| Basic Information | |
|---|---|
| Family ID | F036723 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 169 |
| Average Sequence Length | 42 residues |
| Representative Sequence | PDRVHDQVRTIDFDELPTHFDPYLKGMVRGRTVVRIAPDTHP |
| Number of Associated Samples | 148 |
| Number of Associated Scaffolds | 169 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.41 % |
| % of genes from short scaffolds (< 2000 bps) | 86.98 % |
| Associated GOLD sequencing projects | 137 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.041 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (9.467 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.479 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.929 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.86% β-sheet: 17.14% Coil/Unstructured: 70.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 169 Family Scaffolds |
|---|---|---|
| PF16177 | ACAS_N | 66.86 |
| PF00501 | AMP-binding | 12.43 |
| PF06089 | Asparaginase_II | 5.33 |
| PF01757 | Acyl_transf_3 | 4.73 |
| PF13193 | AMP-binding_C | 2.37 |
| PF12276 | DUF3617 | 0.59 |
| PF03872 | RseA_N | 0.59 |
| PF00132 | Hexapep | 0.59 |
| PF01053 | Cys_Met_Meta_PP | 0.59 |
| PF04542 | Sigma70_r2 | 0.59 |
| COG ID | Name | Functional Category | % Frequency in 169 Family Scaffolds |
|---|---|---|---|
| COG4448 | L-asparaginase II | Amino acid transport and metabolism [E] | 5.33 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.59 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.59 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.59 |
| COG3073 | RseA, negative regulator of sigma E activity | Signal transduction mechanisms [T] | 0.59 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.59 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.59 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.59 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.59 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.59 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.59 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.59 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.59 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.59 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.59 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.59 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.59 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.04 % |
| Unclassified | root | N/A | 2.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908043|A2_c1_ConsensusfromContig31626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 844 | Open in IMG/M |
| 3300001978|JGI24747J21853_1034343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 587 | Open in IMG/M |
| 3300004014|Ga0055456_10237200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 634 | Open in IMG/M |
| 3300004152|Ga0062386_101158666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 642 | Open in IMG/M |
| 3300004480|Ga0062592_102662576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 505 | Open in IMG/M |
| 3300005177|Ga0066690_10984600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 531 | Open in IMG/M |
| 3300005327|Ga0070658_10088463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum | 2550 | Open in IMG/M |
| 3300005331|Ga0070670_100794153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 855 | Open in IMG/M |
| 3300005332|Ga0066388_100950225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1431 | Open in IMG/M |
| 3300005334|Ga0068869_101947112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum | 527 | Open in IMG/M |
| 3300005335|Ga0070666_10332823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1084 | Open in IMG/M |
| 3300005338|Ga0068868_102191862 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300005354|Ga0070675_100176703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1844 | Open in IMG/M |
| 3300005355|Ga0070671_100041073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3843 | Open in IMG/M |
| 3300005356|Ga0070674_100164365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1687 | Open in IMG/M |
| 3300005356|Ga0070674_101165138 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 683 | Open in IMG/M |
| 3300005364|Ga0070673_101301509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 683 | Open in IMG/M |
| 3300005365|Ga0070688_100641171 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 817 | Open in IMG/M |
| 3300005434|Ga0070709_10717821 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 779 | Open in IMG/M |
| 3300005438|Ga0070701_10101093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1597 | Open in IMG/M |
| 3300005455|Ga0070663_101786057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 551 | Open in IMG/M |
| 3300005456|Ga0070678_102075722 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 538 | Open in IMG/M |
| 3300005459|Ga0068867_101662004 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 598 | Open in IMG/M |
