Metagenome / Metatranscriptome Family F036723

Basic Information
Family ID	F036723
Family Type	Metagenome / Metatranscriptome
Number of Sequences	169
Average Sequence Length	42 residues
Representative Sequence	PDRVHDQVRTIDFDELPTHFDPYLKGMVRGRTVVRIAPDTHP
Number of Associated Samples	148
Number of Associated Scaffolds	169

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	99.41 %
% of genes from short scaffolds (< 2000 bps)	86.98 %
Associated GOLD sequencing projects	137
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.43

Most Common Taxonomy
Group	Bacteria (97.041 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (9.467 % of family members)
Environment Ontology (ENVO)	Unclassified (51.479 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (47.929 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 12.86% β-sheet: 17.14% Coil/Unstructured: 70.00%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 169 Family Scaffolds
PF16177	ACAS_N	66.86
PF00501	AMP-binding	12.43
PF06089	Asparaginase_II	5.33
PF01757	Acyl_transf_3	4.73
PF13193	AMP-binding_C	2.37
PF12276	DUF3617	0.59
PF03872	RseA_N	0.59
PF00132	Hexapep	0.59
PF01053	Cys_Met_Meta_PP	0.59
PF04542	Sigma70_r2	0.59

COG ID	Name	Functional Category	% Frequency in 169 Family Scaffolds
COG4448	L-asparaginase II	Amino acid transport and metabolism [E]	5.33
COG1595	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family	Transcription [K]	0.59
COG4941	Predicted RNA polymerase sigma factor, contains C-terminal TPR domain	Transcription [K]	0.59
COG4100	Cystathionine beta-lyase family protein involved in aluminum resistance	Inorganic ion transport and metabolism [P]	0.59
COG3073	RseA, negative regulator of sigma E activity	Signal transduction mechanisms [T]	0.59
COG2873	O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent	Amino acid transport and metabolism [E]	0.59
COG2008	Threonine aldolase	Amino acid transport and metabolism [E]	0.59
COG1982	Arginine/lysine/ornithine decarboxylase	Amino acid transport and metabolism [E]	0.59
COG1921	Seryl-tRNA(Sec) selenium transferase	Translation, ribosomal structure and biogenesis [J]	0.59
COG0075	Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG	Amino acid transport and metabolism [E]	0.59
COG1191	DNA-directed RNA polymerase specialized sigma subunit	Transcription [K]	0.59
COG0626	Cystathionine beta-lyase/cystathionine gamma-synthase	Amino acid transport and metabolism [E]	0.59
COG0568	DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)	Transcription [K]	0.59
COG0520	Selenocysteine lyase/Cysteine desulfurase	Amino acid transport and metabolism [E]	0.59
COG0436	Aspartate/methionine/tyrosine aminotransferase	Amino acid transport and metabolism [E]	0.59
COG0399	dTDP-4-amino-4,6-dideoxygalactose transaminase	Cell wall/membrane/envelope biogenesis [M]	0.59
COG0156	7-keto-8-aminopelargonate synthetase or related enzyme	Coenzyme transport and metabolism [H]	0.59

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	97.04 %
Unclassified	root	N/A	2.96 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	97.04 %
Unclassified	root	N/A	2.96 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	97.04 %
Unclassified	root	N/A	2.96 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	95.86 %
Unclassified	root	N/A	2.96 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	82.25 %
Unclassified	root	N/A	2.96 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	1.18 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.59 %

Name	Rank	Taxonomy	Distribution
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	38.46 %
Unclassified	root	N/A	2.96 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	1.78 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.78 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1.18 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.59 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	0.59 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	38.46 %
Unclassified	root	N/A	2.96 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	1.18 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	1.18 %
Zoogloeaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae	0.59 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.59 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.59 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	0.59 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	38.46 %
Unclassified	root	N/A	2.96 %
Cystobacterineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae	1.18 %
Aromatoleum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum	1.18 %
Acidovorax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax	0.59 %
Rhizobium/Agrobacterium group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group	0.59 %
Thauera	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera	0.59 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	0.59 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	38.46 %
Unclassified	root	N/A	2.96 %
Aromatoleum aromaticum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum	1.18 %
Myxococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae	1.18 %
unclassified Acidovorax	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax	0.59 %
unclassified Thauera	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera	0.59 %
Rhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium	0.59 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	0.59 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	38.46 %
Unclassified	root	N/A	2.96 %
unclassified Myxococcaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae	1.18 %
Aromatoleum aromaticum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum	1.18 %
Acidovorax sp. CCYZU-2555	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. CCYZU-2555	0.59 %
Thauera sp. 28	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp. 28	0.59 %
Rhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium	0.59 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	0.59 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	38.46 %
