Basic Information | |
---|---|
Family ID | F036746 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 169 |
Average Sequence Length | 43 residues |
Representative Sequence | VGGAPLPRWTYAVPPIVGALLWPLLSVLLQWSQRPARSPAEL |
Number of Associated Samples | 149 |
Number of Associated Scaffolds | 169 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 89.94 % |
Associated GOLD sequencing projects | 140 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.408 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (11.243 % of family members) |
Environment Ontology (ENVO) | Unclassified (42.012 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.420 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.57% β-sheet: 0.00% Coil/Unstructured: 61.43% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 169 Family Scaffolds |
---|---|---|
PF03717 | PBP_dimer | 88.17 |
PF01098 | FTSW_RODA_SPOVE | 2.96 |
PF10861 | DUF2784 | 0.59 |
PF13847 | Methyltransf_31 | 0.59 |
PF06969 | HemN_C | 0.59 |
PF08545 | ACP_syn_III | 0.59 |
COG ID | Name | Functional Category | % Frequency in 169 Family Scaffolds |
---|---|---|---|
COG0768 | Cell division protein FtsI, peptidoglycan transpeptidase (Penicillin-binding protein 2) | Cell cycle control, cell division, chromosome partitioning [D] | 88.17 |
COG0772 | Peptodoglycan polymerase FtsW/RodA/SpoVE | Cell cycle control, cell division, chromosome partitioning [D] | 2.96 |
COG0635 | Coproporphyrinogen-III oxidase HemN (oxygen-independent) or related Fe-S oxidoreductase | Coenzyme transport and metabolism [H] | 0.59 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.41 % |
Unclassified | root | N/A | 0.59 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004050|Ga0055491_10066693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 838 | Open in IMG/M |
3300005093|Ga0062594_100408281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira → Nitrosospira multiformis | 1101 | Open in IMG/M |
3300005294|Ga0065705_10619232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 695 | Open in IMG/M |
3300005328|Ga0070676_10639458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae | 771 | Open in IMG/M |
3300005330|Ga0070690_100611869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 828 | Open in IMG/M |
3300005338|Ga0068868_100723763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 892 | Open in IMG/M |
3300005341|Ga0070691_10560371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 669 | Open in IMG/M |
3300005364|Ga0070673_100562986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1036 | Open in IMG/M |
3300005367|Ga0070667_100381881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1280 | Open in IMG/M |
3300005441|Ga0070700_100514746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 923 | Open in IMG/M |
3300005444|Ga0070694_101879376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 511 | Open in IMG/M |
3300005457|Ga0070662_100073195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2531 | Open in IMG/M |
3300005468|Ga0070707_102321874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 504 | Open in IMG/M |
3300005548|Ga0070665_102595159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 507 | Open in IMG/M |
3300005559|Ga0066700_10233635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1280 | Open in IMG/M |
3300005568|Ga0066703_10401481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae | 823 | Open in IMG/M |
3300005578|Ga0068854_101777826 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 565 | Open in IMG/M |
3300005614|Ga0068856_100038301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4706 | Open in IMG/M |
3300005618|Ga0068864_100053229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3491 | Open in IMG/M |
3300005718|Ga0068866_11154879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 557 | Open in IMG/M |
3300005764|Ga0066903_101927377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1133 | Open in IMG/M |
3300005834|Ga0068851_10259699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 988 | Open in IMG/M |
3300005836|Ga0074470_10826912 | All Organisms → cellular organisms → Bacteria | 13073 | Open in IMG/M |
3300005841|Ga0068863_101199138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 765 | Open in IMG/M |
3300005842|Ga0068858_100147201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2212 | Open in IMG/M |
3300005844|Ga0068862_102208407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 562 | Open in IMG/M |
3300006032|Ga0066696_10913607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 559 | Open in IMG/M |
3300006032|Ga0066696_11017353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 527 | Open in IMG/M |
3300006047|Ga0075024_100507843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 633 | Open in IMG/M |
3300006057|Ga0075026_100572262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 660 | Open in IMG/M |
3300006237|Ga0097621_101298465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 687 | Open in IMG/M |
3300006358|Ga0068871_101305951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 682 | Open in IMG/M |
3300006358|Ga0068871_102312144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 512 | Open in IMG/M |