| 3300005535|Ga0070684_100675059 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 962 | Open in IMG/M |
| 3300005569|Ga0066705_10157161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1400 | Open in IMG/M |
| 3300005576|Ga0066708_10183702 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1304 | Open in IMG/M |
| 3300005577|Ga0068857_100077254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2970 | Open in IMG/M |
| 3300005616|Ga0068852_100455568 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1267 | Open in IMG/M |
| 3300005719|Ga0068861_102109370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 564 | Open in IMG/M |
| 3300005834|Ga0068851_10014488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3744 | Open in IMG/M |
| 3300005841|Ga0068863_100353942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1430 | Open in IMG/M |
| 3300005841|Ga0068863_101561386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 669 | Open in IMG/M |
| 3300005843|Ga0068860_101720771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 649 | Open in IMG/M |
| 3300005844|Ga0068862_100081209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2812 | Open in IMG/M |
| 3300006032|Ga0066696_10678126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 664 | Open in IMG/M |
| 3300006046|Ga0066652_101679106 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 580 | Open in IMG/M |
| 3300006358|Ga0068871_102155101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 531 | Open in IMG/M |
| 3300006603|Ga0074064_11796835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp. 28 | 527 | Open in IMG/M |
| 3300006604|Ga0074060_11098504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 577 | Open in IMG/M |
| 3300006606|Ga0074062_12106677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 858 | Open in IMG/M |
| 3300006791|Ga0066653_10766407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 505 | Open in IMG/M |
| 3300006881|Ga0068865_100285401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1316 | Open in IMG/M |
| 3300006954|Ga0079219_10003145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 4626 | Open in IMG/M |
| 3300007521|Ga0105044_10147326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2500 | Open in IMG/M |
| 3300009098|Ga0105245_10584303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1142 | Open in IMG/M |
| 3300009147|Ga0114129_13217053 | Not Available | 531 | Open in IMG/M |
| 3300009174|Ga0105241_11828257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 594 | Open in IMG/M |
| 3300009176|Ga0105242_11548413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 695 | Open in IMG/M |
| 3300009176|Ga0105242_12111200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300009177|Ga0105248_10156115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2575 | Open in IMG/M |
| 3300009177|Ga0105248_10520858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1341 | Open in IMG/M |
| 3300009553|Ga0105249_13173585 | Not Available | 528 | Open in IMG/M |
| 3300009667|Ga0116147_1293335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 614 | Open in IMG/M |
| 3300010326|Ga0134065_10230579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 683 | Open in IMG/M |
| 3300010401|Ga0134121_11943614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 619 | Open in IMG/M |
| 3300011119|Ga0105246_10664566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 909 | Open in IMG/M |
| 3300012185|Ga0136619_10084098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1220 | Open in IMG/M |
| 3300012200|Ga0137382_10037903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2938 | Open in IMG/M |
| 3300012201|Ga0137365_11078594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 579 | Open in IMG/M |
| 3300012207|Ga0137381_10052547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3369 | Open in IMG/M |
| 3300012210|Ga0137378_11433183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 603 | Open in IMG/M |
| 3300012350|Ga0137372_10095766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2498 | Open in IMG/M |
| 3300012353|Ga0137367_10884436 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 616 | Open in IMG/M |
| 3300012354|Ga0137366_10095849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2250 | Open in IMG/M |
| 3300012530|Ga0136635_10317138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 560 | Open in IMG/M |
| 3300012960|Ga0164301_10683364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 770 | Open in IMG/M |
| 3300012976|Ga0134076_10196513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 844 | Open in IMG/M |
| 3300013296|Ga0157374_12367402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300013308|Ga0157375_11119379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 922 | Open in IMG/M |
| 3300014166|Ga0134079_10450794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 610 | Open in IMG/M |
| 3300014312|Ga0075345_1052535 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 845 | Open in IMG/M |
