* |
| Ga0182036_100857411 | 3300016270 | Soil | MEEIYCFAGNPLDRMSERRRDTGWIASLLDEPATRVIPFRDLKP |
| Ga0182036_101435963 | 3300016270 | Soil | MEEIYCFGGNPLDRVSQRRQDAGWVASLLEEPATRVLPLHGL |
| Ga0182041_123100371 | 3300016294 | Soil | MEEIYCFAGNPLDRVSERRRDAGWIASLLYEPATRLILLRDLK |
| Ga0182033_100653881 | 3300016319 | Soil | MEEIYTFGGNPLDRVSQRRQDAGWIASLLDDPETRLLPLRELKP |
| Ga0182033_100915981 | 3300016319 | Soil | MEEIYCFAGNPLDRVSQRRQDAAWVASLLQDPATRLLPLH |
| Ga0182033_114090311 | 3300016319 | Soil | MEEIYCFAGNPLDRVSERRRDTAWVVSLLEEPETRLIPLRDLKPSIRNG |
| Ga0182035_100935571 | 3300016341 | Soil | MEEIYCFAGNPLDRVSQRRQDAAWVASLLQDPATRLLPLHSL |
| Ga0182035_117576872 | 3300016341 | Soil | MEEIYCFAGNPLDRVSERRRDAGWIASLLYEPATRLILLRDLKPSIRNGSQMALDWQPV |
| Ga0182032_106221371 | 3300016357 | Soil | MEEIYCFAGNPLDRVSERRRDTAWVVSLLEEPETRLIPLRDLKPSIRN |
| Ga0182032_106740051 | 3300016357 | Soil | MEEIYCFAGNPLDRVSERRRDTGWIASLLDEPATRVIPFRDLKP |
| Ga0182032_111375141 | 3300016357 | Soil | MEEIYCFAGNPLDRVSERRRDAGWIASLLEEPATRV |
| Ga0182040_106273052 | 3300016387 | Soil | MEEIYCFAGNPLNRVSERRRDAGWITALLDEPATRLIPLRDLKPTIRNGSQMARD |
| Ga0182037_115266682 | 3300016404 | Soil | MEEIYCFAGNPLDRMSERRRDTGWIASLLDEPATRVI |
| Ga0182039_109631681 | 3300016422 | Soil | MEEIYCFAGNPLDRVSERRRDTAWVVSLLEEPETRLIPLRDLKPSIR |
| Ga0182038_102530471 | 3300016445 | Soil | MEEIYCFAGNPLDRVSQRRQDAGWVASLLQDPGTRLLPLH |
| Ga0182038_103079091 | 3300016445 | Soil | MEEIYCFAGNPLDRVSERRRDAGWIASLLDEPATRLILLRDLKP |
| Ga0134074_11506401 | 3300017657 | Grasslands Soil | MEDIYCFGGNPLDRASERREDREWIAALLGDPETRIL |
| Ga0187820_12086722 | 3300017924 | Freshwater Sediment | MEEIYCFAGNPLDRVSERRRDKKWVGGLLANPTSRILPLYDL |
| Ga0187805_104991271 | 3300018007 | Freshwater Sediment | MEEIYCFAGNPLDRVSERRRDKEWVGGLLAAPTSRI |
| Ga0184638_13404502 | 3300018052 | Groundwater Sediment | MEDTYCFAGNPLDRVSERRDDREWIAALLDDPGTRMLALRDLK |
| Ga0187765_112283782 | 3300018060 | Tropical Peatland | MEEIYTFAGNPLDRVSQRRQDAGWVASLLDDPKTRLLPLRELK |
| Ga0187771_100108088 | 3300018088 | Tropical Peatland | MEEIYCFAGNPLDRVSERRRDREWIASLLADPRSRILPLY |
| Ga0190265_131414652 | 3300018422 | Soil | MEDIYCFAGNPLDRASERRRDAAWIGSLFDSPASRILPLRDLRPLTRG |
| Ga0066667_111359812 | 3300018433 | Grasslands Soil | MEEIYCFAGNPLDRVSQRRQDAAWVASLLDEPATRVLPLHGLKPQIR |
| Ga0066669_120634901 | 3300018482 | Grasslands Soil | MEEIYCFAGNPLDRASERRRDGEWIRSLLDDPAARILPLFDLRPATGGSGS |
| Ga0182025_12864494 | 3300019786 | Permafrost | MEEIYCFAGNPLDRASERRRDTAWIASLLDDPAARILRSATCGR |
| Ga0193721_10414203 | 3300020018 | Soil | MEEIYCFAGNPLDRASERRRDRAWIATLLHDPAARVLPLA |