3300006854|Ga0075425_101910245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 665 | Open in IMG/M |
3300006881|Ga0068865_101418273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 620 | Open in IMG/M |
3300006881|Ga0068865_101925054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 536 | Open in IMG/M |
3300006918|Ga0079216_10072870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1574 | Open in IMG/M |
3300007265|Ga0099794_10520391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 627 | Open in IMG/M |
3300009091|Ga0102851_12351292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 608 | Open in IMG/M |
3300009098|Ga0105245_10549335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1177 | Open in IMG/M |
3300009148|Ga0105243_11565164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 685 | Open in IMG/M |
3300009174|Ga0105241_10502438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1081 | Open in IMG/M |
3300009176|Ga0105242_10066599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2975 | Open in IMG/M |
3300009177|Ga0105248_12780833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 558 | Open in IMG/M |
3300009527|Ga0114942_1081952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1041 | Open in IMG/M |
3300009545|Ga0105237_12238724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 556 | Open in IMG/M |
3300009551|Ga0105238_11820335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 641 | Open in IMG/M |
3300009553|Ga0105249_11958290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 659 | Open in IMG/M |
3300009776|Ga0116154_10272962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 729 | Open in IMG/M |
3300010322|Ga0134084_10316797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 584 | Open in IMG/M |
3300010366|Ga0126379_11540717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 770 | Open in IMG/M |
3300010398|Ga0126383_10575742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1194 | Open in IMG/M |
3300011119|Ga0105246_11189212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 701 | Open in IMG/M |
3300011444|Ga0137463_1242297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 673 | Open in IMG/M |
3300012200|Ga0137382_10459928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 901 | Open in IMG/M |
3300012201|Ga0137365_10488679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 905 | Open in IMG/M |
3300012683|Ga0137398_10842506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 641 | Open in IMG/M |
3300012922|Ga0137394_11093557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 660 | Open in IMG/M |
3300013100|Ga0157373_11547548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 507 | Open in IMG/M |
3300013104|Ga0157370_10084698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2979 | Open in IMG/M |
3300013296|Ga0157374_10961651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 873 | Open in IMG/M |
3300013297|Ga0157378_10237675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 1739 | Open in IMG/M |
3300013297|Ga0157378_13007143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 523 | Open in IMG/M |
3300014315|Ga0075350_1023633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1188 | Open in IMG/M |
3300014316|Ga0075339_1181082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 589 | Open in IMG/M |
3300014497|Ga0182008_10980939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 503 | Open in IMG/M |
3300014968|Ga0157379_10233161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1669 | Open in IMG/M |
3300014969|Ga0157376_11482249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 711 | Open in IMG/M |
3300014969|Ga0157376_12103363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 603 | Open in IMG/M |
3300014969|Ga0157376_12223201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 587 | Open in IMG/M |
3300015372|Ga0132256_102523059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 615 | Open in IMG/M |
3300015373|Ga0132257_100436014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1598 | Open in IMG/M |
3300015374|Ga0132255_104403744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 597 | Open in IMG/M |
3300016387|Ga0182040_11020990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 690 | Open in IMG/M |
3300017792|Ga0163161_10137727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 1846 | Open in IMG/M |
3300017959|Ga0187779_10133384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1520 | Open in IMG/M |
3300017973|Ga0187780_10932634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 631 | Open in IMG/M |
3300018058|Ga0187766_10668588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 715 | Open in IMG/M |
3300018081|Ga0184625_10153437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1203 | Open in IMG/M |
3300018083|Ga0184628_10269654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 894 | Open in IMG/M |
3300021859|Ga0210334_10314839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 560 | Open in IMG/M |
3300022389|Ga0210318_1059338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 709 | Open in IMG/M |