| 3300014322|Ga0075355_1023757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1251 | Open in IMG/M |
| 3300014323|Ga0075356_1217913 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300014325|Ga0163163_10177213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2179 | Open in IMG/M |
| 3300014325|Ga0163163_10686729 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1087 | Open in IMG/M |
| 3300014325|Ga0163163_11797240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 673 | Open in IMG/M |
| 3300015080|Ga0167639_1013978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1145 | Open in IMG/M |
| 3300015193|Ga0167668_1091774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 573 | Open in IMG/M |
| 3300015373|Ga0132257_104516195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300015374|Ga0132255_100351694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2134 | Open in IMG/M |
| 3300017930|Ga0187825_10408294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300017974|Ga0187777_10195494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1362 | Open in IMG/M |
| 3300018071|Ga0184618_10273113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 717 | Open in IMG/M |
| 3300018429|Ga0190272_11398303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 703 | Open in IMG/M |
| 3300018433|Ga0066667_11957497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300018433|Ga0066667_12015041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300018476|Ga0190274_11891740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 692 | Open in IMG/M |
| 3300018482|Ga0066669_12070443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 536 | Open in IMG/M |
| 3300020070|Ga0206356_11825537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300025509|Ga0208848_1119205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 520 | Open in IMG/M |
| 3300025903|Ga0207680_11054935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300025911|Ga0207654_10854763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 658 | Open in IMG/M |
| 3300025915|Ga0207693_10130109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1979 | Open in IMG/M |
| 3300025916|Ga0207663_10423135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1023 | Open in IMG/M |
| 3300025916|Ga0207663_11653732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300025917|Ga0207660_10518804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 967 | Open in IMG/M |
| 3300025920|Ga0207649_10059091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2404 | Open in IMG/M |
| 3300025926|Ga0207659_10198241 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1601 | Open in IMG/M |
| 3300025932|Ga0207690_10371179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1135 | Open in IMG/M |
| 3300025933|Ga0207706_11392067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 576 | Open in IMG/M |
| 3300025933|Ga0207706_11604880 | Not Available | 527 | Open in IMG/M |
| 3300025934|Ga0207686_11222781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300025960|Ga0207651_10036741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3201 | Open in IMG/M |
| 3300025961|Ga0207712_10857914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 801 | Open in IMG/M |
| 3300025972|Ga0207668_10475977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. CCYZU-2555 | 1070 | Open in IMG/M |
| 3300025981|Ga0207640_11226105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 668 | Open in IMG/M |
| 3300025986|Ga0207658_10461415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1126 | Open in IMG/M |
| 3300025986|Ga0207658_10893049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 809 | Open in IMG/M |
| 3300025986|Ga0207658_11462532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300026061|Ga0208541_1026611 | Not Available | 581 | Open in IMG/M |
| 3300026067|Ga0207678_10507062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1052 | Open in IMG/M |
| 3300026078|Ga0207702_10485272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1203 | Open in IMG/M |
| 3300026088|Ga0207641_10107281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2470 | Open in IMG/M |
| 3300026088|Ga0207641_10526022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1151 | Open in IMG/M |
| 3300026095|Ga0207676_10743763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 953 | Open in IMG/M |
| 3300026118|Ga0207675_101162242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 792 | Open in IMG/M |
| 3300026142|Ga0207698_10453982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium | 1238 | Open in IMG/M |
| 3300026319|Ga0209647_1052616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2179 | Open in IMG/M |
| 3300026325|Ga0209152_10310950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 592 | Open in IMG/M |
| 3300027725|Ga0209178_1169853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 761 | Open in IMG/M |
| 3300027897|Ga0209254_10335085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1144 | Open in IMG/M |