| Ga0210401_102965262 | 3300020583 | Soil | MEEIYCFAGNPLDRVSQRRQDAGWVASLLEDPATRVLPLHGLKPPVC |
| Ga0210387_101113321 | 3300021405 | Soil | MEEIYCFAGNPLDRVSERRRDATWVASLLDEPATRLIPLRDLKP |
| Ga0210386_111158562 | 3300021406 | Soil | MEEIYCFAGNPLDRVSQRRRDAGWVASLLEDPATRVLPLHGLKPPVRRSSA |
| Ga0242668_11316471 | 3300022529 | Soil | MEEIYCFAGNPLDRVSQRRQDAGWVASLLEDPATRV |
| Ga0207684_117055461 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MEEIYCFAGNPLDRVSERRRDAGWISSLLDEPRTRLIPLRDLKPPI |
| Ga0207693_109509912 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MEEIYCFAGNPLDRVSQRRQDAGWVASLLEDPTTRVLPLHGL |
| Ga0207665_109231891 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDVYCFGGNPLDRVSERRDDGGWIATLLDDPETRLLALR |
| Ga0207661_112351622 | 3300025944 | Corn Rhizosphere | MEDIYCFAGNPLDRVSERRRDTAWIASLLIARDARILPLRDLRPLTRGGAS |
| Ga0207679_113538752 | 3300025945 | Corn Rhizosphere | MEDIYCFAGNPLDRVSERRRDTAWIDGLLADPEARILPLRE |
| Ga0207641_110476923 | 3300026088 | Switchgrass Rhizosphere | MEEIYCFGGNPLDRAAERRQDTAWIASLLDDPAARLLPLRELRPALRAG |
| Ga0207683_108130882 | 3300026121 | Miscanthus Rhizosphere | MEEIYCFGGNPLDRAAERRQDTAWIASLLDDPAARLLPLR |
| Ga0209265_10523611 | 3300026308 | Soil | MEEIYCFAGNQLDRASERRRDTAWIAALLGDPAARVL |
| Ga0209154_10832291 | 3300026317 | Soil | MEEIYCFAGNPLDRVSERRRDTAWIATLLGDPAARVLPLSEL |
| Ga0209687_11741092 | 3300026322 | Soil | MEEIYCFAGNPLDRVSQRRQDAAWVASLLDEPATRVLPLHG |
| Ga0209804_10590881 | 3300026335 | Soil | MEEIYCFAGNPLDRASERRRDAAWIAALLGDAAARV |
| Ga0257147_10818911 | 3300026475 | Soil | MEEIYCFAGNPLDRVSQRRQDAGWVASLLDDPESRLLPL |
| Ga0209056_104608521 | 3300026538 | Soil | MEEIYCFGGNPLDRASERRRDTVWIQSLLDDPAARILPLCE |
| Ga0209805_10680403 | 3300026542 | Soil | MEEIYCFAGNPLDRVSQRRQDAAWVASLLEDPATRVL |
| Ga0208860_10264441 | 3300027076 | Forest Soil | MEEIYCFAGNPLDRVSQRRQDAGWVASLLEDPATRVLPLHEIDFSLMPNG |
| Ga0208988_11462711 | 3300027633 | Forest Soil | MEEIYCFAGNPLDRVSERRRDSAWVGELLDDPAARLLPL |
| Ga0209772_100211341 | 3300027768 | Bog Forest Soil | MEEIYTFAGNPLDRVSQRRQDAGWIAALLDDPKTRMLPLRE |
| Ga0209526_100507663 | 3300028047 | Forest Soil | MEEIYCFAGNPLDRVSQRRQDAGWVASLLEDPGTRVLPLHGLKPQIRHSSAAAL |
| Ga0209526_104921001 | 3300028047 | Forest Soil | MEDIYCFAGNPLDRVSERRRDSAWIDELLDDPAARLLPLRDL |
| Ga0302325_124771421 | 3300031234 | Palsa | MEEIYCFAGNPLDRVSERRRDKEWVGALLADPASRILPLYDLK |
| Ga0318516_104205602 | 3300031543 | Soil | MEEIYCFAGNPLDRVSQRRQDAGWVASLLQDPGTR |
| Ga0318516_105242211 | 3300031543 | Soil | MPAGYAAGMEETYCFAGNPLDRAGERRRDNAWVASLLDEP |