3300022549|Ga0212091_10131492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 981 | Open in IMG/M |
3300022756|Ga0222622_10554220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 826 | Open in IMG/M |
3300025898|Ga0207692_11000319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 552 | Open in IMG/M |
3300025903|Ga0207680_10359514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1024 | Open in IMG/M |
3300025907|Ga0207645_10144489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 1551 | Open in IMG/M |
3300025909|Ga0207705_11157872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 594 | Open in IMG/M |
3300025916|Ga0207663_10543843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 907 | Open in IMG/M |
3300025916|Ga0207663_11332132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 578 | Open in IMG/M |
3300025941|Ga0207711_10310785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1455 | Open in IMG/M |
3300025961|Ga0207712_10464702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1076 | Open in IMG/M |
3300025986|Ga0207658_11073792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 735 | Open in IMG/M |
3300026035|Ga0207703_10004578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 11334 | Open in IMG/M |
3300026041|Ga0207639_12248934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 507 | Open in IMG/M |
3300026078|Ga0207702_10060533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 3228 | Open in IMG/M |
3300026095|Ga0207676_10102978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 2371 | Open in IMG/M |
3300026095|Ga0207676_12303669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 536 | Open in IMG/M |
3300026121|Ga0207683_11716856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 577 | Open in IMG/M |
3300026295|Ga0209234_1222549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 625 | Open in IMG/M |
3300026538|Ga0209056_10273978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1184 | Open in IMG/M |
3300026538|Ga0209056_10650228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 532 | Open in IMG/M |
3300027543|Ga0209999_1089836 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300027698|Ga0209446_1091039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 781 | Open in IMG/M |
3300027792|Ga0209287_10138469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 920 | Open in IMG/M |
3300027887|Ga0208980_10185263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1217 | Open in IMG/M |
3300027899|Ga0209668_10619434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 724 | Open in IMG/M |
3300027915|Ga0209069_10706013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 593 | Open in IMG/M |
3300028651|Ga0302171_10060001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 919 | Open in IMG/M |
3300028652|Ga0302166_10104382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 634 | Open in IMG/M |
3300028733|Ga0302261_1017607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1645 | Open in IMG/M |
3300028743|Ga0302262_10042061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1583 | Open in IMG/M |
3300028777|Ga0302290_10012129 | Not Available | 2090 | Open in IMG/M |
3300028792|Ga0307504_10094295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 942 | Open in IMG/M |
3300028869|Ga0302263_10040529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1832 | Open in IMG/M |
3300029989|Ga0311365_10478084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1079 | Open in IMG/M |
3300030000|Ga0311337_10285749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1375 | Open in IMG/M |
3300030003|Ga0302172_10013045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 2381 | Open in IMG/M |
3300030003|Ga0302172_10192039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 642 | Open in IMG/M |
3300030010|Ga0302299_10254747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 924 | Open in IMG/M |
3300030019|Ga0311348_11377070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 524 | Open in IMG/M |
3300030047|Ga0302286_10712999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 513 | Open in IMG/M |
3300030339|Ga0311360_10771042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 764 | Open in IMG/M |
3300030491|Ga0302211_10070132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1004 | Open in IMG/M |
3300030838|Ga0311335_11070465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 576 | Open in IMG/M |
3300030838|Ga0311335_11183299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 548 | Open in IMG/M |
3300030943|Ga0311366_10837057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 798 | Open in IMG/M |
3300030943|Ga0311366_11241802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 642 | Open in IMG/M |
3300031720|Ga0307469_10188524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1596 | Open in IMG/M |
3300031726|Ga0302321_100158270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2333 | Open in IMG/M |
3300031834|Ga0315290_10056161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3211 | Open in IMG/M |
3300031834|Ga0315290_10334954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1325 | Open in IMG/M |