| 3300028381|Ga0268264_10101597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2500 | Open in IMG/M |
| 3300028587|Ga0247828_10094589 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1402 | Open in IMG/M |
| 3300028732|Ga0302264_1182437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300028774|Ga0302208_10138656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 595 | Open in IMG/M |
| 3300028802|Ga0307503_10286674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 820 | Open in IMG/M |
| 3300028861|Ga0302259_1084001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 768 | Open in IMG/M |
| 3300030114|Ga0311333_10568218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 936 | Open in IMG/M |
| 3300030339|Ga0311360_10717053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 796 | Open in IMG/M |
| 3300031152|Ga0307501_10018315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1295 | Open in IMG/M |
| 3300031249|Ga0265339_10342019 | Not Available | 706 | Open in IMG/M |
| 3300031521|Ga0311364_11868073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 590 | Open in IMG/M |
| 3300031572|Ga0318515_10481306 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300031720|Ga0307469_10507040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1059 | Open in IMG/M |
| 3300031726|Ga0302321_100178772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2202 | Open in IMG/M |
| 3300031726|Ga0302321_100428154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1446 | Open in IMG/M |
| 3300031731|Ga0307405_10253352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1311 | Open in IMG/M |
| 3300031736|Ga0318501_10522853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 648 | Open in IMG/M |
| 3300031794|Ga0318503_10046364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1315 | Open in IMG/M |
| 3300031834|Ga0315290_10198506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1743 | Open in IMG/M |
| 3300031834|Ga0315290_10869749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 767 | Open in IMG/M |
| 3300031834|Ga0315290_11728944 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300031873|Ga0315297_11250315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 607 | Open in IMG/M |
| 3300031885|Ga0315285_10547049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 782 | Open in IMG/M |
| 3300031918|Ga0311367_11794749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300032002|Ga0307416_103492015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300032012|Ga0310902_10234615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1096 | Open in IMG/M |
| 3300032017|Ga0310899_10049426 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1533 | Open in IMG/M |
| 3300032018|Ga0315272_10202232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 947 | Open in IMG/M |
| 3300032054|Ga0318570_10452288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300032143|Ga0315292_10253784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1454 | Open in IMG/M |
| 3300032143|Ga0315292_10597782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 929 | Open in IMG/M |
| 3300032177|Ga0315276_10084348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3195 | Open in IMG/M |
| 3300032177|Ga0315276_11422182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 724 | Open in IMG/M |
| 3300032256|Ga0315271_10830325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 796 | Open in IMG/M |
| 3300032275|Ga0315270_10866287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300032401|Ga0315275_10928380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 959 | Open in IMG/M |
| 3300032516|Ga0315273_10587859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1478 | Open in IMG/M |
| 3300032516|Ga0315273_11526694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 820 | Open in IMG/M |
| 3300032516|Ga0315273_12263603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 635 | Open in IMG/M |
| 3300033290|Ga0318519_10020221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2964 | Open in IMG/M |
| 3300033408|Ga0316605_11138632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 752 | Open in IMG/M |
| 3300033408|Ga0316605_11429511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 671 | Open in IMG/M |
| 3300033418|Ga0316625_102072023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 562 | Open in IMG/M |
| 3300033418|Ga0316625_102592766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300033475|Ga0310811_10273997 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1972 | Open in IMG/M |
| 3300033513|Ga0316628_103508124 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 566 | Open in IMG/M |