| Ga0318528_102364783 | 3300031561 | Soil | MEEIYCFAGNPLDRVSQRRQDAGWVASLLQDPGTRLLPLHSLKPRVHHS |
| Ga0318528_103754381 | 3300031561 | Soil | MEEIYCFAGNPLDRVSERRRDTGWIASLLDEPATRVIPFRDLKPL |
| Ga0318555_100351611 | 3300031640 | Soil | MEEIYCFAGNPLDRVSERRRDATWVASLLDKPTTRLI |
| Ga0318542_107248891 | 3300031668 | Soil | MEEIYCFAGNPLDRVSERRRDNAWIASLLEEQETRLIPL |
| Ga0318574_102513923 | 3300031680 | Soil | MEEIYCFAGNPLDRMSERRRDTGWIASLLDEPATRVIPFRDLKPLIRNG |
| Ga0318572_102076351 | 3300031681 | Soil | MEEIYCFAGNPLDRVSEHRRDAGWIASLLEAPATRLIPLRDLKPS |
| Ga0318572_105424421 | 3300031681 | Soil | MEEIYCFAGNPLDRMSERRRDTGWIASLLDEPATRVIPFRDL |
| Ga0318572_108017101 | 3300031681 | Soil | MEEIYCFGGNPLDRVSQRRQDAGWVASLLEEPATRV |
| Ga0318496_101044961 | 3300031713 | Soil | MEEIYCFAGNPLDRVSERRRDATWVASLLDKPTTRL |
| Ga0307469_103958182 | 3300031720 | Hardwood Forest Soil | MEDIYCFAGNPLDRVSERRDDRDWIASLLADSQTRILA |
| Ga0318501_105844521 | 3300031736 | Soil | MEEIYCFAGNPLDRVSEHRRDAGWIASLLEAPATRLIPLRD |
| Ga0318502_103530022 | 3300031747 | Soil | MEDIYCFAGNPLDRASERRGDREWIGKLLGEPDTRILPL |
| Ga0318502_103715533 | 3300031747 | Soil | MEEIYCFAGNPLDRVSEHRRDAGWIASLLEAPATRL |
| Ga0318502_105632971 | 3300031747 | Soil | MEEIYCFAGNPLDRMSERRRDTGWIASLLDEPATRV |
| Ga0318537_100528361 | 3300031763 | Soil | MEEIYCFAGNPLDRVSERRRDAGWIASLLDEPATRLILLRDLKPSIRNGSQMALDWQ |
| Ga0318554_103297922 | 3300031765 | Soil | MEEIYCFAGNPLDRVSERRRDATWVASLLDEPATRL |
| Ga0318509_107303231 | 3300031768 | Soil | MEEIYCFAGNPLDRVSERRRDAGWIASLLEEPATRLI |
| Ga0318546_100384841 | 3300031771 | Soil | MEEIYCFAGNPLDRMSERRRDTGWIASLLDEPATRVIPF |
| Ga0318543_100088001 | 3300031777 | Soil | MEEIYCFAGNPLDRVSERRRDAGWIASLLYEPATRLILLRDLKPSIR |
| Ga0318547_103464292 | 3300031781 | Soil | MEEIYCFAGNPLDRVSQRRQNPGWVASLLQDPDTQLL |
| Ga0318529_104178381 | 3300031792 | Soil | MEEIYCFAGNPLDRVSERRRDAGWIASLLYEPATRLI |
| Ga0318550_104498982 | 3300031797 | Soil | MEEIYCFAGNPLDRVSERRRDAGWIASLLDEPATRLIPLR |
| Ga0318497_100190145 | 3300031805 | Soil | MEEIYCFAGNPLDRVSERRRDAGWIASLLYEPATRLILLRDL |
| Ga0318511_103908941 | 3300031845 | Soil | MEEIYCFAGNPLDRVSERRRDAGWIASLLDEPATRLIPLRDL |
| Ga0318511_104402952 | 3300031845 | Soil | MEEIYCFAGNPLDRVSQRRQDSGWVASLLDHPETRVLPLHDLKPRVRHA |
| Ga0318512_107513821 | 3300031846 | Soil | MEEIYCFAGNPLDRVSERRRDTAWVVSLLEEPETRLIPLRDLKPSIRNGSEMA |
| Ga0318495_101959133 | 3300031860 | Soil | MEEIYCFAGNPLDRVSERRRDAGWIASLLDEPATRLILLRDLKPSIRNGSQLALD |
| Ga0318536_100490721 | 3300031893 | Soil | MEEIYCFAGNPLDRMSERRRDTGWIASLLDEPATRVIPFRDLKPL |