3300031847|Ga0310907_10544326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 626 | Open in IMG/M |
3300031859|Ga0318527_10183143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 884 | Open in IMG/M |
3300031873|Ga0315297_10567956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 953 | Open in IMG/M |
3300031873|Ga0315297_10839456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 765 | Open in IMG/M |
3300031908|Ga0310900_11565959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 557 | Open in IMG/M |
3300031945|Ga0310913_10942706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 606 | Open in IMG/M |
3300031997|Ga0315278_12147265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 518 | Open in IMG/M |
3300032043|Ga0318556_10736720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 513 | Open in IMG/M |
3300032046|Ga0315289_11435337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 532 | Open in IMG/M |
3300032067|Ga0318524_10199938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1021 | Open in IMG/M |
3300032118|Ga0315277_10413272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1381 | Open in IMG/M |
3300032156|Ga0315295_10319832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1573 | Open in IMG/M |
3300032177|Ga0315276_10030044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5245 | Open in IMG/M |
3300032180|Ga0307471_103788093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 535 | Open in IMG/M |
3300032205|Ga0307472_101217707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 720 | Open in IMG/M |
3300032205|Ga0307472_101590174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 642 | Open in IMG/M |
3300032256|Ga0315271_10077423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 2475 | Open in IMG/M |
3300032256|Ga0315271_11078933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 694 | Open in IMG/M |
3300032256|Ga0315271_11156025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 669 | Open in IMG/M |
3300032256|Ga0315271_11566615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 567 | Open in IMG/M |
3300032401|Ga0315275_12213727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 575 | Open in IMG/M |
3300032782|Ga0335082_11043369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 682 | Open in IMG/M |
3300033158|Ga0335077_10970846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 850 | Open in IMG/M |
3300033408|Ga0316605_10473359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1148 | Open in IMG/M |
3300033408|Ga0316605_11701343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 613 | Open in IMG/M |
3300033412|Ga0310810_10096496 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3530 | Open in IMG/M |
3300033413|Ga0316603_11103427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 750 | Open in IMG/M |
3300033418|Ga0316625_102494346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 522 | Open in IMG/M |
3300033419|Ga0316601_101010435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 830 | Open in IMG/M |
3300033419|Ga0316601_102525423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 516 | Open in IMG/M |
3300033433|Ga0326726_10875047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 871 | Open in IMG/M |
3300033475|Ga0310811_11128305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 659 | Open in IMG/M |
3300033482|Ga0316627_102217235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 574 | Open in IMG/M |
3300033521|Ga0316616_102041844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 760 | Open in IMG/M |
3300033557|Ga0316617_101138110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 771 | Open in IMG/M |
3300034160|Ga0370510_0265604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 540 | Open in IMG/M |
3300034354|Ga0364943_0400365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 530 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 11.24% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 8.28% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.51% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.14% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.14% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.55% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.37% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.37% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.37% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.37% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.37% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.78% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.78% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.78% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 