| 3300033557|Ga0316617_102198311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300034354|Ga0364943_0038978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1542 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 9.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.92% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 4.73% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.14% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.55% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.37% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.78% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.18% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.18% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.18% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.18% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.18% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.18% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.18% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.18% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.59% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.59% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.59% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.59% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.59% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.59% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.59% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.59% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.59% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.59% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.59% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.59% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.59% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.59% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.59% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.59% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.59% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908043 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2 | Environmental | Open in IMG/M |
| 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Host-Associated | Open in IMG/M |
| 3300004014 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D2 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007521 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009667 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG3_MetaG | Engineered | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012185 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ353 (21.06) | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014312 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1 | Environmental | Open in IMG/M |
| 3300014322 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014323 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015080 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6C, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026061 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028732 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300028774 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028861 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A2_c1_00778350 | 2124908043 | Soil | TRAQAKVVTIDFADLPTHFDAFLKGMVRGRTVVRVGADIAGL |
| JGI24747J21853_10343431 | 3300001978 | Corn, Switchgrass And Miscanthus Rhizosphere | EVRTIDFDELPTHFDAYLKGMVRGRTVVRVAADTHP* |
| Ga0055456_102372002 | 3300004014 | Natural And Restored Wetlands | VHDQVRTIDFDELPTHFDAYIKGLVRGRTVVKIAADPVGL* |
| Ga0062386_1011586661 | 3300004152 | Bog Forest Soil | DGVHDSVRTIDFDELPTHFDAYLKGLVRGRTVVRIAADTHP* |
| Ga0062592_1026625761 | 3300004480 | Soil | DRVHDEVRTIDFDELPTHFDAYLKGMVRGRTVVRVAADTHP* |
| Ga0066690_109846001 | 3300005177 | Soil | EWRPTRAQAKVVTIDFADLPTHFDAFLKGMVRGRTVVRVGADIAGL* |
| Ga0070658_100884633 | 3300005327 | Corn Rhizosphere | DRVHDKVSTIDFDELPMHFDAYLKGMARGRTVVRVAADSHP* |
| Ga0070670_1007941531 | 3300005331 | Switchgrass Rhizosphere | PDRVHDQVRTIDFDELPTHFDPYLKGLVRGRTVVRIAPDTHGG* |
| Ga0066388_1009502251 | 3300005332 | Tropical Forest Soil | SRVQSKVRTIDFAELPTHFDAFLKGMIRGRTVVRIGADPVGN* |
| Ga0068869_1019471122 | 3300005334 | Miscanthus Rhizosphere | VHDQVRTIDFDELPTHFDAYLKGLVRGRTVVKIASDPVGL* |
| Ga0070666_103328232 | 3300005335 | Switchgrass Rhizosphere | LANEWRPSRVQARVVTIDFADLPTHFDAFLKGTVRCRTVVRVGADTAGL* |
| Ga0068868_1021918622 | 3300005338 | Miscanthus Rhizosphere | VEWRPDRVHDQVRTIDFDDLPTHFDSYLKGTVRGRTVVRIAPDTHP* |
| Ga0070675_1001767032 | 3300005354 | Miscanthus Rhizosphere | DRVHDQVRTIDFNELPTHFDPYLKGLARGRTVVRVAPDTHGG* |
| Ga0070671_1000410731 | 3300005355 | Switchgrass Rhizosphere | DRLANEWRPSRVQARVVTIDFADLPTHFDAFLKGTVRCRTVVRVGADTAGL* |
| Ga0070674_1001643652 | 3300005356 | Miscanthus Rhizosphere | WDRLANEWRPSRVQARVVTIDFADLPTHFDAFLKGTVRCRTVVRVGADTAGL* |
| Ga0070674_1011651381 | 3300005356 | Miscanthus Rhizosphere | VEWRPDRVHDQVRTIDFEDLPTHFDSYLKGMVRGRTVVRVGADTHP* |
| Ga0070673_1013015092 | 3300005364 | Switchgrass Rhizosphere | VEWRPDRVHDQVRTIDFDELPTHFDPFLKGMVRGRTVVRIAPDTHP* |
| Ga0070688_1006411712 | 3300005365 | Switchgrass Rhizosphere | AVDWRPDRVHDEVRTIDFDELPTHFDAYLKGMARGRTVVRVAADSHP* |
| Ga0070709_107178211 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | RVHDKVSTIDFDELPMHFDAYLKGMARGRTVVRVAADSHP* |