Unclassified	root	N/A	2.96 %
Myxococcaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium	1.18 %
Aromatoleum aromaticum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum	1.18 %
Acidovorax sp. CCYZU-2555	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. CCYZU-2555	0.59 %
Thauera sp. 28	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp. 28	0.59 %
Rhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium	0.59 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	0.59 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2124908043\|A2_c1_ConsensusfromContig31626	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	844	Open in IMG/M
3300001978\|JGI24747J21853_1034343	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	587	Open in IMG/M
3300004014\|Ga0055456_10237200	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	634	Open in IMG/M
3300004152\|Ga0062386_101158666	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	642	Open in IMG/M
3300004480\|Ga0062592_102662576	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	505	Open in IMG/M
3300005177\|Ga0066690_10984600	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	531	Open in IMG/M
3300005327\|Ga0070658_10088463	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum	2550	Open in IMG/M
3300005331\|Ga0070670_100794153	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	855	Open in IMG/M
3300005332\|Ga0066388_100950225	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1431	Open in IMG/M
3300005334\|Ga0068869_101947112	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum	527	Open in IMG/M
3300005335\|Ga0070666_10332823	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1084	Open in IMG/M
3300005338\|Ga0068868_102191862	All Organisms → cellular organisms → Bacteria → Proteobacteria	526	Open in IMG/M
3300005354\|Ga0070675_100176703	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1844	Open in IMG/M
3300005355\|Ga0070671_100041073	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3843	Open in IMG/M
3300005356\|Ga0070674_100164365	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1687	Open in IMG/M
3300005356\|Ga0070674_101165138	All Organisms → cellular organisms → Bacteria → Proteobacteria	683	Open in IMG/M
3300005364\|Ga0070673_101301509	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	683	Open in IMG/M
3300005365\|Ga0070688_100641171	All Organisms → cellular organisms → Bacteria → Proteobacteria	817	Open in IMG/M
3300005434\|Ga0070709_10717821	All Organisms → cellular organisms → Bacteria → Proteobacteria	779	Open in IMG/M
3300005438\|Ga0070701_10101093	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1597	Open in IMG/M
3300005455\|Ga0070663_101786057	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	551	Open in IMG/M
3300005456\|Ga0070678_102075722	All Organisms → cellular organisms → Bacteria → Proteobacteria	538	Open in IMG/M
3300005459\|Ga0068867_101662004	All Organisms → cellular organisms → Bacteria → Proteobacteria	598	Open in IMG/M
3300005535\|Ga0070684_100675059	All Organisms → cellular organisms → Bacteria → Proteobacteria	962	Open in IMG/M
3300005569\|Ga0066705_10157161	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1400	Open in IMG/M
3300005576\|Ga0066708_10183702	All Organisms → cellular organisms → Bacteria → Proteobacteria	1304	Open in IMG/M
3300005577\|Ga0068857_100077254	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2970	Open in IMG/M
3300005616\|Ga0068852_100455568	All Organisms → cellular organisms → Bacteria → Proteobacteria	1267	Open in IMG/M
3300005719\|Ga0068861_102109370	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	564	Open in IMG/M
3300005834\|Ga0068851_10014488	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3744	Open in IMG/M
3300005841\|Ga0068863_100353942	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1430	Open in IMG/M
3300005841\|Ga0068863_101561386	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	669	Open in IMG/M
3300005843\|Ga0068860_101720771	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	649	Open in IMG/M
3300005844\|Ga0068862_100081209	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2812	Open in IMG/M
3300006032\|Ga0066696_10678126	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	664	Open in IMG/M
3300006046\|Ga0066652_101679106	All Organisms → cellular organisms → Bacteria → Proteobacteria	580	Open in IMG/M
3300006358\|Ga0068871_102155101	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	531	Open in IMG/M
3300006603\|Ga0074064_11796835	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp. 28	527	Open in IMG/M
3300006604\|Ga0074060_11098504	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	577	Open in IMG/M
3300006606\|Ga0074062_12106677	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	858	Open in IMG/M
3300006791\|Ga0066653_10766407	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	505	Open in IMG/M
3300006881\|Ga0068865_100285401	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1316	Open in IMG/M
3300006954\|Ga0079219_10003145	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	4626	Open in IMG/M
3300007521\|Ga0105044_10147326	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	2500	Open in IMG/M
3300009098\|Ga0105245_10584303	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1142	Open in IMG/M
3300009147\|Ga0114129_13217053	Not Available	531	Open in IMG/M
3300009174\|Ga0105241_11828257	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	594	Open in IMG/M
3300009176\|Ga0105242_11548413	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	695	Open in IMG/M
3300009176\|Ga0105242_12111200	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	607	Open in IMG/M
3300009177\|Ga0105248_10156115	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2575	Open in IMG/M
3300009177\|Ga0105248_10520858	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1341	Open in IMG/M
3300009553\|Ga0105249_13173585	Not Available	528	Open in IMG/M
