NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F036746

Metagenome / Metatranscriptome Family F036746

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F036746
Family Type Metagenome / Metatranscriptome
Number of Sequences 169
Average Sequence Length 43 residues
Representative Sequence VGGAPLPRWTYAVPPIVGALLWPLLSVLLQWSQRPARSPAEL
Number of Associated Samples 149
Number of Associated Scaffolds 169

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 89.94 %
Associated GOLD sequencing projects 140
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.408 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen
(11.243 % of family members)
Environment Ontology (ENVO) Unclassified
(42.012 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(41.420 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 38.57%    β-sheet: 0.00%    Coil/Unstructured: 61.43%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 169 Family Scaffolds
PF03717PBP_dimer 88.17
PF01098FTSW_RODA_SPOVE 2.96
PF10861DUF2784 0.59
PF13847Methyltransf_31 0.59
PF06969HemN_C 0.59
PF08545ACP_syn_III 0.59

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 169 Family Scaffolds
COG0768Cell division protein FtsI, peptidoglycan transpeptidase (Penicillin-binding protein 2)Cell cycle control, cell division, chromosome partitioning [D] 88.17
COG0772Peptodoglycan polymerase FtsW/RodA/SpoVECell cycle control, cell division, chromosome partitioning [D] 2.96
COG0635Coproporphyrinogen-III oxidase HemN (oxygen-independent) or related Fe-S oxidoreductaseCoenzyme transport and metabolism [H] 0.59


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.41 %
UnclassifiedrootN/A0.59 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004050|Ga0055491_10066693All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria838Open in IMG/M
3300005093|Ga0062594_100408281All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira → Nitrosospira multiformis1101Open in IMG/M
3300005294|Ga0065705_10619232All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria695Open in IMG/M
3300005328|Ga0070676_10639458All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae771Open in IMG/M
3300005330|Ga0070690_100611869All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria828Open in IMG/M
3300005338|Ga0068868_100723763All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria892Open in IMG/M
3300005341|Ga0070691_10560371All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria669Open in IMG/M
3300005364|Ga0070673_100562986All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1036Open in IMG/M
3300005367|Ga0070667_100381881All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1280Open in IMG/M
3300005441|Ga0070700_100514746All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria923Open in IMG/M
3300005444|Ga0070694_101879376All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria511Open in IMG/M
3300005457|Ga0070662_100073195All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2531Open in IMG/M
3300005468|Ga0070707_102321874All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria504Open in IMG/M
3300005548|Ga0070665_102595159All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria507Open in IMG/M
3300005559|Ga0066700_10233635All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1280Open in IMG/M
3300005568|Ga0066703_10401481All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae823Open in IMG/M
3300005578|Ga0068854_101777826All Organisms → cellular organisms → Bacteria → Proteobacteria565Open in IMG/M
3300005614|Ga0068856_100038301All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria4706Open in IMG/M
3300005618|Ga0068864_100053229All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3491Open in IMG/M
3300005718|Ga0068866_11154879All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria557Open in IMG/M
3300005764|Ga0066903_101927377All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1133Open in IMG/M
3300005834|Ga0068851_10259699All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria988Open in IMG/M
3300005836|Ga0074470_10826912All Organisms → cellular organisms → Bacteria13073Open in IMG/M
3300005841|Ga0068863_101199138All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria765Open in IMG/M
3300005842|Ga0068858_100147201All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2212Open in IMG/M
3300005844|Ga0068862_102208407All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria562Open in IMG/M
3300006032|Ga0066696_10913607All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria559Open in IMG/M
3300006032|Ga0066696_11017353All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria527Open in IMG/M
3300006047|Ga0075024_100507843All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria633Open in IMG/M
3300006057|Ga0075026_100572262All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria660Open in IMG/M
3300006237|Ga0097621_101298465All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria687Open in IMG/M