| Ga0070701_101010931 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | PDRVHDQVRTIDFNELPTHFDPYLKGLARGRTVVRVAPDTHGG* |
| Ga0070663_1017860571 | 3300005455 | Corn Rhizosphere | PDRVHDQVRTIDFDELPEHFDAYIKGMVRGRMVVRIGADSHP* |
| Ga0070678_1020757221 | 3300005456 | Miscanthus Rhizosphere | AWRPDRVHDQVRTIDFDELPTHFEPYLKGMVRGRTVVRIAPDTHP* |
| Ga0068867_1016620042 | 3300005459 | Miscanthus Rhizosphere | DRVHDEVRTIDFDELPTHFDAYLKGMARGRTVVRVAADSHP* |
| Ga0070684_1006750591 | 3300005535 | Corn Rhizosphere | VDWRPDRVHDEVRTIDFDELPTHFDAYLKGMVRGRTVVRVAADTHP* |
| Ga0066705_101571612 | 3300005569 | Soil | KVVTIDFADLPTHFDAFLKGMVRGRTVVRVGADIAGL* |
| Ga0066708_101837021 | 3300005576 | Soil | PDQVHDLVRTIDFEELPTHFDAYLKGMVRGRTVVRIGADSHP* |
| Ga0068857_1000772543 | 3300005577 | Corn Rhizosphere | VRTIDFDELPTHFDAYLKGMVRGRTVVRVAADTHP* |
| Ga0068852_1004555681 | 3300005616 | Corn Rhizosphere | WRPDRVHDQVRTIDFEDLPTHFDPYLKGMVRGRTVVRIGADTHP* |
| Ga0068861_1021093702 | 3300005719 | Switchgrass Rhizosphere | DQVRTIDFNELPTHFDPYLKGLVRGRTVVRIAPDTHGG* |
| Ga0068851_100144884 | 3300005834 | Corn Rhizosphere | EWRPDRVHDKVSTIDFDELPMHFDAYLKGMARGRTVVRVAADSHP* |
| Ga0068863_1003539421 | 3300005841 | Switchgrass Rhizosphere | VQWRPDRVHDQVRTIDFDELPEHFDAYIKGMVRGRMVVRIGADSHP* |
| Ga0068863_1015613861 | 3300005841 | Switchgrass Rhizosphere | RTIDFDELPTHFDPYLKGLVRGRTVVRIAPDTHGG* |
| Ga0068860_1017207712 | 3300005843 | Switchgrass Rhizosphere | LAVQWRPDVVHDQVRTIDFADLPTHFDAYLKGMVRGRTVVKIGSDPVGL* |
| Ga0068862_1000812091 | 3300005844 | Switchgrass Rhizosphere | HDQVRTIDFDELPTHFDPYLKGLVRGRTVVRIAPDTHGG* |
| Ga0066696_106781262 | 3300006032 | Soil | QVHDQVRTIDFDELPTHFDAYIKGMARGRTVVRVAADTHP* |
| Ga0066652_1016791062 | 3300006046 | Soil | ANEWRPTRAQAKVVTIDFADLPTHFDAFLKGMVRGRTVVRVGADIAGL* |
| Ga0068871_1021551011 | 3300006358 | Miscanthus Rhizosphere | DQVRTIDFNELPTHFDPYLKGLARGRTVVRVAPDTHGG* |
| Ga0074064_117968351 | 3300006603 | Soil | LAEQVPGTRLEVFDQVRTIDFDDLPTHFDPYLKGMVRGRTVVRVAPDTHP* |
| Ga0074060_110985042 | 3300006604 | Soil | PDRVHDLVRTIDFDELPTHFDPYLKGLARGRTVVRVAPDTHGG* |
| Ga0074062_121066771 | 3300006606 | Soil | RPDRVHDLVRTIDFDELPTHFDPYLKGLARGRTVVRVAPDTHGG* |
| Ga0066653_107664071 | 3300006791 | Soil | KLAVAWRPDRVHDQVRTIDFEDLPTHFDAYIKGLVRGRTVVRIGADRHP* |
| Ga0068865_1002854012 | 3300006881 | Miscanthus Rhizosphere | VHDQVRTIDFDELPTHFDPYLKGLVRGRTVVRIAPDTHGG* |
| Ga0079219_100031451 | 3300006954 | Agricultural Soil | KLAIEWRPDRVHDEVRTIDFEELPTHFDAYLKGMARGRTVVRVGADTHP* |
| Ga0105044_101473261 | 3300007521 | Freshwater | WRPDRVHDQVRTIDFDELPTHFDAYLKGLVRGRTVVRIAPDTHGG* |
| Ga0105245_105843031 | 3300009098 | Miscanthus Rhizosphere | ARVVTIDFADLPTHFDAFLKGTVRCRTVVRVGADTAGL* |
| Ga0114129_132170531 | 3300009147 | Populus Rhizosphere | QVHDQVRTIDFDELPTHFDAYIKGMVRGRTVVRIAPDTHP* |
| Ga0105241_118282571 | 3300009174 | Corn Rhizosphere | KLAVDWRPDRVHDKVATIDFEDLPTHFDAYLKGMARGRTVVRVGADTHP* |
| Ga0105242_115484132 | 3300009176 | Miscanthus Rhizosphere | AVQWRPDRVHDQVRTIDFDELPEHFDAYIKGMVRGRMVVRIGADSHP* |
| Ga0105242_121112002 | 3300009176 | Miscanthus Rhizosphere | PDRVHDEVRTIDFDELPTHFDAYLKGMVRGRTVVRVAADTHP* |
| Ga0105248_101561151 | 3300009177 | Switchgrass Rhizosphere | RVHDQVRTIDFDELPTHFDPYLKGMVRGRTVVRIAPDTHP* |
| Ga0105248_105208582 | 3300009177 | Switchgrass Rhizosphere | WRPDRVHDQVRTIDFDELPEHFDAYIKGMVRGRMVVRIGADSHP* |
| Ga0105249_131735851 | 3300009553 | Switchgrass Rhizosphere | WRPDRVHDQVRTIDFDELPTHFDPYLKGLVRGRTVVRIAPDTHGG* |
| Ga0116147_12933352 | 3300009667 | Anaerobic Digestor Sludge | RTIDFEELPTHFDAYLKGMVRGRTVVRVGRDTHP* |
| Ga0134065_102305791 | 3300010326 | Grasslands Soil | VLTIDFDELPTHFDSYIKGTVRGRTVVRIGADSHP* |
| Ga0134121_119436142 | 3300010401 | Terrestrial Soil | VHDQVRTIDFDELPTHFEPYLKGMVRGRTVVRIAPDTHP* |
| Ga0105246_106645661 | 3300011119 | Miscanthus Rhizosphere | VEWRPDRVHDEVRTIDFDELPTHFDACLKGMVRGRTVVRVAADTHP* |
| Ga0136619_100840982 | 3300012185 | Polar Desert Sand | PDSVHDQVRTIDFDELPTHFDAYIKGLVRGRTVVRIAPDTHGG* |
| Ga0137382_100379031 | 3300012200 | Vadose Zone Soil | KVVTIDFTDLPTHFDAFLKGMVRGRTVVRVGADIAGL* |
| Ga0137365_110785942 | 3300012201 | Vadose Zone Soil | AWRPDRVHDQVRTIDFEDLPMHFDAYIKGLVRGRTVVRIGADTHP* |
| Ga0137381_100525471 | 3300012207 | Vadose Zone Soil | LAVDWRPDRVHDQVHTIDFEDLPMHFDAYLKGLVRGRTVVRIGPDSHP* |
| Ga0137378_114331831 | 3300012210 | Vadose Zone Soil | TRVQSKVVTIDFADLPTHFDAFLKGMVRGRTVVRVGADIAGL* |
| Ga0137372_100957661 | 3300012350 | Vadose Zone Soil | DWRPDRVHDQVHTIDFEDLPMHFDAYLKGLVRGRTVVRIGPDSHP* |
| Ga0137367_108844361 | 3300012353 | Vadose Zone Soil | QVRTIDFEELPLHFDAYLKGTVRGRTVVRVAPDTHP* |
| Ga0137366_100958491 | 3300012354 | Vadose Zone Soil | PDRVHDQVHTIDFEDLPMHFDAYLKGLVRGRTVVRIGPDSHP* |
| Ga0136635_103171382 | 3300012530 | Polar Desert Sand | VHDQVRTIDFDELPTHFDAYIKGLVRGRTVVRIAPDTHGG* |
| Ga0164301_106833642 | 3300012960 | Soil | DEVRTIDFDELPTHFDAYLKGMVRGRTVVRVAADTHP* |
| Ga0134076_101965132 | 3300012976 | Grasslands Soil | WRPDSVHDQVRTIDFEDLPMHFDAYIKGLVRGRTVVRIGADTHP* |
| Ga0157374_123674022 | 3300013296 | Miscanthus Rhizosphere | PDRVHDQVRTIDFDELPTHFDPYLKGMVRGRTVVRIAPDTHP* |