3300009667\|Ga0116147_1293335	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	614	Open in IMG/M
3300010326\|Ga0134065_10230579	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	683	Open in IMG/M
3300010401\|Ga0134121_11943614	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	619	Open in IMG/M
3300011119\|Ga0105246_10664566	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	909	Open in IMG/M
3300012185\|Ga0136619_10084098	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1220	Open in IMG/M
3300012200\|Ga0137382_10037903	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2938	Open in IMG/M
3300012201\|Ga0137365_11078594	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	579	Open in IMG/M
3300012207\|Ga0137381_10052547	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3369	Open in IMG/M
3300012210\|Ga0137378_11433183	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	603	Open in IMG/M
3300012350\|Ga0137372_10095766	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2498	Open in IMG/M
3300012353\|Ga0137367_10884436	All Organisms → cellular organisms → Bacteria → Proteobacteria	616	Open in IMG/M
3300012354\|Ga0137366_10095849	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2250	Open in IMG/M
3300012530\|Ga0136635_10317138	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium	560	Open in IMG/M
3300012960\|Ga0164301_10683364	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	770	Open in IMG/M
3300012976\|Ga0134076_10196513	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	844	Open in IMG/M
3300013296\|Ga0157374_12367402	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	558	Open in IMG/M
3300013308\|Ga0157375_11119379	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	922	Open in IMG/M
3300014166\|Ga0134079_10450794	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	610	Open in IMG/M
3300014312\|Ga0075345_1052535	All Organisms → cellular organisms → Bacteria → Proteobacteria	845	Open in IMG/M
3300014322\|Ga0075355_1023757	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1251	Open in IMG/M
3300014323\|Ga0075356_1217913	All Organisms → cellular organisms → Bacteria	522	Open in IMG/M
3300014325\|Ga0163163_10177213	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	2179	Open in IMG/M
3300014325\|Ga0163163_10686729	All Organisms → cellular organisms → Bacteria → Proteobacteria	1087	Open in IMG/M
3300014325\|Ga0163163_11797240	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	673	Open in IMG/M
3300015080\|Ga0167639_1013978	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1145	Open in IMG/M
3300015193\|Ga0167668_1091774	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	573	Open in IMG/M
3300015373\|Ga0132257_104516195	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	506	Open in IMG/M
3300015374\|Ga0132255_100351694	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	2134	Open in IMG/M
3300017930\|Ga0187825_10408294	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	523	Open in IMG/M
3300017974\|Ga0187777_10195494	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1362	Open in IMG/M
3300018071\|Ga0184618_10273113	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	717	Open in IMG/M
3300018429\|Ga0190272_11398303	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	703	Open in IMG/M
3300018433\|Ga0066667_11957497	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	537	Open in IMG/M
3300018433\|Ga0066667_12015041	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	531	Open in IMG/M
3300018476\|Ga0190274_11891740	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	692	Open in IMG/M
3300018482\|Ga0066669_12070443	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium	536	Open in IMG/M
3300020070\|Ga0206356_11825537	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	516	Open in IMG/M
3300025509\|Ga0208848_1119205	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	520	Open in IMG/M
3300025903\|Ga0207680_11054935	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	581	Open in IMG/M
3300025911\|Ga0207654_10854763	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	658	Open in IMG/M
3300025915\|Ga0207693_10130109	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1979	Open in IMG/M
3300025916\|Ga0207663_10423135	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1023	Open in IMG/M
3300025916\|Ga0207663_11653732	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	515	Open in IMG/M
3300025917\|Ga0207660_10518804	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	967	Open in IMG/M
3300025920\|Ga0207649_10059091	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2404	Open in IMG/M
3300025926\|Ga0207659_10198241	All Organisms → cellular organisms → Bacteria → Proteobacteria	1601	Open in IMG/M
3300025932\|Ga0207690_10371179	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1135	Open in IMG/M
3300025933\|Ga0207706_11392067	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	576	Open in IMG/M
3300025933\|Ga0207706_11604880	Not Available	527	Open in IMG/M
3300025934\|Ga0207686_11222781	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	615	Open in IMG/M
3300025960\|Ga0207651_10036741	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3201	Open in IMG/M
3300025961\|Ga0207712_10857914	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	801	Open in IMG/M
3300025972\|Ga0207668_10475977	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. CCYZU-2555	1070	Open in IMG/M
3300025981\|Ga0207640_11226105	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	668	Open in IMG/M
3300025986\|Ga0207658_10461415	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1126	Open in IMG/M
3300025986\|Ga0207658_10893049	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	809	Open in IMG/M
3300025986\|Ga0207658_11462532	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	625	Open in IMG/M
3300026061\|Ga0208541_1026611	Not Available	581	Open in IMG/M
3300026067\|Ga0207678_10507062	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1052	Open in IMG/M