1.18% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.18% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.18% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.18% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.18% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.18% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.18% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.18% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.18% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.18% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.59% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.59% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.59% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.59% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.59% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.59% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.59% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.59% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.59% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.59% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.59% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.59% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.59% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.59% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.59% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.59% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.59% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.59% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.59% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.59% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.59% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.59% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.59% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.59% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.59% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.59% |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.59% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004050 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009527 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold Creek | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009776 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG | Engineered | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014315 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1 | Environmental | Open in IMG/M |
3300014316 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1 | Environmental | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
3300021859 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022389 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.24 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022549 | Cold Creek_combined assembly | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028651 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_2 | Environmental | Open in IMG/M |
3300028652 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_3 | Environmental | Open in IMG/M |
3300028733 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_4 | Environmental | Open in IMG/M |
3300028743 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4 | Environmental | Open in IMG/M |
3300028777 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_3 | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028869 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4 | Environmental | Open in IMG/M |
3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300030003 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3 | Environmental | Open in IMG/M |
3300030010 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4 | Environmental | Open in IMG/M |
3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030047 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3 | Environmental | Open in IMG/M |
3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300030491 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_3 | Environmental | Open in IMG/M |
3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
3300034160 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03S_18 | Environmental | Open in IMG/M |
3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0055491_100666932 | 3300004050 | Natural And Restored Wetlands | LCAALVLFVRVFGGASPPRLTYFAPALVGALLWPVLSVLLQLPQRPVRSASTL* |
Ga0062594_1004082811 | 3300005093 | Soil | GAPPPRWTYAVGSLTGALLWPLVTALLQWPQRPQRSPAER* |
Ga0065705_106192321 | 3300005294 | Switchgrass Rhizosphere | APLPRWTYAVPPIVGALLWPLLSVLLQWPQRPSRNSSTL* |
Ga0070676_106394582 | 3300005328 | Miscanthus Rhizosphere | VGGAPLPRWTYLVPPLVGALLWPVITLLLQWPQRPQHSGAEL* |
Ga0070690_1006118691 | 3300005330 | Switchgrass Rhizosphere | GGAPLPRWTYAVPPLVAALLWPVLTLAIQSWQRPQQSQTAL* |
Ga0068868_1007237631 | 3300005338 | Miscanthus Rhizosphere | VGGAPLPRWTYAVPPIVGALLWPVVTRAIQSWQRPQASKSAL* |
Ga0070691_105603711 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | IGGAPLPRWTYAAPPVVGALLWPLLSVLLQRPQRPRRRSEV* |
Ga0070673_1005629861 | 3300005364 | Switchgrass Rhizosphere | IVGGAPLPRWTYVVPPLVGALLWPVVTVLLQWPQRPQHSGVEL* |
Ga0070667_1003818811 | 3300005367 | Switchgrass Rhizosphere | VVGGAPVPRWTYLMSPIVGALLWPPLSILLQWPQRPMRSRGER* |
Ga0070700_1005147461 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VLLGLCAALVLLVRVVGGAPLPHWMYAVPPLVGALLWPAVTLLLQWPQRPQHSSAEL* |
Ga0070694_1018793762 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | RIAGGAPPPRWTYVVGSLTGALLWPLVTVVLQWPQRPQRSSAEL* |