| Ga0157375_111193792 | 3300013308 | Miscanthus Rhizosphere | QVRTIDFEDLPTHFDAYLKGMVRGRTVVRIGPDSHP* |
| Ga0134079_104507942 | 3300014166 | Grasslands Soil | RPSRVQARVVTIDFADLPMHFDAFLKGTVRCRTVVRVGADTAGL* |
| Ga0075345_10525351 | 3300014312 | Natural And Restored Wetlands | DRVHDQVRTIDFDDLPTHFDPYIKGMVRGRTVVRIAPDSHP* |
| Ga0075355_10237571 | 3300014322 | Natural And Restored Wetlands | TIDFDDLPTHFDPYLKGLVRGRTVVRIAPDSHGG* |
| Ga0075356_12179131 | 3300014323 | Natural And Restored Wetlands | QVRTIDFDELPTHFDAYIKGLVRGRTVVKIAADPVGL* |
| Ga0163163_101772132 | 3300014325 | Switchgrass Rhizosphere | VHDQVRTIDFDELPTHFDPFLKGMVRGRTVVRIAPDTHP* |
| Ga0163163_106867292 | 3300014325 | Switchgrass Rhizosphere | HDQVRTIDFDELPEHFDAYIKGMVRGRMVVRIGADSHP* |
| Ga0163163_117972401 | 3300014325 | Switchgrass Rhizosphere | RVHDQVRTIDFDELPTHFDPYIKGMVRGRTVVRIAPDTHP* |
| Ga0167639_10139781 | 3300015080 | Glacier Forefield Soil | RAQANVVTIDFADLPTHFDAFLKGMVRGRTVVRVGADIAGL* |
| Ga0167668_10917741 | 3300015193 | Glacier Forefield Soil | NEWRPTRVQSKVVTIDFADLPTHFDAFLKGMVRGRTVVRVGADIAGL* |
| Ga0132257_1045161952 | 3300015373 | Arabidopsis Rhizosphere | RLANEWRPSRVQARVVTIDFADLPTHFDAFLKGTVRCRTVVRVGADTAGL* |
| Ga0132255_1003516942 | 3300015374 | Arabidopsis Rhizosphere | VHDEVRTIDFDELPTHFDAYLKGMVRGRTVVRVAADTHP* |
| Ga0187825_104082942 | 3300017930 | Freshwater Sediment | WRPDRVHDKVATIDFDELPMHFDAYLKGMARGRTVVRVGADTHP |
| Ga0187777_101954942 | 3300017974 | Tropical Peatland | RTIDFAELPTHFDPYLKGLVRGRTVVRIAPDSHGG |
| Ga0184618_102731131 | 3300018071 | Groundwater Sediment | WRPTRVQSKVVTIDFADLPTHFDAFLKGMVRGRTVVRVGADIAGL |
| Ga0190272_113983032 | 3300018429 | Soil | WRPDRVHDQVRTIDFEELPTHFDAYLKGMVRGRTVVRIGPDSHP |
| Ga0066667_119574972 | 3300018433 | Grasslands Soil | VHDQVRTIDFEDLPMHFDAYIKGLVRGRTVVRIGADTHP |
| Ga0066667_120150412 | 3300018433 | Grasslands Soil | QVLTIDFDELPTHFDSYIKGTVRGRTVVRIGADSHP |
| Ga0190274_118917401 | 3300018476 | Soil | RVHDQVRTIDFDELPTHFDPFLKGMVRGRTVVRVGSDSHP |
| Ga0066669_120704431 | 3300018482 | Grasslands Soil | RPDRVHDQVLTIDFDELPTHFDSYIKGTVRGRTVVRIGADTHP |
| Ga0206356_118255371 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | HDMVRTIDFDELPHNFDAYLKGMARGRTVVRVGADTHP |
| Ga0208848_11192052 | 3300025509 | Arctic Peat Soil | TRVQSKVVTIDFADLPTHFDAFLKGMVRGRTVVRVGADTAGL |
| Ga0207680_110549352 | 3300025903 | Switchgrass Rhizosphere | RVHDQVRTIDFDELPTHFDPFLKGMVRGRTVVRIAPDSHP |
| Ga0207654_108547632 | 3300025911 | Corn Rhizosphere | KLAVDWRPDRVHDKVATIDFEDLPTHFDAYLKGMARGRTVVRVGADTHP |
| Ga0207693_101301092 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | NRLAVEWRPDRVHDKVSTIDFDELPMHFDAYLKGMARGRTVVRVAADSHP |
| Ga0207663_104231351 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | PSRVQARVVTIDFADLPTHFDAFLKGTVRGRTVVRVGADTAGL |
| Ga0207663_116537321 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VATIDFEDLPTHFDAYLKGMARGRTVVRVGADTHP |
| Ga0207660_105188042 | 3300025917 | Corn Rhizosphere | WRPDRVHDEVRTIDFDELPTHFDAYLKGMARGRTVVRVGADTHP |
| Ga0207649_100590913 | 3300025920 | Corn Rhizosphere | RVHDEVRTIDFDELPTHFDAYLKGMVRGRTVVRVAADTHP |
| Ga0207659_101982412 | 3300025926 | Miscanthus Rhizosphere | VRTIDFDELPTHFDAYLKGMARGRTVVRVGADTHP |
| Ga0207690_103711792 | 3300025932 | Corn Rhizosphere | KLAVEWRPDRVHDKVATIDFDELPMHFDAYLKGMARGRTVVRVGADSHP |
| Ga0207706_113920671 | 3300025933 | Corn Rhizosphere | LAVVWRPDRVHDQVRTIDFDELPTHFDAYLKGMVRGRTVVRVGHDTHP |
| Ga0207706_116048801 | 3300025933 | Corn Rhizosphere | NKLAVEWRPDRVHDQVRTIDFDELPTHFDPYLKGMVPGRTVVRIAPDTHP |
| Ga0207686_112227811 | 3300025934 | Miscanthus Rhizosphere | EWRPDRVHDEVRTIDFDELPTHFDAYLKGMVRGRTVVRVAADTHP |
| Ga0207651_100367413 | 3300025960 | Switchgrass Rhizosphere | PDRVHDEVRTIDFDELPTHFDAYLKGMVRGRTVVRVAADTHP |
| Ga0207712_108579142 | 3300025961 | Switchgrass Rhizosphere | QARVVTIDFADLPTHFDAFLKGTVRCRTVVRVGADTAGL |
| Ga0207668_104759772 | 3300025972 | Switchgrass Rhizosphere | VRTIDFEDLPTHFDSYLKGMVRGRTVVRVGADTHP |
| Ga0207640_112261051 | 3300025981 | Corn Rhizosphere | RVHDQVRTIDFDELPTHFDPYLKGLVRGRTVVRIAPDTHGG |
| Ga0207658_104614151 | 3300025986 | Switchgrass Rhizosphere | AVKWRPDRVHDQVRTIDFDELPEHFDAYLKGMARGRTVVRIGADTHP |
| Ga0207658_108930492 | 3300025986 | Switchgrass Rhizosphere | QARVVTIDFADLPTHFDAFLKGTVRGRTVVRVGADTAGL |
| Ga0207658_114625322 | 3300025986 | Switchgrass Rhizosphere | WRPDRVHDQVRTIDFEELPTHFDPYLKGLVRGRTVVRVAPDSHGG |
| Ga0208541_10266112 | 3300026061 | Natural And Restored Wetlands | WRPDRVHDQVRTIDFDDLPTHFDPYIKGMVRGRTVVRIAPDSHP |
| Ga0207678_105070622 | 3300026067 | Corn Rhizosphere | ANEWRPSRVQARVVTIDFADLPTHFDAFLKGTVRCRTVVRVGADTAGL |
| Ga0207702_104852722 | 3300026078 | Corn Rhizosphere | DQVHDQVRTIDFDELPTHFDAYLKGTVRGRTVVRIAADTHP |
| Ga0207641_101072811 | 3300026088 | Switchgrass Rhizosphere | VHDQVRTIDFDELPTHFDPYLKGMVRGRTVVRIAPDTHP |
| Ga0207641_105260221 | 3300026088 | Switchgrass Rhizosphere | VHDQVRTIDFDELPTHFDPYLKGLVRGRTVVRIAPDTHGG |
| Ga0207676_107437631 | 3300026095 | Switchgrass Rhizosphere | DQVRTIDFDELPEHFDAYIKGMVRGRMVVRIGADSHP |