3300026078\|Ga0207702_10485272	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1203	Open in IMG/M
3300026088\|Ga0207641_10107281	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2470	Open in IMG/M
3300026088\|Ga0207641_10526022	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1151	Open in IMG/M
3300026095\|Ga0207676_10743763	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	953	Open in IMG/M
3300026118\|Ga0207675_101162242	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	792	Open in IMG/M
3300026142\|Ga0207698_10453982	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium	1238	Open in IMG/M
3300026319\|Ga0209647_1052616	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	2179	Open in IMG/M
3300026325\|Ga0209152_10310950	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	592	Open in IMG/M
3300027725\|Ga0209178_1169853	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	761	Open in IMG/M
3300027897\|Ga0209254_10335085	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1144	Open in IMG/M
3300028381\|Ga0268264_10101597	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2500	Open in IMG/M
3300028587\|Ga0247828_10094589	All Organisms → cellular organisms → Bacteria → Proteobacteria	1402	Open in IMG/M
3300028732\|Ga0302264_1182437	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	509	Open in IMG/M
3300028774\|Ga0302208_10138656	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	595	Open in IMG/M
3300028802\|Ga0307503_10286674	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	820	Open in IMG/M
3300028861\|Ga0302259_1084001	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	768	Open in IMG/M
3300030114\|Ga0311333_10568218	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	936	Open in IMG/M
3300030339\|Ga0311360_10717053	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	796	Open in IMG/M
3300031152\|Ga0307501_10018315	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1295	Open in IMG/M
3300031249\|Ga0265339_10342019	Not Available	706	Open in IMG/M
3300031521\|Ga0311364_11868073	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	590	Open in IMG/M
3300031572\|Ga0318515_10481306	All Organisms → cellular organisms → Bacteria	663	Open in IMG/M
3300031720\|Ga0307469_10507040	All Organisms → cellular organisms → Bacteria → Proteobacteria	1059	Open in IMG/M
3300031726\|Ga0302321_100178772	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	2202	Open in IMG/M
3300031726\|Ga0302321_100428154	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1446	Open in IMG/M
3300031731\|Ga0307405_10253352	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1311	Open in IMG/M
3300031736\|Ga0318501_10522853	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	648	Open in IMG/M
3300031794\|Ga0318503_10046364	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1315	Open in IMG/M
3300031834\|Ga0315290_10198506	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1743	Open in IMG/M
3300031834\|Ga0315290_10869749	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	767	Open in IMG/M
3300031834\|Ga0315290_11728944	All Organisms → cellular organisms → Bacteria → Proteobacteria	501	Open in IMG/M
3300031873\|Ga0315297_11250315	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	607	Open in IMG/M
3300031885\|Ga0315285_10547049	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	782	Open in IMG/M
3300031918\|Ga0311367_11794749	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	596	Open in IMG/M
3300032002\|Ga0307416_103492015	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	526	Open in IMG/M
3300032012\|Ga0310902_10234615	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1096	Open in IMG/M
3300032017\|Ga0310899_10049426	All Organisms → cellular organisms → Bacteria → Proteobacteria	1533	Open in IMG/M
3300032018\|Ga0315272_10202232	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	947	Open in IMG/M
3300032054\|Ga0318570_10452288	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	586	Open in IMG/M
3300032143\|Ga0315292_10253784	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1454	Open in IMG/M
3300032143\|Ga0315292_10597782	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	929	Open in IMG/M
3300032177\|Ga0315276_10084348	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3195	Open in IMG/M
3300032177\|Ga0315276_11422182	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	724	Open in IMG/M
3300032256\|Ga0315271_10830325	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	796	Open in IMG/M
3300032275\|Ga0315270_10866287	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	596	Open in IMG/M
3300032401\|Ga0315275_10928380	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	959	Open in IMG/M
3300032516\|Ga0315273_10587859	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1478	Open in IMG/M
3300032516\|Ga0315273_11526694	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	820	Open in IMG/M
3300032516\|Ga0315273_12263603	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	635	Open in IMG/M
3300033290\|Ga0318519_10020221	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2964	Open in IMG/M
3300033408\|Ga0316605_11138632	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	752	Open in IMG/M
3300033408\|Ga0316605_11429511	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	671	Open in IMG/M
3300033418\|Ga0316625_102072023	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	562	Open in IMG/M
3300033418\|Ga0316625_102592766	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	515	Open in IMG/M
3300033475\|Ga0310811_10273997	All Organisms → cellular organisms → Bacteria → Proteobacteria	1972	Open in IMG/M
3300033513\|Ga0316628_103508124	All Organisms → cellular organisms → Bacteria → Proteobacteria	566	Open in IMG/M
3300033557\|Ga0316617_102198311	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	569	Open in IMG/M
3300034354\|Ga0364943_0038978	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1542	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	60.36%