3300006358|Ga0068871_101305951All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria682Open in IMG/M
3300006358|Ga0068871_102312144All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales512Open in IMG/M
3300006854|Ga0075425_101910245All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria665Open in IMG/M
3300006881|Ga0068865_101418273All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales620Open in IMG/M
3300006881|Ga0068865_101925054All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria536Open in IMG/M
3300006918|Ga0079216_10072870All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1574Open in IMG/M
3300007265|Ga0099794_10520391All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria627Open in IMG/M
3300009091|Ga0102851_12351292All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria608Open in IMG/M
3300009098|Ga0105245_10549335All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1177Open in IMG/M
3300009148|Ga0105243_11565164All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria685Open in IMG/M
3300009174|Ga0105241_10502438All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1081Open in IMG/M
3300009176|Ga0105242_10066599All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2975Open in IMG/M
3300009177|Ga0105248_12780833All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria558Open in IMG/M
3300009527|Ga0114942_1081952All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1041Open in IMG/M
3300009545|Ga0105237_12238724All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria556Open in IMG/M
3300009551|Ga0105238_11820335All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria641Open in IMG/M
3300009553|Ga0105249_11958290All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria659Open in IMG/M
3300009776|Ga0116154_10272962All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria729Open in IMG/M
3300010322|Ga0134084_10316797All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria584Open in IMG/M
3300010366|Ga0126379_11540717All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria770Open in IMG/M
3300010398|Ga0126383_10575742All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1194Open in IMG/M
3300011119|Ga0105246_11189212All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria701Open in IMG/M
3300011444|Ga0137463_1242297All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria673Open in IMG/M
3300012200|Ga0137382_10459928All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria901Open in IMG/M
3300012201|Ga0137365_10488679All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria905Open in IMG/M
3300012683|Ga0137398_10842506All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria641Open in IMG/M
3300012922|Ga0137394_11093557All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria660Open in IMG/M
3300013100|Ga0157373_11547548All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria507Open in IMG/M
3300013104|Ga0157370_10084698All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2979Open in IMG/M
3300013296|Ga0157374_10961651All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria873Open in IMG/M
3300013297|Ga0157378_10237675All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia1739Open in IMG/M
3300013297|Ga0157378_13007143All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria523Open in IMG/M
3300014315|Ga0075350_1023633All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1188Open in IMG/M
3300014316|Ga0075339_1181082All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria589Open in IMG/M
3300014497|Ga0182008_10980939All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria503Open in IMG/M
3300014968|Ga0157379_10233161All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1669Open in IMG/M
3300014969|Ga0157376_11482249All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria711Open in IMG/M
3300014969|Ga0157376_12103363All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria603Open in IMG/M
3300014969|Ga0157376_12223201All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria587Open in IMG/M
3300015372|Ga0132256_102523059All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria615Open in IMG/M
3300015373|Ga0132257_100436014All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae1598Open in IMG/M
3300015374|Ga0132255_104403744All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria597Open in IMG/M
3300016387|Ga0182040_11020990All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria690Open in IMG/M
3300017792|Ga0163161_10137727All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia1846Open in IMG/M
3300017959|Ga0187779_10133384All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1520Open in IMG/M
3300017973|Ga0187780_10932634All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria631Open in IMG/M
3300018058|Ga0187766_10668588All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria715Open in IMG/M