| Ga0207675_1011622422 | 3300026118 | Switchgrass Rhizosphere | LWDRLANEWRPSRVQARVVTIDFADLPTHFDAFLKGTVRCRTVVRVGADTAGL |
| Ga0207698_104539821 | 3300026142 | Corn Rhizosphere | QWRPDVVHDQVRTIDFADLPTHFDAYLKGMVRGRTVVKIGSDPVGL |
| Ga0209647_10526161 | 3300026319 | Grasslands Soil | LAVEWRPDRVHDLVRTIDFDELPTHFDPYLKGLVRGRTVVRIASDTHP |
| Ga0209152_103109502 | 3300026325 | Soil | AWRPDRVHDQVRTIDFEDLPTHFDAYIKGLVRGRTVVRIGADTHP |
| Ga0209178_11698532 | 3300027725 | Agricultural Soil | EWRPDRVHDEVRTIDFEELPTHFDAYLKGMARGRTVVRVGADSHP |
| Ga0209254_103350852 | 3300027897 | Freshwater Lake Sediment | DRVHDQVRTIDFEDLPTHFDAYLKGMVRGRTVVRIGRDPHP |
| Ga0268264_101015973 | 3300028381 | Switchgrass Rhizosphere | QVRTIDFEELPTHFDPYLKGLVRGRTVVRVAPDSHGG |
| Ga0247828_100945891 | 3300028587 | Soil | EVRTIDFDELPTHFDAYLKGMARGRTVVRVGADTHP |
| Ga0302264_11824372 | 3300028732 | Fen | PDRVHDLVRTIDFDDLPTHFDPYLKGLVRGRTVVRIAPDSHGG |
| Ga0302208_101386561 | 3300028774 | Fen | AVEWRPDRVHDLVRTIDFDDLPTHFDPYLKGLVRGRTVVRIAPDSHGG |
| Ga0307503_102866741 | 3300028802 | Soil | LVRTIDFDELPTHFDAYLKGLVRGRTVVRIAPDTHGG |
| Ga0302259_10840012 | 3300028861 | Fen | LVRTIDFDDLPTHFDPYLKGLVRGRTVVRIAPDSHGG |
| Ga0311333_105682182 | 3300030114 | Fen | RPDRVHDLVRTIDFDELPTHFDPFLKGLVRGRTVVRIAPDTHGG |
| Ga0311360_107170531 | 3300030339 | Bog | DRVHDLVRTIDFDDLPTHFDPYLKGLVRGRTVVRIAPDSHGG |
| Ga0307501_100183152 | 3300031152 | Soil | PDRVHDQVLTIDFDELPTHFDSYIKGTVRGRTVVRIGADSHP |
| Ga0265339_103420191 | 3300031249 | Rhizosphere | DKVHDQVRTIDFDDLPTHFDPYLKGMVRGRTVVRIAPDTHP |
| Ga0311364_118680732 | 3300031521 | Fen | LAVEWRPDRVHDLVRTIDFEELPTHFDPYLKGLVRGRTVVRIAPDSHGG |
| Ga0318515_104813062 | 3300031572 | Soil | QVRTIDFEDLPTHFDPYLKGMVRGRTVVRIAPDTHP |
| Ga0307469_105070401 | 3300031720 | Hardwood Forest Soil | EWRPDRVHDQVRTIDFEDLPTHFDPYLKGMVRGRTVVRIAPDTHP |
| Ga0302321_1001787721 | 3300031726 | Fen | VEWRPDRVHDLVRTIDFDDLPTHFDPYLKGLVRGRTVVRIAPDSHGG |
| Ga0302321_1004281541 | 3300031726 | Fen | VRTIDFDDLPTHFDPYLKGLVRGRTVVRIAPDSHGG |
| Ga0307405_102533522 | 3300031731 | Rhizosphere | QVHDQVRTIDFDELPTHFDTYLKGMVRGRTVVRIGSDSHP |
| Ga0318501_105228531 | 3300031736 | Soil | VHDQARTIDFVDLPTHFDAYLKGLVRGRTVVRIGADTHP |
| Ga0318503_100463642 | 3300031794 | Soil | HVHDLARTIDFIDLPTHFDAYLKGLVRGRTVVRIGADTHP |
| Ga0315290_101985062 | 3300031834 | Sediment | RTIDFADLPTHFDAYIKGLVRGRTVVKIAADPVGL |
| Ga0315290_108697492 | 3300031834 | Sediment | EWRPDRVHDQVRTIDFEDLPTHFDPYIKGMVRGRTVVRIGPDSHP |
| Ga0315290_117289441 | 3300031834 | Sediment | EWRPDRVHDQVRTIDFDDLPTHFDPYLKGMVRGRTVVRIAPDTHP |
| Ga0315297_112503151 | 3300031873 | Sediment | WRPDRVHDQVRTIDFDDLPTHFDPYLKGMVRGRTVVRIAPDSHP |
| Ga0315285_105470491 | 3300031885 | Sediment | QVRTIDFEDLPTHFDPYIKGMVRGRTVVRIAPDSHP |
| Ga0311367_117947491 | 3300031918 | Fen | EWRPDRVHDLVRTIDFDDLPTHFDPYLKGLVRGRTVVRIAPDSHGG |
| Ga0307416_1034920152 | 3300032002 | Rhizosphere | QVRTIDFDELPTHFDAYLKGMVRGRTVVRIGPDTHP |
| Ga0310902_102346152 | 3300032012 | Soil | VRTIDFDELPTHFDAYLKGMVRGRTVVRVAADTHP |
| Ga0310899_100494262 | 3300032017 | Soil | RPDRVHDEVRTIDFDELPTHFDAYLKGMARGRTVVRVGADTHP |
| Ga0315272_102022321 | 3300032018 | Sediment | WRPDQVHDQVRTIDFGDLPTHFDAYIKGLVRGRTVVKIAADPVGL |
| Ga0318570_104522882 | 3300032054 | Soil | RVQSKVRTIDFAELPTHFDAFLKGMVRGRTVVRIGADPVGN |
| Ga0315292_102537841 | 3300032143 | Sediment | AVEWRPDRVHDQVRTIDFDDLPTHFDPYLKGMVRGRTVVRIAPDSHP |
| Ga0315292_105977821 | 3300032143 | Sediment | PDRVHDQVRTIDFEDLPTHFDPYIKGMVRGRTVVRIAPDSHP |
| Ga0315276_100843481 | 3300032177 | Sediment | VRTIDFDDLPTHFDPYLKGMVRGRTVVRIAPDTHP |
| Ga0315276_114221821 | 3300032177 | Sediment | NKLAVEWRPDRVHDQVRTIDFEDLPTHFDPYIKGMVRGRTVVRIAPDSHP |
| Ga0315271_108303251 | 3300032256 | Sediment | RPDQVHDQVRTIDFDELPTHFDAYIKGLVRGRTVVKIAADPVGL |
| Ga0315270_108662871 | 3300032275 | Sediment | AVEWRPDRVHDQVRTIDFEDLPTHFDPYIKGMVRGRTVVRIAPDSHP |
| Ga0315275_109283802 | 3300032401 | Sediment | DWRPDKVHDQVRTIDFDELPTHFDAYIKGLVRGRTVVKIAADPVGL |
| Ga0315273_105878592 | 3300032516 | Sediment | RVHDQVRTIDFEDLPTHFDPYIKGMVRGRTVVRIAPDSHP |
| Ga0315273_115266941 | 3300032516 | Sediment | VEWRPDRVHDQVRTIDFEDLPTHFDPYIKGMVRGRTVVRIAPDSHP |
| Ga0315273_122636031 | 3300032516 | Sediment | VHDQVRTIDFEDLPTHFDPYIKGMVRGRTVVRIAPDSHP |
| Ga0318519_100202211 | 3300033290 | Soil | SHVHDLARTIDFIDLPTHFDAYLKGLVRGRTVVRIGADTHP |
| Ga0316605_111386321 | 3300033408 | Soil | VHDLVRTIDFDELPTHFDPYLKGMVRGRTVVRIAPDTHP |
| Ga0316605_114295112 | 3300033408 | Soil | QVRTIDFEDLPTHFDPYLKGMVRGRTVVRIAPDSHP |
| Ga0316625_1020720232 | 3300033418 | Soil | VHDLVRTIDFDELPTHFDPYLKGMVRGRTVVRIGADTHP |
| Ga0316625_1025927662 | 3300033418 | Soil | PDQVHDQVRTIDFDELPTHFDAYLKGLVRGRTVVKIAADPVGL |
| Ga0310811_102739971 | 3300033475 | Soil | HDEVRTIDFDELPTHFDAYLKGMARGRTVVRVGADTHP |
| Ga0316628_1035081242 | 3300033513 | Soil | WRPDQVHDQVRTIDFDDLPTHFEPYLKGMVRGRTVVRIAPDTHP |
| Ga0316617_1021983112 | 3300033557 | Soil | PDIVHDQVRTIDFDELPTHFDAYIKGLVRGRTVVKVAADHVGL |
| Ga0364943_0038978_1400_1540 | 3300034354 | Sediment | VEWRPDQVHDLVRTIDFDDLPTHFDPYIKGMVRGRTVVRIAPDTHP |
| ⦗Top⦘ |