Host-Associated	Host-Associated	39.05%
Engineered	Engineered	0.59%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	46.15%
Plants	Host-Associated → Plants	39.05%
Aquatic	Environmental → Aquatic	14.20%
Wastewater	Engineered → Wastewater	0.59%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	40.24%
Rhizosphere	Host-Associated → Plants → Rhizosphere	22.49%
Rhizoplane	Host-Associated → Plants → Rhizoplane	14.20%
Freshwater	Environmental → Aquatic → Freshwater	13.02%
Peat	Environmental → Terrestrial → Peat	5.33%
Roots	Host-Associated → Plants → Roots	2.37%
Marine	Environmental → Aquatic → Marine	0.59%
Sediment	Environmental → Aquatic → Sediment	0.59%
Floodplain	Environmental → Terrestrial → Floodplain	0.59%
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	0.59%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	28.40%
Soil	Host-Associated → Plants → Rhizosphere → Soil	13.02%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	12.43%
Lake	Environmental → Aquatic → Freshwater → Lake	9.47%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	9.47%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	6.51%
Loam	Environmental → Terrestrial → Soil → Loam	5.33%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	5.33%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	2.37%
Ice	Environmental → Aquatic → Freshwater → Ice	1.78%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.18%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.18%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.59%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.59%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.59%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.59%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.59%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	0.59%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	13.61%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	13.02%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	12.43%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	9.47%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	9.47%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	6.51%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	6.51%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	5.33%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.73%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	3.55%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	2.37%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.78%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.78%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	1.18%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	1.18%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.18%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	0.59%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.59%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.59%
Glacial Lake	Environmental → Aquatic → Freshwater → Ice → Glacial Lake	0.59%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.59%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.59%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.59%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.59%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.59%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	0.59%

Habitat	Taxonomy	Distribution
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	9.47%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	5.92%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	5.92%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	4.73%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	4.14%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	4.14%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	4.14%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.55%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	3.55%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	3.55%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.96%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.96%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.96%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.37%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	2.37%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.37%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.37%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	2.37%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.78%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.78%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.78%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	1.78%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	1.18%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	1.18%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.18%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.18%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.18%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.18%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.18%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.18%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	0.59%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.59%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.59%
Freshwater	Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater	0.59%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.59%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.59%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.59%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.59%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.59%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	0.59%
Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil	0.59%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.59%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.59%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.59%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.59%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	0.59%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.59%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.59%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.59%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.59%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	0.59%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.59%
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	0.59%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2124908043	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2	Environmental	Open in IMG/M
3300001978	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6	Host-Associated	Open in IMG/M
3300004014	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D2	Environmental	Open in IMG/M
3300004152	Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3	Environmental	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300005177	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139	Environmental	Open in IMG/M
3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Host-Associated	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Environmental	Open in IMG/M
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental	Open in IMG/M
3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Environmental	Open in IMG/M
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated	Open in IMG/M
3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Host-Associated	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Environmental	Open in IMG/M
3300005569	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154	Environmental	Open in IMG/M
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006603	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006604	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006606	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006791	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102	Environmental	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300007521	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01	Environmental	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009667	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG3_MetaG	Engineered	Open in IMG/M
3300010326	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300012185	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ353 (21.06)	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental	Open in IMG/M
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental	Open in IMG/M
3300012530	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06)	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012976	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG	Environmental	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015	Environmental	Open in IMG/M
3300014312	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1	Environmental	Open in IMG/M
3300014322	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1	Environmental	Open in IMG/M
3300014323	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300015080	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6C, Proglacial plain, adjacent to northern proglacial tributary)	Environmental	Open in IMG/M
3300015193	Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream)	Environmental	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017930	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5	Environmental	Open in IMG/M
3300017974	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG	Environmental	Open in IMG/M
3300018071	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300025509	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes)	Environmental	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026061	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D1 (SPAdes)	Environmental	Open in IMG/M
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026319	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)	Environmental	Open in IMG/M
3300026325	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)	Environmental	Open in IMG/M
3300027725	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)	Environmental	Open in IMG/M
3300027897	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)	Environmental	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028587	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3	Environmental	Open in IMG/M
3300028732	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_4	Environmental	Open in IMG/M
3300028774	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_3	Environmental	Open in IMG/M
3300028802	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S	Environmental	Open in IMG/M
3300028861	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_4	Environmental	Open in IMG/M
3300030114	I_Fen_E2 coassembly	Environmental	Open in IMG/M
3300030339	III_Bog_N1 coassembly	Environmental	Open in IMG/M
3300031152	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S	Environmental	Open in IMG/M
3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Host-Associated	Open in IMG/M
3300031521	III_Fen_E2 coassembly	Environmental	Open in IMG/M
3300031572	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031726	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1	Environmental	Open in IMG/M
3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Host-Associated	Open in IMG/M
3300031736	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21	Environmental	Open in IMG/M
3300031794	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23	Environmental	Open in IMG/M
3300031834	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0	Environmental	Open in IMG/M
3300031873	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0	Environmental	Open in IMG/M
3300031885	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36	Environmental	Open in IMG/M
3300031918	III_Fen_N3 coassembly	Environmental	Open in IMG/M
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated	Open in IMG/M