Ga0070662_1000731951 | 3300005457 | Corn Rhizosphere | APLPTWQYLVPPLVGALLWPVVSVLLQTPQRPSRSRTRS* |
Ga0070707_1023218742 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VGGAPPPGWRYLASPLVGALLWPLVSVLLQTPQRPSRSGSRR* |
Ga0070665_1025951591 | 3300005548 | Switchgrass Rhizosphere | WQYLVPPLVGALLWPVVSVLLQTPQRPSRSRTRS* |
Ga0066700_102336351 | 3300005559 | Soil | APIPRWTYAVGPLVGALLWPVVTTLLQWPQRPRRSQAEV* |
Ga0066703_104014812 | 3300005568 | Soil | PRWTYAVPPVVGALMWPLLSVLLQFPQRPTHSSTER* |
Ga0068854_1017778261 | 3300005578 | Corn Rhizosphere | VVLVRIVGGAPPPRWTYFIGPLAGAFLWPLISVILRLPQRPTGSGGDR* |
Ga0068856_1000383011 | 3300005614 | Corn Rhizosphere | PKWTYVAPPLVGALLWPLVSVLLQAPQRPSRSRR* |
Ga0068864_1000532291 | 3300005618 | Switchgrass Rhizosphere | WTYFIPPIVGALLWPLLSALLQWPQRPSRSPSER* |
Ga0068866_111548791 | 3300005718 | Miscanthus Rhizosphere | MPRWTYFIPPIVGALLWPLLSALLQWPQRPSRSPSER* |
Ga0066903_1019273771 | 3300005764 | Tropical Forest Soil | RWTYAVPPLVGALLWPILTAAIQSGQRPQPSKSVL* |
Ga0068851_102596991 | 3300005834 | Corn Rhizosphere | PPRWTYVVGSLTGALLWPLVTVVLQWPQRPQRSSAEL* |
Ga0074470_108269121 | 3300005836 | Sediment (Intertidal) | LCAALVLLVRYVGGAPLPGWKYAAPPLVGALLWPIVTVAINWSQRPKHSSTAL* |
Ga0068863_1011991382 | 3300005841 | Switchgrass Rhizosphere | VGGAPLPRWTYVVPPLVGALLWPVVTVLLQWPQRPQHSGVEL* |
Ga0068858_1001472011 | 3300005842 | Switchgrass Rhizosphere | PTWQYLVPPLVGALLWPVVSVLLQTPQRPSRSRTRS* |
Ga0068862_1022084071 | 3300005844 | Switchgrass Rhizosphere | GGAPLPRWTYAAPPLVGALLWPLLSVLLQRPQRPRRRSDS* |
Ga0066696_109136072 | 3300006032 | Soil | VAALLALCAAIVLLVRIVGGAPLPRWTYAAPPIIGALMWPVLSVLLQYPQRPMPSTAKR* |
Ga0066696_110173531 | 3300006032 | Soil | VGGAPMPRWTYVVGPLVGALLWPVVTVLLQWPQRPRRSSGER* |
Ga0075024_1005078432 | 3300006047 | Watersheds | LVLLVRYVGGAALPRWTYAIPPLVGALLWPSVTVLLQWPQRPLQSSAEL* |
Ga0075026_1005722622 | 3300006057 | Watersheds | WTYAVPPVVGALLWPVVTMLMQWPQRPKHSSAAL* |
Ga0097621_1012984651 | 3300006237 | Miscanthus Rhizosphere | GGAPLPRWTYVAPPLVGALLWPLVSVVLQWPQRPARSPAEL* |
Ga0068871_1013059512 | 3300006358 | Miscanthus Rhizosphere | VRVVGGAPLPRWTYAVPPIVGALLWPLLSVLLQWSQRPARSPAEL* |
Ga0068871_1023121441 | 3300006358 | Miscanthus Rhizosphere | TWQYLVPPLVGALLWPVVSVLLQTPQRPSRSRTRS* |
Ga0075425_1019102452 | 3300006854 | Populus Rhizosphere | LIRFVGGATMPRWTYAAPPLLGALLWPLVSAVLQWPQRPPRSPGDR* |
Ga0068865_1014182732 | 3300006881 | Miscanthus Rhizosphere | LLIRVVGGAPLPRLMYVTPPLVGALLWPLFSVVLQWPQRPRLSPSDL* |
Ga0068865_1019250541 | 3300006881 | Miscanthus Rhizosphere | LPRWTYAVPPIVGALLWPLLSVLLQWPQRPSRNSSTL* |
Ga0079216_100728702 | 3300006918 | Agricultural Soil | CAALVLLVRVVGGSPLPPWTYFVSALSGAAVWPIASVLLQVPQRPLRSSATL* |
Ga0099794_105203911 | 3300007265 | Vadose Zone Soil | RWTYVVPPIVGALLWPLVSVLLQWSQRPARSAGER* |
Ga0102851_123512922 | 3300009091 | Freshwater Wetlands | GGAPLPRWTYAVPPIVGALLWPVISVMLQWPQRPLRSRAGL* |
Ga0105245_105493352 | 3300009098 | Miscanthus Rhizosphere | VLLVRVVGGAPLPRWTYAVPPIVGALLWPLLSVLLQWSQRPARSPAEL* |
Ga0105243_115651641 | 3300009148 | Miscanthus Rhizosphere | WTYAVPPIVGALLWPLLSVLLQWSQRPARSPAEL* |
Ga0105241_105024382 | 3300009174 | Corn Rhizosphere | WTYAVGSLTGALLWPLVTVLLQWPQRSHGMPSER* |
Ga0105242_100665993 | 3300009176 | Miscanthus Rhizosphere | PLPRWTYAVPPLVGALLWPAVTMLLQWPQRPQHSPVEL* |
Ga0105248_127808331 | 3300009177 | Switchgrass Rhizosphere | RWTYVVPPLVGALLWPAVTLLLQWPQRPQHSSREL* |
Ga0114942_10819521 | 3300009527 | Groundwater | LVLAVRLIGGAPLPRWTYAVPPITGALLWPLLSVLLQWPQRPHRRSTTL* |
Ga0105237_122387241 | 3300009545 | Corn Rhizosphere | PRWTYAAPPLVGALLWPLLSVLLQRPQRPRRRSDS* |
Ga0105238_118203352 | 3300009551 | Corn Rhizosphere | VGGAPLPRWTYAVPPVVGALLWPPLSVLLQWPQRPTRSRSDR* |
Ga0105249_119582902 | 3300009553 | Switchgrass Rhizosphere | GGAPLPRWTYAVPPVVGALLWPPLSVLLQWPQRPARSRGDR* |
Ga0116154_102729622 | 3300009776 | Anaerobic Digestor Sludge | PRWTYAVPPIVGALLWPPLTVVLQWPQRPTRSSSTF* |
Ga0134084_103167972 | 3300010322 | Grasslands Soil | VPRWTYAVGPLVGALLWPVVTILLQWPQRPRRSQAEV* |
Ga0126379_115407171 | 3300010366 | Tropical Forest Soil | GGAPMPRWTYMAPPLLSALLWPLVSAVLQWPQRPPRSPADR* |
Ga0126383_105757422 | 3300010398 | Tropical Forest Soil | VGGAPLPRWTYAVGPLTGALLWPIVSVLLQWPQRPTRGER* |
Ga0105246_111892121 | 3300011119 | Miscanthus Rhizosphere | AVLLGLCSALVLLVRFVGGAPLPRWTYAVPPIVGALLWPVVTRAIQSWQRPQASKSAL* |
Ga0137463_12422971 | 3300011444 | Soil | PLPRWSYAVGPLTGALLWPAVTVLLQWPQRPPLSRAER* |
Ga0137382_104599282 | 3300012200 | Vadose Zone Soil | LCAAIVLLVRIVGGAPLPRWTYAVPPVVGALMWPLLSVLLQYPQRPTRSSAKR* |
Ga0137365_104886792 | 3300012201 | Vadose Zone Soil | GGAPMPRWTYAVPPLVSALLWPFVSVVLQWPQRPQRSSAEL* |
Ga0137398_108425061 | 3300012683 | Vadose Zone Soil | GAPLPRWSYAVGALTGALLWPVLTVLLQWPQRPKRSTAEL* |
Ga0137394_110935572 | 3300012922 | Vadose Zone Soil | LPRWTYAVPPVVGALLWPIVTLAIQWSQRPQPSSNAL* |
Ga0157373_115475482 | 3300013100 | Corn Rhizosphere | VGGATLPQWTYLAPALVGACLWPLVSVLLQSPQRPSRSRRRDGF* |
Ga0157370_100846981 | 3300013104 | Corn Rhizosphere | LVRFVGGATLPKWTYLAPALVGACLWPLVSVLLQSPQRPSRSRRRDGF* |
Ga0157374_109616511 | 3300013296 | Miscanthus Rhizosphere | RIVGGAPLPRLTYLVPPLVGALLWPVITVLLQWPQRPQHSGVEL* |
Ga0157378_102376752 | 3300013297 | Miscanthus Rhizosphere | GAPLPTWQYLVPPLVGALLWPVVSVLLQTPQRPSRSRTRS* |