3300018081|Ga0184625_10153437All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1203Open in IMG/M
3300018083|Ga0184628_10269654All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria894Open in IMG/M
3300021859|Ga0210334_10314839All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria560Open in IMG/M
3300022389|Ga0210318_1059338All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria709Open in IMG/M
3300022549|Ga0212091_10131492All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria981Open in IMG/M
3300022756|Ga0222622_10554220All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria826Open in IMG/M
3300025898|Ga0207692_11000319All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria552Open in IMG/M
3300025903|Ga0207680_10359514All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1024Open in IMG/M
3300025907|Ga0207645_10144489All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia1551Open in IMG/M
3300025909|Ga0207705_11157872All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria594Open in IMG/M
3300025916|Ga0207663_10543843All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria907Open in IMG/M
3300025916|Ga0207663_11332132All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria578Open in IMG/M
3300025941|Ga0207711_10310785All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1455Open in IMG/M
3300025961|Ga0207712_10464702All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1076Open in IMG/M
3300025986|Ga0207658_11073792All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria735Open in IMG/M
3300026035|Ga0207703_10004578All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria11334Open in IMG/M
3300026041|Ga0207639_12248934All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria507Open in IMG/M
3300026078|Ga0207702_10060533All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae3228Open in IMG/M
3300026095|Ga0207676_10102978All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales2371Open in IMG/M
3300026095|Ga0207676_12303669All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria536Open in IMG/M
3300026121|Ga0207683_11716856All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria577Open in IMG/M
3300026295|Ga0209234_1222549All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria625Open in IMG/M
3300026538|Ga0209056_10273978All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1184Open in IMG/M
3300026538|Ga0209056_10650228All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria532Open in IMG/M
3300027543|Ga0209999_1089836All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300027698|Ga0209446_1091039All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria781Open in IMG/M
3300027792|Ga0209287_10138469All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria920Open in IMG/M
3300027887|Ga0208980_10185263All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1217Open in IMG/M
3300027899|Ga0209668_10619434All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria724Open in IMG/M
3300027915|Ga0209069_10706013All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria593Open in IMG/M
3300028651|Ga0302171_10060001All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria919Open in IMG/M
3300028652|Ga0302166_10104382All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria634Open in IMG/M
3300028733|Ga0302261_1017607All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1645Open in IMG/M
3300028743|Ga0302262_10042061All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1583Open in IMG/M
3300028777|Ga0302290_10012129Not Available2090Open in IMG/M
3300028792|Ga0307504_10094295All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria942Open in IMG/M
3300028869|Ga0302263_10040529All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1832Open in IMG/M
3300029989|Ga0311365_10478084All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1079Open in IMG/M
3300030000|Ga0311337_10285749All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1375Open in IMG/M
3300030003|Ga0302172_10013045All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales2381Open in IMG/M
3300030003|Ga0302172_10192039All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria642Open in IMG/M
3300030010|Ga0302299_10254747All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria924Open in IMG/M
3300030019|Ga0311348_11377070All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria524Open in IMG/M
3300030047|Ga0302286_10712999All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria513Open in IMG/M
3300030339|Ga0311360_10771042All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria764Open in IMG/M
3300030491|Ga0302211_10070132All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1004Open in IMG/M
3300030838|Ga0311335_11070465All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria576Open in IMG/M
3300030838|Ga0311335_11183299All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria548Open in IMG/M
3300030943|Ga0311366_10837057All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria798Open in IMG/M