3300032012	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3	Environmental	Open in IMG/M
3300032017	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4	Environmental	Open in IMG/M
3300032018	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle	Environmental	Open in IMG/M
3300032054	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23	Environmental	Open in IMG/M
3300032143	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0	Environmental	Open in IMG/M
3300032177	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0	Environmental	Open in IMG/M
3300032256	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top	Environmental	Open in IMG/M
3300032275	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom	Environmental	Open in IMG/M
3300032401	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0	Environmental	Open in IMG/M
3300032516	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0	Environmental	Open in IMG/M
3300033290	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15	Environmental	Open in IMG/M
3300033408	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT	Environmental	Open in IMG/M
3300033418	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A	Environmental	Open in IMG/M
3300033475	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC	Environmental	Open in IMG/M
3300033513	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C	Environmental	Open in IMG/M
3300033557	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B	Environmental	Open in IMG/M
3300034354	Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.43
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.43
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F036723

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
A2_c1_00778350	2124908043	Soil	TRAQAKVVTIDFADLPTHFDAFLKGMVRGRTVVRVGADIAGL
JGI24747J21853_10343431	3300001978	Corn, Switchgrass And Miscanthus Rhizosphere	EVRTIDFDELPTHFDAYLKGMVRGRTVVRVAADTHP*
Ga0055456_102372002	3300004014	Natural And Restored Wetlands	VHDQVRTIDFDELPTHFDAYIKGLVRGRTVVKIAADPVGL*
Ga0062386_1011586661	3300004152	Bog Forest Soil	DGVHDSVRTIDFDELPTHFDAYLKGLVRGRTVVRIAADTHP*
Ga0062592_1026625761	3300004480	Soil	DRVHDEVRTIDFDELPTHFDAYLKGMVRGRTVVRVAADTHP*
Ga0066690_109846001	3300005177	Soil	EWRPTRAQAKVVTIDFADLPTHFDAFLKGMVRGRTVVRVGADIAGL*
Ga0070658_100884633	3300005327	Corn Rhizosphere	DRVHDKVSTIDFDELPMHFDAYLKGMARGRTVVRVAADSHP*
Ga0070670_1007941531	3300005331	Switchgrass Rhizosphere	PDRVHDQVRTIDFDELPTHFDPYLKGLVRGRTVVRIAPDTHGG*
Ga0066388_1009502251	3300005332	Tropical Forest Soil	SRVQSKVRTIDFAELPTHFDAFLKGMIRGRTVVRIGADPVGN*
Ga0068869_1019471122	3300005334	Miscanthus Rhizosphere	VHDQVRTIDFDELPTHFDAYLKGLVRGRTVVKIASDPVGL*
Ga0070666_103328232	3300005335	Switchgrass Rhizosphere	LANEWRPSRVQARVVTIDFADLPTHFDAFLKGTVRCRTVVRVGADTAGL*
Ga0068868_1021918622	3300005338	Miscanthus Rhizosphere	VEWRPDRVHDQVRTIDFDDLPTHFDSYLKGTVRGRTVVRIAPDTHP*
Ga0070675_1001767032	3300005354	Miscanthus Rhizosphere	DRVHDQVRTIDFNELPTHFDPYLKGLARGRTVVRVAPDTHGG*
Ga0070671_1000410731	3300005355	Switchgrass Rhizosphere	DRLANEWRPSRVQARVVTIDFADLPTHFDAFLKGTVRCRTVVRVGADTAGL*
Ga0070674_1001643652	3300005356	Miscanthus Rhizosphere	WDRLANEWRPSRVQARVVTIDFADLPTHFDAFLKGTVRCRTVVRVGADTAGL*
Ga0070674_1011651381	3300005356	Miscanthus Rhizosphere	VEWRPDRVHDQVRTIDFEDLPTHFDSYLKGMVRGRTVVRVGADTHP*
Ga0070673_1013015092	3300005364	Switchgrass Rhizosphere	VEWRPDRVHDQVRTIDFDELPTHFDPFLKGMVRGRTVVRIAPDTHP*
Ga0070688_1006411712	3300005365	Switchgrass Rhizosphere	AVDWRPDRVHDEVRTIDFDELPTHFDAYLKGMARGRTVVRVAADSHP*
Ga0070709_107178211	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	RVHDKVSTIDFDELPMHFDAYLKGMARGRTVVRVAADSHP*
Ga0070701_101010931	3300005438	Corn, Switchgrass And Miscanthus Rhizosphere	PDRVHDQVRTIDFNELPTHFDPYLKGLARGRTVVRVAPDTHGG*
Ga0070663_1017860571	3300005455	Corn Rhizosphere	PDRVHDQVRTIDFDELPEHFDAYIKGMVRGRMVVRIGADSHP*
Ga0070678_1020757221	3300005456	Miscanthus Rhizosphere	AWRPDRVHDQVRTIDFDELPTHFEPYLKGMVRGRTVVRIAPDTHP*
Ga0068867_1016620042	3300005459	Miscanthus Rhizosphere	DRVHDEVRTIDFDELPTHFDAYLKGMARGRTVVRVAADSHP*
Ga0070684_1006750591	3300005535	Corn Rhizosphere	VDWRPDRVHDEVRTIDFDELPTHFDAYLKGMVRGRTVVRVAADTHP*
Ga0066705_101571612	3300005569	Soil	KVVTIDFADLPTHFDAFLKGMVRGRTVVRVGADIAGL*
Ga0066708_101837021	3300005576	Soil	PDQVHDLVRTIDFEELPTHFDAYLKGMVRGRTVVRIGADSHP*
Ga0068857_1000772543	3300005577	Corn Rhizosphere	VRTIDFDELPTHFDAYLKGMVRGRTVVRVAADTHP*
Ga0068852_1004555681	3300005616	Corn Rhizosphere	WRPDRVHDQVRTIDFEDLPTHFDPYLKGMVRGRTVVRIGADTHP*
Ga0068861_1021093702	3300005719	Switchgrass Rhizosphere	DQVRTIDFNELPTHFDPYLKGLVRGRTVVRIAPDTHGG*
Ga0068851_100144884	3300005834	Corn Rhizosphere	EWRPDRVHDKVSTIDFDELPMHFDAYLKGMARGRTVVRVAADSHP*
Ga0068863_1003539421	3300005841	Switchgrass Rhizosphere	VQWRPDRVHDQVRTIDFDELPEHFDAYIKGMVRGRMVVRIGADSHP*
Ga0068863_1015613861	3300005841	Switchgrass Rhizosphere	RTIDFDELPTHFDPYLKGLVRGRTVVRIAPDTHGG*
Ga0068860_1017207712	3300005843	Switchgrass Rhizosphere	LAVQWRPDVVHDQVRTIDFADLPTHFDAYLKGMVRGRTVVKIGSDPVGL*
Ga0068862_1000812091	3300005844	Switchgrass Rhizosphere	HDQVRTIDFDELPTHFDPYLKGLVRGRTVVRIAPDTHGG*
Ga0066696_106781262	3300006032	Soil	QVHDQVRTIDFDELPTHFDAYIKGMARGRTVVRVAADTHP*
Ga0066652_1016791062	3300006046	Soil	ANEWRPTRAQAKVVTIDFADLPTHFDAFLKGMVRGRTVVRVGADIAGL*
Ga0068871_1021551011	3300006358	Miscanthus Rhizosphere	DQVRTIDFNELPTHFDPYLKGLARGRTVVRVAPDTHGG*
Ga0074064_117968351	3300006603	Soil	LAEQVPGTRLEVFDQVRTIDFDDLPTHFDPYLKGMVRGRTVVRVAPDTHP*
Ga0074060_110985042	3300006604	Soil	PDRVHDLVRTIDFDELPTHFDPYLKGLARGRTVVRVAPDTHGG*
Ga0074062_121066771	3300006606	Soil	RPDRVHDLVRTIDFDELPTHFDPYLKGLARGRTVVRVAPDTHGG*
Ga0066653_107664071	3300006791	Soil	KLAVAWRPDRVHDQVRTIDFEDLPTHFDAYIKGLVRGRTVVRIGADRHP*
Ga0068865_1002854012	3300006881	Miscanthus Rhizosphere	VHDQVRTIDFDELPTHFDPYLKGLVRGRTVVRIAPDTHGG*
Ga0079219_100031451	3300006954	Agricultural Soil	KLAIEWRPDRVHDEVRTIDFEELPTHFDAYLKGMARGRTVVRVGADTHP*
Ga0105044_101473261	3300007521	Freshwater	WRPDRVHDQVRTIDFDELPTHFDAYLKGLVRGRTVVRIAPDTHGG*
Ga0105245_105843031	3300009098	Miscanthus Rhizosphere	ARVVTIDFADLPTHFDAFLKGTVRCRTVVRVGADTAGL*