Ga0157378_130071432 | 3300013297 | Miscanthus Rhizosphere | VLLVRFVGGAPLPRWTCAVPPIVGALLWPILTLAIQSWQRPQPSKTAL* |
Ga0075350_10236331 | 3300014315 | Natural And Restored Wetlands | GAPAPRLTYFAPALVGALLWPVLSVLLQPPQRHVRSAASL* |
Ga0075339_11810821 | 3300014316 | Natural And Restored Wetlands | WTYAVPPLSGALLWPALSVLLQWPQRPAPSASEL* |
Ga0182008_109809391 | 3300014497 | Rhizosphere | RAAPALVGACLWPLVSVLLQSPQRPSRSRRRDGF* |
Ga0157379_102331612 | 3300014968 | Switchgrass Rhizosphere | LVRFVGGAPLPRWTYAVPPVVGALLWPVVTRAIQSWQRPQASKSAL* |
Ga0157376_114822491 | 3300014969 | Miscanthus Rhizosphere | PLPTWSYVAPPLVGALLWPLVSVLLQTPQRPSRSRTRN* |
Ga0157376_121033631 | 3300014969 | Miscanthus Rhizosphere | VRFVGGAPLPRWTYAAPPIVGALLWPILTRAIQSWQHPQPSKTAL* |
Ga0157376_122232012 | 3300014969 | Miscanthus Rhizosphere | TLCAAIVLLIRLFGGAPLPRWTYVVPSLVGALMWPLMSVMLQWPQRPPPSPADL* |
Ga0132256_1025230591 | 3300015372 | Arabidopsis Rhizosphere | SLPRWTYVAPSLVGALLWPVLSVLLQWPQRPTHAPAEL* |
Ga0132257_1004360142 | 3300015373 | Arabidopsis Rhizosphere | PGWTYLAPPLVGAALWPLVSVLLQTPQRPSRSGSRR* |
Ga0132255_1044037441 | 3300015374 | Arabidopsis Rhizosphere | ALVLLVRFVGGAPLPRWTYAVPPVVGALLWPILTLAIQSWQRPQPSKTAL* |
Ga0182040_110209902 | 3300016387 | Soil | LGLCSALVLLVRFVGGAPLPRWTYGVPPLVGALLWPILTAAIQSWQRPQPSKSVL |
Ga0163161_101377272 | 3300017792 | Switchgrass Rhizosphere | GAPLPTWQYLVPPLVGALLWPVVSVLLQTPQRPSRSRTRS |
Ga0187779_101333841 | 3300017959 | Tropical Peatland | RWTYAVGSLAGALLWPPLSVLLQWPQRPPRSPGEL |
Ga0187780_109326342 | 3300017973 | Tropical Peatland | VVGGAPLPRWTYAVGSLTGALLWPPLTVLLQWPQRPPRSPGER |
Ga0187766_106685881 | 3300018058 | Tropical Peatland | PLPRWTYAVGALTGALLWPPLSVLLQRPQRPPRSPGEL |
Ga0184625_101534371 | 3300018081 | Groundwater Sediment | RFVGGAPLPHWMYAVPPLVGALLWPAVTLLLQWPQRPQYSSGEL |
Ga0184628_102696542 | 3300018083 | Groundwater Sediment | TVGGAPLPRWTYVVPSLVGALLWPLVSVVLQWPQRPPPSPAER |
Ga0210334_103148392 | 3300021859 | Estuarine | LVRYVGGAPLPRWTYVVPPLVGALLWPVLTVALQWTQRPQRSSAEL |
Ga0210318_10593382 | 3300022389 | Estuarine | VGGAPLPRWTYAVPPLAGALLWPVLTVALQWTQRPQHSSAEL |
Ga0212091_101314921 | 3300022549 | Groundwater | RWTYAVPPITGALLWPLLSVLLQWPQRPHRRSTTL |
Ga0222622_105542201 | 3300022756 | Groundwater Sediment | TAGLVLVVRFIGGAPMPRWTYAAPPIVGALLWPLLSVLLQRPQRPRRRGDR |
Ga0207692_110003192 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | GAPPPRWTYAVGSLTGALLWPLVTALLQWPQRPQRSPAER |
Ga0207680_103595142 | 3300025903 | Switchgrass Rhizosphere | GGAPLPRWTYAVPPIVGALLWPVVTRAIQSWQRPQASKSAL |
Ga0207645_101444892 | 3300025907 | Miscanthus Rhizosphere | WTYAAPPFVGALLWPLLSVLLQYPQRPNHASSNKR |
Ga0207705_111578722 | 3300025909 | Corn Rhizosphere | VGGAPLPHWQYLVPPLVGALLWPIVSVLLQTPQRPSRSRTRN |
Ga0207663_105438432 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | PPPRWTYVVGSLTGALLWPLVTVVLQWPQRPQRSSAEL |
Ga0207663_113321321 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | APLPKWTYVAPPLVGALLWPLVSVLLQAPQRPSRSRR |
Ga0207711_103107851 | 3300025941 | Switchgrass Rhizosphere | PLPRWTYAVPPVVGALLWPPLSVLLQWPQRPTRSRSDR |
Ga0207712_104647022 | 3300025961 | Switchgrass Rhizosphere | PRWTYAVPPLVGALLWPAVTMVLQWPQRPQHSPVEL |
Ga0207658_110737922 | 3300025986 | Switchgrass Rhizosphere | GGAPLPRWTYAVPPVVGALLWPPLSVLLQWPQRPARSRGDR |
Ga0207703_1000457820 | 3300026035 | Switchgrass Rhizosphere | VGGAPLPRWTYAVPPIVGALLWPLLSVLLQWSQRPARSPAEL |
Ga0207639_122489342 | 3300026041 | Corn Rhizosphere | PMPRWTYFIPPIVGALLWPLLSALLQWPQRPSRSPSER |
Ga0207702_100605333 | 3300026078 | Corn Rhizosphere | VRIVGGAPSPRWTYAVPPLVGALLWPALSVLLQYPQRPNRSSSKR |
Ga0207676_101029781 | 3300026095 | Switchgrass Rhizosphere | VGGAPLPRWTYAVPPIVGALLWPVVTRAIQSWQRPQASKSAL |
Ga0207676_123036692 | 3300026095 | Switchgrass Rhizosphere | ALLVLLVRVVGGAPLPRWTYAVPPIVGALLWPLLSVLLQWSQRPARSPAEL |
Ga0207683_117168562 | 3300026121 | Miscanthus Rhizosphere | LVVRFIGGAPMPRWTYAAPPIVGALLWPLLSVLLQRPQRPRRRGDR |
Ga0209234_12225492 | 3300026295 | Grasslands Soil | PIPRWTYAVGPLVGALLWPVVTTLLQWPQRPRRSQAEV |
Ga0209056_102739782 | 3300026538 | Soil | IPRWTYAVGPLVGALLWPVVTTLLQWPQRPRRSQAEV |
Ga0209056_106502281 | 3300026538 | Soil | RIVGGAPLPRWTYAVPPVVGALLWPLLSVLLQYPQRPTRSSTKR |
Ga0209999_10898361 | 3300027543 | Arabidopsis Thaliana Rhizosphere | MIGSAPLPRWTYAVPPIVGALLWPLLTVVLQWPQRPSRRSTTL |
Ga0209446_10910391 | 3300027698 | Bog Forest Soil | VVGGAPLPRWTYAVGPLVGALLWPAVSALLQWPQRPPRSPAER |
Ga0209287_101384691 | 3300027792 | Freshwater Sediment | LFVRVFGGAPMPRLTYFVPALVGALLWPAFSVLLQLPQRPVRSSATL |
Ga0208980_101852631 | 3300027887 | Wetland | PRWTYAVPPLAGALLWPAVSVVMQWPQRPQKSATELS |
Ga0209668_106194341 | 3300027899 | Freshwater Lake Sediment | LLSLCAGLVLLVRYVGGAPLPRWTYAVPPLVGALLWPVLTVALQWTQRPQRSSAEL |
Ga0209069_107060132 | 3300027915 | Watersheds | LVLLVRYVGGAALPRWTYAIPPLVGALLWPSVTVLLQWPQRPLQSSAEL |
Ga0302171_100600012 | 3300028651 | Fen | LVLLVRVVGNAPLPRWTYVVPPIVGALLWPLLSVLLQWSQRPSRSTSER |
Ga0302166_101043821 | 3300028652 | Fen | RVVGGAPLPRWTYAVPPLVGALLWPLLSVLLQWSQRPARSPSER |
Ga0302261_10176071 | 3300028733 | Fen | VGNAPLPRWTYAVPPIVGALLWPFLSVLLQWSQRPARSTSER |
Ga0302262_100420612 | 3300028743 | Fen | PRWTYVVPPIVGALLWPLLSVLLQWSQRPSRSTSER |
Ga0302290_100121291 | 3300028777 | Fen | VLLMVCALLVLLVRVVGNAPLPRWTYVVPPIVGALLWPLLSVLLQWSQRPSRSTSER |