3300030943|Ga0311366_11241802All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria642Open in IMG/M
3300031720|Ga0307469_10188524All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1596Open in IMG/M
3300031726|Ga0302321_100158270All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2333Open in IMG/M
3300031834|Ga0315290_10056161All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3211Open in IMG/M
3300031834|Ga0315290_10334954All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1325Open in IMG/M
3300031847|Ga0310907_10544326All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria626Open in IMG/M
3300031859|Ga0318527_10183143All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria884Open in IMG/M
3300031873|Ga0315297_10567956All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria953Open in IMG/M
3300031873|Ga0315297_10839456All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria765Open in IMG/M
3300031908|Ga0310900_11565959All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria557Open in IMG/M
3300031945|Ga0310913_10942706All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria606Open in IMG/M
3300031997|Ga0315278_12147265All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria518Open in IMG/M
3300032043|Ga0318556_10736720All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria513Open in IMG/M
3300032046|Ga0315289_11435337All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria532Open in IMG/M
3300032067|Ga0318524_10199938All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1021Open in IMG/M
3300032118|Ga0315277_10413272All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1381Open in IMG/M
3300032156|Ga0315295_10319832All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1573Open in IMG/M
3300032177|Ga0315276_10030044All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria5245Open in IMG/M
3300032180|Ga0307471_103788093All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria535Open in IMG/M
3300032205|Ga0307472_101217707All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria720Open in IMG/M
3300032205|Ga0307472_101590174All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria642Open in IMG/M
3300032256|Ga0315271_10077423All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales2475Open in IMG/M
3300032256|Ga0315271_11078933All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria694Open in IMG/M
3300032256|Ga0315271_11156025All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria669Open in IMG/M
3300032256|Ga0315271_11566615All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria567Open in IMG/M
3300032401|Ga0315275_12213727All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria575Open in IMG/M
3300032782|Ga0335082_11043369All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria682Open in IMG/M
3300033158|Ga0335077_10970846All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria850Open in IMG/M
3300033408|Ga0316605_10473359All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1148Open in IMG/M
3300033408|Ga0316605_11701343All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria613Open in IMG/M
3300033412|Ga0310810_10096496All Organisms → cellular organisms → Bacteria → Proteobacteria3530Open in IMG/M
3300033413|Ga0316603_11103427All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria750Open in IMG/M
3300033418|Ga0316625_102494346All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria522Open in IMG/M
3300033419|Ga0316601_101010435All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria830Open in IMG/M
3300033419|Ga0316601_102525423All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria516Open in IMG/M
3300033433|Ga0326726_10875047All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria871Open in IMG/M
3300033475|Ga0310811_11128305All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria659Open in IMG/M
3300033482|Ga0316627_102217235All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria574Open in IMG/M
3300033521|Ga0316616_102041844All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria760Open in IMG/M
3300033557|Ga0316617_101138110All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria771Open in IMG/M
3300034160|Ga0370510_0265604All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria540Open in IMG/M