| Ga0318522_100802412 | 3300031894 | Soil | MEEIYCFAGNPLDRVSERRRDAGWIASLLDEPATRLIP |
| Ga0318520_106254901 | 3300031897 | Soil | MEEIYCFAGNPLDRVSQRRQDAGWVASLLEDPATRVLPL |
| Ga0306921_116374112 | 3300031912 | Soil | MEEIYCFAGNPLDRMSERRRDTGWIASLLDEPATRVIPFRDLKPSIRNGS |
| Ga0306921_117663843 | 3300031912 | Soil | MEEIYCFAGNPLDRVSERRRDTGWIASLLDEPATRVIPF |
| Ga0310916_101834211 | 3300031942 | Soil | MEEIYCFAGNPLDRVSERRRDAGWIASLLEEPVTRL |
| Ga0310916_104414612 | 3300031942 | Soil | MEEIYCFGGNPLDRVSQRRQDAGWVASLLEEPATRVLPLHGLKPLIR |
| Ga0310916_108394182 | 3300031942 | Soil | MEEIYCFAGNPLNRVSERRRDAGWIAALLDEPATRLIPLRDLKPSI |
| Ga0310916_109144342 | 3300031942 | Soil | MEEIYCFAGNPLDRVSERRRDNAWIASLLEEQETRL |
| Ga0310913_111300542 | 3300031945 | Soil | MEEIYCFAGNPLDRVSERRRDAGWIASLLEEPTTRLIP |
| Ga0318530_103306741 | 3300031959 | Soil | MEEIYCFAGNPLDRVSERRRDAGWIASLLDEPATRLILLRDL |
| Ga0307479_117533951 | 3300031962 | Hardwood Forest Soil | MEEVYCFAGNPLDRASERRRDSEWIGSLLDDPTARILPLHDLRPATR |
| Ga0318531_101624182 | 3300031981 | Soil | MEEIYCFAGNPLDRVSERRRDAGWIASLLDEPATRLIPL |
| Ga0318531_102998191 | 3300031981 | Soil | MEEIYCFAGNPLNRVSERRRDAGWIAALLDEPATRLIPLRDLKPSIR |
| Ga0318531_105218261 | 3300031981 | Soil | MEEIYCFAGNPLDRMSERRRDTGWIASLLDELATRVIPFRDLK |
| Ga0318569_103064912 | 3300032010 | Soil | MEEIYCFAGNPLNRVSERRRDAGWIAALLDEPATRLIPLRDL |
| Ga0318569_104666841 | 3300032010 | Soil | MEEIYCFAGNPLDRVSERRRDNAWIASLLEEPTTRLIPL |
| Ga0310911_103078933 | 3300032035 | Soil | MEEIYCFAGNPLDRMSERRRDTGWIASLLDEPATRVIPFRDLKPS |
| Ga0318559_100588041 | 3300032039 | Soil | MEEIYCFAGNPLDRVSERRRDAGWIASLLEEPATRVI |
| Ga0318556_103114762 | 3300032043 | Soil | MEEIYTFAGNPLDRVSQRRTDAGWVHSLLDDPATRVLPLNE |
| Ga0318533_100795191 | 3300032059 | Soil | MEEIYCFAGNPLDRVSERRRDATWVASLLDEPATRLIPLR |
| Ga0318504_100323194 | 3300032063 | Soil | MEEIYCFAGNPLDRVSERRRDATWVASLLDKPTTRLIPLR |
| Ga0318504_105557692 | 3300032063 | Soil | MEEIYCFAGNPLDRVSERRRDAGWIASLLYEPATRLILLRDLKP |
| Ga0318514_107037082 | 3300032066 | Soil | MEEIYCFAGNPLDRADERRRDAGWVASLLDETSSRLL |
| Ga0318518_104908471 | 3300032090 | Soil | MEEIYCFAGNPLDRVSERRRDNAWIASLLEEPTTRLIPLRDL |
| Ga0318540_101578151 | 3300032094 | Soil | MEEIYCFAGNPLDRMSERRRDTGWIASLLDEPATRVIP |
| Ga0307471_1003450951 | 3300032180 | Hardwood Forest Soil | MEDIYCFAGNPLDRVSERRDDRDWIAALLGDPQTRSRALRD |
| Ga0306920_1006798123 | 3300032261 | Soil | MEEIYCFAGNPLDRMSERRRDTGWIASLLDEPATRVIPFRDLKPSIR |
| Ga0310914_101596113 | 3300033289 | Soil | MEEIYCFGGNPLDRVSQRRQDAGWVASLLEEPATRVLPLH |
| ⦗Top⦘ |