Ga0307504_100942951 | 3300028792 | Soil | VVGGAPVPRWTYAVGPLVGAFLWPVVTVLLQRPQRPRRSRQEH |
Ga0302263_100405291 | 3300028869 | Fen | LVLLVRVVGGAPLPRWTYAAPPIVGALLWPLVSVLLQWSQRPSRSPSQR |
Ga0311365_104780841 | 3300029989 | Fen | QFMSGANMPRWSYAAPPLVGALLWPLVSVMLQWPQRPQRSASER |
Ga0311337_102857492 | 3300030000 | Fen | LPRWTYAVPPIVGALLWPLVSVLLQWSQRPSRSPSQR |
Ga0302172_100130453 | 3300030003 | Fen | VGNAPLPRWTYVVPPIVGALLWPLLSVLLQWSQRPSRSTSER |
Ga0302172_101920391 | 3300030003 | Fen | RVVGNAPLPRWTYAVPPIVGALLWPLLSVLLQWSQRPARSNSER |
Ga0302299_102547472 | 3300030010 | Fen | QFMGGANMPRWSYAAPPLVGALLWPLVSVMLQWPQRPQRSASER |
Ga0311348_113770701 | 3300030019 | Fen | GAPLPRWTYAVPPIVGALLWPLVSVLLQWSQRPSRSPSQR |
Ga0302286_107129991 | 3300030047 | Fen | LPRWTYAVPPIVGALLWPLLSVLLQWSQRPTRSSAQL |
Ga0311360_107710421 | 3300030339 | Bog | VLLMVCALLVLLVRVVGTAPLPRWTYAVPPIVGALLWPLLSVLLQWSQRPTRSSAQL |
Ga0302211_100701322 | 3300030491 | Fen | VGGAPLPRWTYAVPPIVGALLWPLVSVLLQWSQRPSRSPSQR |
Ga0311335_110704652 | 3300030838 | Fen | LLVRVVGTAPLPRWTYAVPPIVGALLWPLLSVLLQWSQRPTRSSAQL |
Ga0311335_111832991 | 3300030838 | Fen | VLLVRVVGSAPMPRWTYAVPPLVGALLWPLVSVLLQWSQRPDRSPSER |
Ga0311366_108370571 | 3300030943 | Fen | LPRWTYAVPPIVGALLWPFLSVLLQWSQRPARSTSER |
Ga0311366_112418021 | 3300030943 | Fen | LLGLCATLVLIVRTVGGAPVPRWTYAMPSIVGALMWPVVTRVLQWPQRPQRTPDKL |
Ga0307469_101885241 | 3300031720 | Hardwood Forest Soil | PRWTYVVPPVVGALLWPIVTLAVQSWQRPQTSKSAL |
Ga0302321_1001582703 | 3300031726 | Fen | LVLLVRVVGGAPLPRWTYAVPPIVGALLWPLVSVLLQWSQRPSRSPSQR |
Ga0315290_100561611 | 3300031834 | Sediment | APLPRWTYVVPPLVGALLWPLVSVMLQWPQRPPSSASDL |
Ga0315290_103349542 | 3300031834 | Sediment | VGGAPLPRWTYAVPPLVGAFLWPVLTLVLQWSQRPRHSSAAL |
Ga0310907_105443261 | 3300031847 | Soil | AVLPRWTYFAPPLVGALLWPLISVLLQTPQRPSRSGARR |
Ga0318527_101831431 | 3300031859 | Soil | RWTYAVPPITGALLWPLVSVLLQWPQRPTRGTTER |
Ga0315297_105679562 | 3300031873 | Sediment | VRYVGGAPLPRWTYAVPPLVGAFLWPVVTLVLQWLPRPQHSSTAL |
Ga0315297_108394562 | 3300031873 | Sediment | VIRYVGGAPLPRWTYVVPSLVGALLWPLVSVVLQWPQRPPPSPAKR |
Ga0310900_115659592 | 3300031908 | Soil | RWTYLMSPIVGALLWPPLSILLQWPQRPTRSRGERQRTL |
Ga0310913_109427061 | 3300031945 | Soil | ALCSSLVLLVRFVGGAPLPRWTYAVPPLIGALLWPILTLAIQSWQRPQPSRNAL |
Ga0315278_121472651 | 3300031997 | Sediment | RWTYLAPSLVGALLWPFVSVVLQTPQRPPPSPADL |
Ga0318556_107367202 | 3300032043 | Soil | GLCSALVLLVRFVGGAPLPRWTYGVPPLVGALLWPILTAAIQSWQRPQPSKSVL |
Ga0315289_114353371 | 3300032046 | Sediment | LPRWTYAVPPLVGALLWPALTVALQWTQRPQRSSAEL |
Ga0318524_101999382 | 3300032067 | Soil | LCSSLVLLVRFVGGAPLPRWTYAVPPLIGALLWPILTLAIQSWQRPQPSRNAL |
Ga0315277_104132721 | 3300032118 | Sediment | AVLLGLCAALVLLVRYVGGAPLPRWTYAVPPLAGALLWPVVTLVLQWSPRPQHSSTAL |
Ga0315295_103198321 | 3300032156 | Sediment | GAPLPRWTYAVPPLVGALLWPVLTVALQWTQRPQRSSAEL |
Ga0315276_100300441 | 3300032177 | Sediment | VGGAPLPRWTYAVPPLVGALLWPAVTLVLQWPQRPQHGTAEL |
Ga0307471_1037880931 | 3300032180 | Hardwood Forest Soil | CAALVLLVRFVGGAPLPRWMYAVPPLVGALLWPAVTLLLQWPQRPQYSSAEL |
Ga0307472_1012177071 | 3300032205 | Hardwood Forest Soil | LVALVRIVGGAPMPRWTYAMGSLTGALLWPVLTVVLQWPQRPPRSQAEL |
Ga0307472_1015901742 | 3300032205 | Hardwood Forest Soil | GASIPRWTYAVGPLVGALLWPVVTTLLQWPQRPRRSQAEV |
Ga0315271_100774231 | 3300032256 | Sediment | LVLLVRVVGNAPLPRWTYAVPPIVGALLWPLLSVLLQWSQRPARSSSER |
Ga0315271_110789331 | 3300032256 | Sediment | LLVLLVRVVGGAPLPRWTYAVPPIVGALLWPLVSVLLQWSQRPARSMAEL |
Ga0315271_111560251 | 3300032256 | Sediment | LMICALLVLLVRVVGSAPLPRWTYAVPPIVGALLWPLVSVLLRWSQRPSRSTSEL |
Ga0315271_115666152 | 3300032256 | Sediment | LLVRYVGGAPLPRWTYAVPPLVGALLWPVVTLVLQWLQRPGGH |
Ga0315275_122137271 | 3300032401 | Sediment | AQVAMLLGLCAALVLLVRYVGGAPLPRWTYAVPPLVGAFLWPVVTLVLQWLPRPQHSSTT |
Ga0335082_110433692 | 3300032782 | Soil | LLVRFVGGAPVPRWTYAVPPAVGALLWPVLTAAIQSWQRPQPSKSAL |
Ga0335077_109708462 | 3300033158 | Soil | GLTSALVLLVRFVGGAPVPRWTYAVPPAVGALLWPVLTAAIQSWQRPQPSKSAL |
Ga0316605_104733592 | 3300033408 | Soil | LCAGLVVLVRVVGGSPLPRWTYAVPPLSAALLWPVLSVLLQWPQRPTRSAAAL |
Ga0316605_117013431 | 3300033408 | Soil | APLPRWTYAVPPIVGALLWPVISVMLQWPQRPLRSRAGL |
Ga0310810_100964961 | 3300033412 | Soil | LPRWTYAVPPIVGALLWPLLTVVLQWPQRPSRRSATL |
Ga0316603_111034272 | 3300033413 | Soil | FGGAPMPRLTYFVPALVGALLWPALSVLLQLPQRPVRSTATL |
Ga0316625_1024943461 | 3300033418 | Soil | LFVRVFGGAPMPRLTYFVPALVGALLWPALSVLLQLPQRPVRSTATL |
Ga0316601_1010104352 | 3300033419 | Soil | GGAPLPRWTYAVPPLVGALLWPFVSVVLQWPQRPPRSPAEM |
Ga0316601_1025254232 | 3300033419 | Soil | GAPMPRLIFFAPPLAGALLWPVLSVLLQLPQRPVRSTATL |
Ga0326726_108750471 | 3300033433 | Peat Soil | AALVLLIRFVGGAPLPQLTYAAPPFVGALLWPVISVVLQWPQRPRRSSEL |
Ga0310811_111283052 | 3300033475 | Soil | GAPLPHWQYLVPPLVGALLWPIVSVLLQTPQRPSRSRTRN |
Ga0316627_1022172352 | 3300033482 | Soil | CAGLVLVVRVVGGAPLPRWTYAVPPLVGALIWPFVSVVLQWPQRPPRSPAEM |
Ga0316616_1020418441 | 3300033521 | Soil | IVLLVRVVGGAPLPRWTYFVSPLVGALAWPLLSVLLQLPQRPVRSSSTL |
Ga0316617_1011381101 | 3300033557 | Soil | LLSLCAGLVLVVRVVGGAPLPRWTYAVPPLVGALIWPFVSVVLQWPQRPPRSPAEM |
Ga0370510_0265604_377_538 | 3300034160 | Untreated Peat Soil | LCAGLVVLVRAVGGAPLPRWTYAVPPLSGALLWPVITVMLQWPQRPTRSAAEL |
Ga0364943_0400365_417_530 | 3300034354 | Sediment | LPRWTYAVPPIVGALLWPLVSVLLQWSQRPARSPSEL |
⦗Top⦘ |