3300034354|Ga0364943_0400365All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria530Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen11.24%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment8.28%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil6.51%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.14%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.55%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.96%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.37%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.37%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.37%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.37%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.37%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.78%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.78%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.78%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater1.18%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.18%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.18%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.18%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.18%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.18%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.18%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.18%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.18%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.18%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.59%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.59%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.59%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.59%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.59%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.59%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.59%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.59%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.59%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.59%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.59%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.59%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.59%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.59%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.59%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.59%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.59%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.59%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.59%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.59%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.59%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.59%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.59%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.59%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.59%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.59%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.59%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004050Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009527Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold CreekEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009776Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaGEngineeredOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014315Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1EnvironmentalOpen in IMG/M
3300014316Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1EnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300021859Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022389Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.24 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022549Cold Creek_combined assemblyEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027543Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027792Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027887Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 BulkEnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028651Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_2EnvironmentalOpen in IMG/M
3300028652Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_3EnvironmentalOpen in IMG/M
3300028733Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_4EnvironmentalOpen in IMG/M
3300028743Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4EnvironmentalOpen in IMG/M
3300028777Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_3EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028869Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4EnvironmentalOpen in IMG/M
3300029989III_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030003Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3EnvironmentalOpen in IMG/M
3300030010Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4EnvironmentalOpen in IMG/M
3300030019II_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030047Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3EnvironmentalOpen in IMG/M
3300030339III_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030491Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_3EnvironmentalOpen in IMG/M
3300030838I_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030943III_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032046Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M
3300034160Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03S_18EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0055491_1006669323300004050Natural And Restored WetlandsLCAALVLFVRVFGGASPPRLTYFAPALVGALLWPVLSVLLQLPQRPVRSASTL*
Ga0062594_10040828113300005093SoilGAPPPRWTYAVGSLTGALLWPLVTALLQWPQRPQRSPAER*
Ga0065705_1061923213300005294Switchgrass RhizosphereAPLPRWTYAVPPIVGALLWPLLSVLLQWPQRPSRNSSTL*
Ga0070676_1063945823300005328Miscanthus RhizosphereVGGAPLPRWTYLVPPLVGALLWPVITLLLQWPQRPQHSGAEL*
Ga0070690_10061186913300005330Switchgrass RhizosphereGGAPLPRWTYAVPPLVAALLWPVLTLAIQSWQRPQQSQTAL*
Ga0068868_10072376313300005338Miscanthus RhizosphereVGGAPLPRWTYAVPPIVGALLWPVVTRAIQSWQRPQASKSAL*
Ga0070691_1056037113300005341Corn, Switchgrass And Miscanthus RhizosphereIGGAPLPRWTYAAPPVVGALLWPLLSVLLQRPQRPRRRSEV*
Ga0070673_10056298613300005364Switchgrass RhizosphereIVGGAPLPRWTYVVPPLVGALLWPVVTVLLQWPQRPQHSGVEL*
Ga0070667_10038188113300005367Switchgrass RhizosphereVVGGAPVPRWTYLMSPIVGALLWPPLSILLQWPQRPMRSRGER*
Ga0070700_10051474613300005441Corn, Switchgrass And Miscanthus RhizosphereVLLGLCAALVLLVRVVGGAPLPHWMYAVPPLVGALLWPAVTLLLQWPQRPQHSSAEL*
Ga0070694_10187937623300005444Corn, Switchgrass And Miscanthus RhizosphereRIAGGAPPPRWTYVVGSLTGALLWPLVTVVLQWPQRPQRSSAEL*
Ga0070662_10007319513300005457Corn RhizosphereAPLPTWQYLVPPLVGALLWPVVSVLLQTPQRPSRSRTRS*
Ga0070707_10232187423300005468Corn, Switchgrass And Miscanthus RhizosphereVGGAPPPGWRYLASPLVGALLWPLVSVLLQTPQRPSRSGSRR*
Ga0070665_10259515913300005548Switchgrass RhizosphereWQYLVPPLVGALLWPVVSVLLQTPQRPSRSRTRS*
Ga0066700_1023363513300005559SoilAPIPRWTYAVGPLVGALLWPVVTTLLQWPQRPRRSQAEV*
Ga0066703_1040148123300005568SoilPRWTYAVPPVVGALMWPLLSVLLQFPQRPTHSSTER*
Ga0068854_10177782613300005578Corn RhizosphereVVLVRIVGGAPPPRWTYFIGPLAGAFLWPLISVILRLPQRPTGSGGDR*
Ga0068856_10003830113300005614Corn RhizospherePKWTYVAPPLVGALLWPLVSVLLQAPQRPSRSRR*
Ga0068864_10005322913300005618Switchgrass RhizosphereWTYFIPPIVGALLWPLLSALLQWPQRPSRSPSER*
Ga0068866_1115487913300005718Miscanthus RhizosphereMPRWTYFIPPIVGALLWPLLSALLQWPQRPSRSPSER*
Ga0066903_10192737713300005764Tropical Forest SoilRWTYAVPPLVGALLWPILTAAIQSGQRPQPSKSVL*
Ga0068851_1025969913300005834Corn RhizospherePPRWTYVVGSLTGALLWPLVTVVLQWPQRPQRSSAEL*
Ga0074470_1082691213300005836Sediment (Intertidal)LCAALVLLVRYVGGAPLPGWKYAAPPLVGALLWPIVTVAINWSQRPKHSSTAL*
Ga0068863_10119913823300005841Switchgrass RhizosphereVGGAPLPRWTYVVPPLVGALLWPVVTVLLQWPQRPQHSGVEL*
Ga0068858_10014720113300005842Switchgrass RhizospherePTWQYLVPPLVGALLWPVVSVLLQTPQRPSRSRTRS*
Ga0068862_10220840713300005844Switchgrass RhizosphereGGAPLPRWTYAAPPLVGALLWPLLSVLLQRPQRPRRRSDS*
Ga0066696_1091360723300006032SoilVAALLALCAAIVLLVRIVGGAPLPRWTYAAPPIIGALMWPVLSVLLQYPQRPMPSTAKR*
Ga0066696_1101735313300006032SoilVGGAPMPRWTYVVGPLVGALLWPVVTVLLQWPQRPRRSSGER*
Ga0075024_10050784323300006047WatershedsLVLLVRYVGGAALPRWTYAIPPLVGALLWPSVTVLLQWPQRPLQSSAEL*
Ga0075026_10057226223300006057WatershedsWTYAVPPVVGALLWPVVTMLMQWPQRPKHSSAAL*
Ga0097621_10129846513300006237Miscanthus RhizosphereGGAPLPRWTYVAPPLVGALLWPLVSVVLQWPQRPARSPAEL*
Ga0068871_10130595123300006358Miscanthus RhizosphereVRVVGGAPLPRWTYAVPPIVGALLWPLLSVLLQWSQRPARSPAEL*
Ga0068871_10231214413300006358Miscanthus RhizosphereTWQYLVPPLVGALLWPVVSVLLQTPQRPSRSRTRS*
Ga0075425_10191024523300006854Populus RhizosphereLIRFVGGATMPRWTYAAPPLLGALLWPLVSAVLQWPQRPPRSPGDR*
Ga0068865_10141827323300006881Miscanthus RhizosphereLLIRVVGGAPLPRLMYVTPPLVGALLWPLFSVVLQWPQRPRLSPSDL*
Ga0068865_10192505413300006881Miscanthus RhizosphereLPRWTYAVPPIVGALLWPLLSVLLQWPQRPSRNSSTL*
Ga0079216_1007287023300006918Agricultural SoilCAALVLLVRVVGGSPLPPWTYFVSALSGAAVWPIASVLLQVPQRPLRSSATL*
Ga0099794_1052039113300007265Vadose Zone SoilRWTYVVPPIVGALLWPLVSVLLQWSQRPARSAGER*
Ga0102851_1235129223300009091Freshwater WetlandsGGAPLPRWTYAVPPIVGALLWPVISVMLQWPQRPLRSRAGL*
Ga0105245_1054933523300009098Miscanthus RhizosphereVLLVRVVGGAPLPRWTYAVPPIVGALLWPLLSVLLQWSQRPARSPAEL*
Ga0105243_1156516413300009148Miscanthus RhizosphereWTYAVPPIVGALLWPLLSVLLQWSQRPARSPAEL*
Ga0105241_1050243823300009174Corn RhizosphereWTYAVGSLTGALLWPLVTVLLQWPQRSHGMPSER*
Ga0105242_1006659933300009176Miscanthus RhizospherePLPRWTYAVPPLVGALLWPAVTMLLQWPQRPQHSPVEL*
Ga0105248_1278083313300009177Switchgrass RhizosphereRWTYVVPPLVGALLWPAVTLLLQWPQRPQHSSREL*
Ga0114942_108195213300009527GroundwaterLVLAVRLIGGAPLPRWTYAVPPITGALLWPLLSVLLQWPQRPHRRSTTL*
Ga0105237_1223872413300009545Corn RhizospherePRWTYAAPPLVGALLWPLLSVLLQRPQRPRRRSDS*
Ga0105238_1182033523300009551Corn RhizosphereVGGAPLPRWTYAVPPVVGALLWPPLSVLLQWPQRPTRSRSDR*
Ga0105249_1195829023300009553Switchgrass RhizosphereGGAPLPRWTYAVPPVVGALLWPPLSVLLQWPQRPARSRGDR*
Ga0116154_1027296223300009776Anaerobic Digestor SludgePRWTYAVPPIVGALLWPPLTVVLQWPQRPTRSSSTF*
Ga0134084_1031679723300010322Grasslands SoilVPRWTYAVGPLVGALLWPVVTILLQWPQRPRRSQAEV*
Ga0126379_1154071713300010366Tropical Forest SoilGGAPMPRWTYMAPPLLSALLWPLVSAVLQWPQRPPRSPADR*
Ga0126383_1057574223300010398Tropical Forest SoilVGGAPLPRWTYAVGPLTGALLWPIVSVLLQWPQRPTRGER*
Ga0105246_1118921213300011119Miscanthus RhizosphereAVLLGLCSALVLLVRFVGGAPLPRWTYAVPPIVGALLWPVVTRAIQSWQRPQASKSAL*
Ga0137463_124229713300011444SoilPLPRWSYAVGPLTGALLWPAVTVLLQWPQRPPLSRAER*
Ga0137382_1045992823300012200Vadose Zone SoilLCAAIVLLVRIVGGAPLPRWTYAVPPVVGALMWPLLSVLLQYPQRPTRSSAKR*
Ga0137365_1048867923300012201Vadose Zone SoilGGAPMPRWTYAVPPLVSALLWPFVSVVLQWPQRPQRSSAEL*
Ga0137398_1084250613300012683Vadose Zone SoilGAPLPRWSYAVGALTGALLWPVLTVLLQWPQRPKRSTAEL*
Ga0137394_1109355723300012922Vadose Zone SoilLPRWTYAVPPVVGALLWPIVTLAIQWSQRPQPSSNAL*
Ga0157373_1154754823300013100Corn RhizosphereVGGATLPQWTYLAPALVGACLWPLVSVLLQSPQRPSRSRRRDGF*
Ga0157370_1008469813300013104Corn RhizosphereLVRFVGGATLPKWTYLAPALVGACLWPLVSVLLQSPQRPSRSRRRDGF*
Ga0157374_1096165113300013296Miscanthus RhizosphereRIVGGAPLPRLTYLVPPLVGALLWPVITVLLQWPQRPQHSGVEL*
Ga0157378_1023767523300013297Miscanthus RhizosphereGAPLPTWQYLVPPLVGALLWPVVSVLLQTPQRPSRSRTRS*
Ga0157378_1300714323300013297Miscanthus RhizosphereVLLVRFVGGAPLPRWTCAVPPIVGALLWPILTLAIQSWQRPQPSKTAL*
Ga0075350_102363313300014315Natural And Restored WetlandsGAPAPRLTYFAPALVGALLWPVLSVLLQPPQRHVRSAASL*
Ga0075339_118108213300014316Natural And Restored WetlandsWTYAVPPLSGALLWPALSVLLQWPQRPAPSASEL*
Ga0182008_1098093913300014497RhizosphereRAAPALVGACLWPLVSVLLQSPQRPSRSRRRDGF*
Ga0157379_1023316123300014968Switchgrass RhizosphereLVRFVGGAPLPRWTYAVPPVVGALLWPVVTRAIQSWQRPQASKSAL*
Ga0157376_1148224913300014969Miscanthus RhizospherePLPTWSYVAPPLVGALLWPLVSVLLQTPQRPSRSRTRN*
Ga0157376_1210336313300014969Miscanthus RhizosphereVRFVGGAPLPRWTYAAPPIVGALLWPILTRAIQSWQHPQPSKTAL*
Ga0157376_1222320123300014969Miscanthus RhizosphereTLCAAIVLLIRLFGGAPLPRWTYVVPSLVGALMWPLMSVMLQWPQRPPPSPADL*
Ga0132256_10252305913300015372Arabidopsis RhizosphereSLPRWTYVAPSLVGALLWPVLSVLLQWPQRPTHAPAEL*
Ga0132257_10043601423300015373Arabidopsis RhizospherePGWTYLAPPLVGAALWPLVSVLLQTPQRPSRSGSRR*
Ga0132255_10440374413300015374Arabidopsis RhizosphereALVLLVRFVGGAPLPRWTYAVPPVVGALLWPILTLAIQSWQRPQPSKTAL*
Ga0182040_1102099023300016387SoilLGLCSALVLLVRFVGGAPLPRWTYGVPPLVGALLWPILTAAIQSWQRPQPSKSVL
Ga0163161_1013772723300017792Switchgrass RhizosphereGAPLPTWQYLVPPLVGALLWPVVSVLLQTPQRPSRSRTRS
Ga0187779_1013338413300017959Tropical PeatlandRWTYAVGSLAGALLWPPLSVLLQWPQRPPRSPGEL
Ga0187780_1093263423300017973Tropical PeatlandVVGGAPLPRWTYAVGSLTGALLWPPLTVLLQWPQRPPRSPGER
Ga0187766_1066858813300018058Tropical PeatlandPLPRWTYAVGALTGALLWPPLSVLLQRPQRPPRSPGEL
Ga0184625_1015343713300018081Groundwater SedimentRFVGGAPLPHWMYAVPPLVGALLWPAVTLLLQWPQRPQYSSGEL
Ga0184628_1026965423300018083Groundwater SedimentTVGGAPLPRWTYVVPSLVGALLWPLVSVVLQWPQRPPPSPAER
Ga0210334_1031483923300021859EstuarineLVRYVGGAPLPRWTYVVPPLVGALLWPVLTVALQWTQRPQRSSAEL
Ga0210318_105933823300022389EstuarineVGGAPLPRWTYAVPPLAGALLWPVLTVALQWTQRPQHSSAEL
Ga0212091_1013149213300022549GroundwaterRWTYAVPPITGALLWPLLSVLLQWPQRPHRRSTTL
Ga0222622_1055422013300022756Groundwater SedimentTAGLVLVVRFIGGAPMPRWTYAAPPIVGALLWPLLSVLLQRPQRPRRRGDR
Ga0207692_1100031923300025898Corn, Switchgrass And Miscanthus RhizosphereGAPPPRWTYAVGSLTGALLWPLVTALLQWPQRPQRSPAER
Ga0207680_1035951423300025903Switchgrass RhizosphereGGAPLPRWTYAVPPIVGALLWPVVTRAIQSWQRPQASKSAL
Ga0207645_1014448923300025907Miscanthus RhizosphereWTYAAPPFVGALLWPLLSVLLQYPQRPNHASSNKR
Ga0207705_1115787223300025909Corn RhizosphereVGGAPLPHWQYLVPPLVGALLWPIVSVLLQTPQRPSRSRTRN
Ga0207663_1054384323300025916Corn, Switchgrass And Miscanthus RhizospherePPPRWTYVVGSLTGALLWPLVTVVLQWPQRPQRSSAEL
Ga0207663_1133213213300025916Corn, Switchgrass And Miscanthus RhizosphereAPLPKWTYVAPPLVGALLWPLVSVLLQAPQRPSRSRR
Ga0207711_1031078513300025941Switchgrass RhizospherePLPRWTYAVPPVVGALLWPPLSVLLQWPQRPTRSRSDR
Ga0207712_1046470223300025961Switchgrass RhizospherePRWTYAVPPLVGALLWPAVTMVLQWPQRPQHSPVEL
Ga0207658_1107379223300025986Switchgrass RhizosphereGGAPLPRWTYAVPPVVGALLWPPLSVLLQWPQRPARSRGDR
Ga0207703_10004578203300026035Switchgrass RhizosphereVGGAPLPRWTYAVPPIVGALLWPLLSVLLQWSQRPARSPAEL
Ga0207639_1224893423300026041Corn RhizospherePMPRWTYFIPPIVGALLWPLLSALLQWPQRPSRSPSER
Ga0207702_1006053333300026078Corn RhizosphereVRIVGGAPSPRWTYAVPPLVGALLWPALSVLLQYPQRPNRSSSKR
Ga0207676_1010297813300026095Switchgrass RhizosphereVGGAPLPRWTYAVPPIVGALLWPVVTRAIQSWQRPQASKSAL
Ga0207676_1230366923300026095Switchgrass RhizosphereALLVLLVRVVGGAPLPRWTYAVPPIVGALLWPLLSVLLQWSQRPARSPAEL
Ga0207683_1171685623300026121Miscanthus RhizosphereLVVRFIGGAPMPRWTYAAPPIVGALLWPLLSVLLQRPQRPRRRGDR
Ga0209234_122254923300026295Grasslands SoilPIPRWTYAVGPLVGALLWPVVTTLLQWPQRPRRSQAEV
Ga0209056_1027397823300026538SoilIPRWTYAVGPLVGALLWPVVTTLLQWPQRPRRSQAEV
Ga0209056_1065022813300026538SoilRIVGGAPLPRWTYAVPPVVGALLWPLLSVLLQYPQRPTRSSTKR
Ga0209999_108983613300027543Arabidopsis Thaliana RhizosphereMIGSAPLPRWTYAVPPIVGALLWPLLTVVLQWPQRPSRRSTTL
Ga0209446_109103913300027698Bog Forest SoilVVGGAPLPRWTYAVGPLVGALLWPAVSALLQWPQRPPRSPAER
Ga0209287_1013846913300027792Freshwater SedimentLFVRVFGGAPMPRLTYFVPALVGALLWPAFSVLLQLPQRPVRSSATL
Ga0208980_1018526313300027887WetlandPRWTYAVPPLAGALLWPAVSVVMQWPQRPQKSATELS
Ga0209668_1061943413300027899Freshwater Lake SedimentLLSLCAGLVLLVRYVGGAPLPRWTYAVPPLVGALLWPVLTVALQWTQRPQRSSAEL
Ga0209069_1070601323300027915WatershedsLVLLVRYVGGAALPRWTYAIPPLVGALLWPSVTVLLQWPQRPLQSSAEL
Ga0302171_1006000123300028651FenLVLLVRVVGNAPLPRWTYVVPPIVGALLWPLLSVLLQWSQRPSRSTSER
Ga0302166_1010438213300028652FenRVVGGAPLPRWTYAVPPLVGALLWPLLSVLLQWSQRPARSPSER
Ga0302261_101760713300028733FenVGNAPLPRWTYAVPPIVGALLWPFLSVLLQWSQRPARSTSER
Ga0302262_1004206123300028743FenPRWTYVVPPIVGALLWPLLSVLLQWSQRPSRSTSER
Ga0302290_1001212913300028777FenVLLMVCALLVLLVRVVGNAPLPRWTYVVPPIVGALLWPLLSVLLQWSQRPSRSTSER
Ga0307504_1009429513300028792SoilVVGGAPVPRWTYAVGPLVGAFLWPVVTVLLQRPQRPRRSRQEH
Ga0302263_1004052913300028869FenLVLLVRVVGGAPLPRWTYAAPPIVGALLWPLVSVLLQWSQRPSRSPSQR
Ga0311365_1047808413300029989FenQFMSGANMPRWSYAAPPLVGALLWPLVSVMLQWPQRPQRSASER
Ga0311337_1028574923300030000FenLPRWTYAVPPIVGALLWPLVSVLLQWSQRPSRSPSQR
Ga0302172_1001304533300030003FenVGNAPLPRWTYVVPPIVGALLWPLLSVLLQWSQRPSRSTSER
Ga0302172_1019203913300030003FenRVVGNAPLPRWTYAVPPIVGALLWPLLSVLLQWSQRPARSNSER
Ga0302299_1025474723300030010FenQFMGGANMPRWSYAAPPLVGALLWPLVSVMLQWPQRPQRSASER
Ga0311348_1137707013300030019FenGAPLPRWTYAVPPIVGALLWPLVSVLLQWSQRPSRSPSQR
Ga0302286_1071299913300030047FenLPRWTYAVPPIVGALLWPLLSVLLQWSQRPTRSSAQL
Ga0311360_1077104213300030339BogVLLMVCALLVLLVRVVGTAPLPRWTYAVPPIVGALLWPLLSVLLQWSQRPTRSSAQL
Ga0302211_1007013223300030491FenVGGAPLPRWTYAVPPIVGALLWPLVSVLLQWSQRPSRSPSQR
Ga0311335_1107046523300030838FenLLVRVVGTAPLPRWTYAVPPIVGALLWPLLSVLLQWSQRPTRSSAQL
Ga0311335_1118329913300030838FenVLLVRVVGSAPMPRWTYAVPPLVGALLWPLVSVLLQWSQRPDRSPSER
Ga0311366_1083705713300030943FenLPRWTYAVPPIVGALLWPFLSVLLQWSQRPARSTSER
Ga0311366_1124180213300030943FenLLGLCATLVLIVRTVGGAPVPRWTYAMPSIVGALMWPVVTRVLQWPQRPQRTPDKL
Ga0307469_1018852413300031720Hardwood Forest SoilPRWTYVVPPVVGALLWPIVTLAVQSWQRPQTSKSAL
Ga0302321_10015827033300031726FenLVLLVRVVGGAPLPRWTYAVPPIVGALLWPLVSVLLQWSQRPSRSPSQR
Ga0315290_1005616113300031834SedimentAPLPRWTYVVPPLVGALLWPLVSVMLQWPQRPPSSASDL
Ga0315290_1033495423300031834SedimentVGGAPLPRWTYAVPPLVGAFLWPVLTLVLQWSQRPRHSSAAL
Ga0310907_1054432613300031847SoilAVLPRWTYFAPPLVGALLWPLISVLLQTPQRPSRSGARR
Ga0318527_1018314313300031859SoilRWTYAVPPITGALLWPLVSVLLQWPQRPTRGTTER
Ga0315297_1056795623300031873SedimentVRYVGGAPLPRWTYAVPPLVGAFLWPVVTLVLQWLPRPQHSSTAL
Ga0315297_1083945623300031873SedimentVIRYVGGAPLPRWTYVVPSLVGALLWPLVSVVLQWPQRPPPSPAKR
Ga0310900_1156595923300031908SoilRWTYLMSPIVGALLWPPLSILLQWPQRPTRSRGERQRTL
Ga0310913_1094270613300031945SoilALCSSLVLLVRFVGGAPLPRWTYAVPPLIGALLWPILTLAIQSWQRPQPSRNAL
Ga0315278_1214726513300031997SedimentRWTYLAPSLVGALLWPFVSVVLQTPQRPPPSPADL
Ga0318556_1073672023300032043SoilGLCSALVLLVRFVGGAPLPRWTYGVPPLVGALLWPILTAAIQSWQRPQPSKSVL
Ga0315289_1143533713300032046SedimentLPRWTYAVPPLVGALLWPALTVALQWTQRPQRSSAEL
Ga0318524_1019993823300032067SoilLCSSLVLLVRFVGGAPLPRWTYAVPPLIGALLWPILTLAIQSWQRPQPSRNAL
Ga0315277_1041327213300032118SedimentAVLLGLCAALVLLVRYVGGAPLPRWTYAVPPLAGALLWPVVTLVLQWSPRPQHSSTAL
Ga0315295_1031983213300032156SedimentGAPLPRWTYAVPPLVGALLWPVLTVALQWTQRPQRSSAEL
Ga0315276_1003004413300032177SedimentVGGAPLPRWTYAVPPLVGALLWPAVTLVLQWPQRPQHGTAEL
Ga0307471_10378809313300032180Hardwood Forest SoilCAALVLLVRFVGGAPLPRWMYAVPPLVGALLWPAVTLLLQWPQRPQYSSAEL
Ga0307472_10121770713300032205Hardwood Forest SoilLVALVRIVGGAPMPRWTYAMGSLTGALLWPVLTVVLQWPQRPPRSQAEL
Ga0307472_10159017423300032205Hardwood Forest SoilGASIPRWTYAVGPLVGALLWPVVTTLLQWPQRPRRSQAEV
Ga0315271_1007742313300032256SedimentLVLLVRVVGNAPLPRWTYAVPPIVGALLWPLLSVLLQWSQRPARSSSER
Ga0315271_1107893313300032256SedimentLLVLLVRVVGGAPLPRWTYAVPPIVGALLWPLVSVLLQWSQRPARSMAEL
Ga0315271_1115602513300032256SedimentLMICALLVLLVRVVGSAPLPRWTYAVPPIVGALLWPLVSVLLRWSQRPSRSTSEL
Ga0315271_1156661523300032256SedimentLLVRYVGGAPLPRWTYAVPPLVGALLWPVVTLVLQWLQRPGGH
Ga0315275_1221372713300032401SedimentAQVAMLLGLCAALVLLVRYVGGAPLPRWTYAVPPLVGAFLWPVVTLVLQWLPRPQHSSTT
Ga0335082_1104336923300032782SoilLLVRFVGGAPVPRWTYAVPPAVGALLWPVLTAAIQSWQRPQPSKSAL
Ga0335077_1097084623300033158SoilGLTSALVLLVRFVGGAPVPRWTYAVPPAVGALLWPVLTAAIQSWQRPQPSKSAL
Ga0316605_1047335923300033408SoilLCAGLVVLVRVVGGSPLPRWTYAVPPLSAALLWPVLSVLLQWPQRPTRSAAAL
Ga0316605_1170134313300033408SoilAPLPRWTYAVPPIVGALLWPVISVMLQWPQRPLRSRAGL
Ga0310810_1009649613300033412SoilLPRWTYAVPPIVGALLWPLLTVVLQWPQRPSRRSATL
Ga0316603_1110342723300033413SoilFGGAPMPRLTYFVPALVGALLWPALSVLLQLPQRPVRSTATL
Ga0316625_10249434613300033418SoilLFVRVFGGAPMPRLTYFVPALVGALLWPALSVLLQLPQRPVRSTATL
Ga0316601_10101043523300033419SoilGGAPLPRWTYAVPPLVGALLWPFVSVVLQWPQRPPRSPAEM
Ga0316601_10252542323300033419SoilGAPMPRLIFFAPPLAGALLWPVLSVLLQLPQRPVRSTATL
Ga0326726_1087504713300033433Peat SoilAALVLLIRFVGGAPLPQLTYAAPPFVGALLWPVISVVLQWPQRPRRSSEL
Ga0310811_1112830523300033475SoilGAPLPHWQYLVPPLVGALLWPIVSVLLQTPQRPSRSRTRN
Ga0316627_10221723523300033482SoilCAGLVLVVRVVGGAPLPRWTYAVPPLVGALIWPFVSVVLQWPQRPPRSPAEM
Ga0316616_10204184413300033521SoilIVLLVRVVGGAPLPRWTYFVSPLVGALAWPLLSVLLQLPQRPVRSSSTL
Ga0316617_10113811013300033557SoilLLSLCAGLVLVVRVVGGAPLPRWTYAVPPLVGALIWPFVSVVLQWPQRPPRSPAEM
Ga0370510_0265604_377_5383300034160Untreated Peat SoilLCAGLVVLVRAVGGAPLPRWTYAVPPLSGALLWPVITVMLQWPQRPTRSAAEL
Ga0364943_0400365_417_5303300034354SedimentLPRWTYAVPPIVGALLWPLVSVLLQWSQRPARSPSEL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.