Ga0114129_132170531	3300009147	Populus Rhizosphere	QVHDQVRTIDFDELPTHFDAYIKGMVRGRTVVRIAPDTHP*
Ga0105241_118282571	3300009174	Corn Rhizosphere	KLAVDWRPDRVHDKVATIDFEDLPTHFDAYLKGMARGRTVVRVGADTHP*
Ga0105242_115484132	3300009176	Miscanthus Rhizosphere	AVQWRPDRVHDQVRTIDFDELPEHFDAYIKGMVRGRMVVRIGADSHP*
Ga0105242_121112002	3300009176	Miscanthus Rhizosphere	PDRVHDEVRTIDFDELPTHFDAYLKGMVRGRTVVRVAADTHP*
Ga0105248_101561151	3300009177	Switchgrass Rhizosphere	RVHDQVRTIDFDELPTHFDPYLKGMVRGRTVVRIAPDTHP*
Ga0105248_105208582	3300009177	Switchgrass Rhizosphere	WRPDRVHDQVRTIDFDELPEHFDAYIKGMVRGRMVVRIGADSHP*
Ga0105249_131735851	3300009553	Switchgrass Rhizosphere	WRPDRVHDQVRTIDFDELPTHFDPYLKGLVRGRTVVRIAPDTHGG*
Ga0116147_12933352	3300009667	Anaerobic Digestor Sludge	RTIDFEELPTHFDAYLKGMVRGRTVVRVGRDTHP*
Ga0134065_102305791	3300010326	Grasslands Soil	VLTIDFDELPTHFDSYIKGTVRGRTVVRIGADSHP*
Ga0134121_119436142	3300010401	Terrestrial Soil	VHDQVRTIDFDELPTHFEPYLKGMVRGRTVVRIAPDTHP*
Ga0105246_106645661	3300011119	Miscanthus Rhizosphere	VEWRPDRVHDEVRTIDFDELPTHFDACLKGMVRGRTVVRVAADTHP*
Ga0136619_100840982	3300012185	Polar Desert Sand	PDSVHDQVRTIDFDELPTHFDAYIKGLVRGRTVVRIAPDTHGG*
Ga0137382_100379031	3300012200	Vadose Zone Soil	KVVTIDFTDLPTHFDAFLKGMVRGRTVVRVGADIAGL*
Ga0137365_110785942	3300012201	Vadose Zone Soil	AWRPDRVHDQVRTIDFEDLPMHFDAYIKGLVRGRTVVRIGADTHP*
Ga0137381_100525471	3300012207	Vadose Zone Soil	LAVDWRPDRVHDQVHTIDFEDLPMHFDAYLKGLVRGRTVVRIGPDSHP*
Ga0137378_114331831	3300012210	Vadose Zone Soil	TRVQSKVVTIDFADLPTHFDAFLKGMVRGRTVVRVGADIAGL*
Ga0137372_100957661	3300012350	Vadose Zone Soil	DWRPDRVHDQVHTIDFEDLPMHFDAYLKGLVRGRTVVRIGPDSHP*
Ga0137367_108844361	3300012353	Vadose Zone Soil	QVRTIDFEELPLHFDAYLKGTVRGRTVVRVAPDTHP*
Ga0137366_100958491	3300012354	Vadose Zone Soil	PDRVHDQVHTIDFEDLPMHFDAYLKGLVRGRTVVRIGPDSHP*
Ga0136635_103171382	3300012530	Polar Desert Sand	VHDQVRTIDFDELPTHFDAYIKGLVRGRTVVRIAPDTHGG*
Ga0164301_106833642	3300012960	Soil	DEVRTIDFDELPTHFDAYLKGMVRGRTVVRVAADTHP*
Ga0134076_101965132	3300012976	Grasslands Soil	WRPDSVHDQVRTIDFEDLPMHFDAYIKGLVRGRTVVRIGADTHP*
Ga0157374_123674022	3300013296	Miscanthus Rhizosphere	PDRVHDQVRTIDFDELPTHFDPYLKGMVRGRTVVRIAPDTHP*
Ga0157375_111193792	3300013308	Miscanthus Rhizosphere	QVRTIDFEDLPTHFDAYLKGMVRGRTVVRIGPDSHP*
Ga0134079_104507942	3300014166	Grasslands Soil	RPSRVQARVVTIDFADLPMHFDAFLKGTVRCRTVVRVGADTAGL*
Ga0075345_10525351	3300014312	Natural And Restored Wetlands	DRVHDQVRTIDFDDLPTHFDPYIKGMVRGRTVVRIAPDSHP*
Ga0075355_10237571	3300014322	Natural And Restored Wetlands	TIDFDDLPTHFDPYLKGLVRGRTVVRIAPDSHGG*
Ga0075356_12179131	3300014323	Natural And Restored Wetlands	QVRTIDFDELPTHFDAYIKGLVRGRTVVKIAADPVGL*
Ga0163163_101772132	3300014325	Switchgrass Rhizosphere	VHDQVRTIDFDELPTHFDPFLKGMVRGRTVVRIAPDTHP*
Ga0163163_106867292	3300014325	Switchgrass Rhizosphere	HDQVRTIDFDELPEHFDAYIKGMVRGRMVVRIGADSHP*
Ga0163163_117972401	3300014325	Switchgrass Rhizosphere	RVHDQVRTIDFDELPTHFDPYIKGMVRGRTVVRIAPDTHP*
Ga0167639_10139781	3300015080	Glacier Forefield Soil	RAQANVVTIDFADLPTHFDAFLKGMVRGRTVVRVGADIAGL*
Ga0167668_10917741	3300015193	Glacier Forefield Soil	NEWRPTRVQSKVVTIDFADLPTHFDAFLKGMVRGRTVVRVGADIAGL*
Ga0132257_1045161952	3300015373	Arabidopsis Rhizosphere	RLANEWRPSRVQARVVTIDFADLPTHFDAFLKGTVRCRTVVRVGADTAGL*
Ga0132255_1003516942	3300015374	Arabidopsis Rhizosphere	VHDEVRTIDFDELPTHFDAYLKGMVRGRTVVRVAADTHP*
Ga0187825_104082942	3300017930	Freshwater Sediment	WRPDRVHDKVATIDFDELPMHFDAYLKGMARGRTVVRVGADTHP
Ga0187777_101954942	3300017974	Tropical Peatland	RTIDFAELPTHFDPYLKGLVRGRTVVRIAPDSHGG
Ga0184618_102731131	3300018071	Groundwater Sediment	WRPTRVQSKVVTIDFADLPTHFDAFLKGMVRGRTVVRVGADIAGL
Ga0190272_113983032	3300018429	Soil	WRPDRVHDQVRTIDFEELPTHFDAYLKGMVRGRTVVRIGPDSHP
Ga0066667_119574972	3300018433	Grasslands Soil	VHDQVRTIDFEDLPMHFDAYIKGLVRGRTVVRIGADTHP
Ga0066667_120150412	3300018433	Grasslands Soil	QVLTIDFDELPTHFDSYIKGTVRGRTVVRIGADSHP
Ga0190274_118917401	3300018476	Soil	RVHDQVRTIDFDELPTHFDPFLKGMVRGRTVVRVGSDSHP
Ga0066669_120704431	3300018482	Grasslands Soil	RPDRVHDQVLTIDFDELPTHFDSYIKGTVRGRTVVRIGADTHP
Ga0206356_118255371	3300020070	Corn, Switchgrass And Miscanthus Rhizosphere	HDMVRTIDFDELPHNFDAYLKGMARGRTVVRVGADTHP
Ga0208848_11192052	3300025509	Arctic Peat Soil	TRVQSKVVTIDFADLPTHFDAFLKGMVRGRTVVRVGADTAGL
Ga0207680_110549352	3300025903	Switchgrass Rhizosphere	RVHDQVRTIDFDELPTHFDPFLKGMVRGRTVVRIAPDSHP
Ga0207654_108547632	3300025911	Corn Rhizosphere	KLAVDWRPDRVHDKVATIDFEDLPTHFDAYLKGMARGRTVVRVGADTHP
Ga0207693_101301092	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	NRLAVEWRPDRVHDKVSTIDFDELPMHFDAYLKGMARGRTVVRVAADSHP
Ga0207663_104231351	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	PSRVQARVVTIDFADLPTHFDAFLKGTVRGRTVVRVGADTAGL
Ga0207663_116537321	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	VATIDFEDLPTHFDAYLKGMARGRTVVRVGADTHP
Ga0207660_105188042	3300025917	Corn Rhizosphere	WRPDRVHDEVRTIDFDELPTHFDAYLKGMARGRTVVRVGADTHP
Ga0207649_100590913	3300025920	Corn Rhizosphere	RVHDEVRTIDFDELPTHFDAYLKGMVRGRTVVRVAADTHP
Ga0207659_101982412	3300025926	Miscanthus Rhizosphere	VRTIDFDELPTHFDAYLKGMARGRTVVRVGADTHP
Ga0207690_103711792	3300025932	Corn Rhizosphere	KLAVEWRPDRVHDKVATIDFDELPMHFDAYLKGMARGRTVVRVGADSHP
Ga0207706_113920671	3300025933	Corn Rhizosphere	LAVVWRPDRVHDQVRTIDFDELPTHFDAYLKGMVRGRTVVRVGHDTHP
Ga0207706_116048801	3300025933	Corn Rhizosphere	NKLAVEWRPDRVHDQVRTIDFDELPTHFDPYLKGMVPGRTVVRIAPDTHP
Ga0207686_112227811	3300025934	Miscanthus Rhizosphere	EWRPDRVHDEVRTIDFDELPTHFDAYLKGMVRGRTVVRVAADTHP
Ga0207651_100367413	3300025960	Switchgrass Rhizosphere	PDRVHDEVRTIDFDELPTHFDAYLKGMVRGRTVVRVAADTHP
Ga0207712_108579142	3300025961	Switchgrass Rhizosphere	QARVVTIDFADLPTHFDAFLKGTVRCRTVVRVGADTAGL
Ga0207668_104759772	3300025972	Switchgrass Rhizosphere	VRTIDFEDLPTHFDSYLKGMVRGRTVVRVGADTHP
Ga0207640_112261051	3300025981	Corn Rhizosphere	RVHDQVRTIDFDELPTHFDPYLKGLVRGRTVVRIAPDTHGG
Ga0207658_104614151	3300025986	Switchgrass Rhizosphere	AVKWRPDRVHDQVRTIDFDELPEHFDAYLKGMARGRTVVRIGADTHP
Ga0207658_108930492	3300025986	Switchgrass Rhizosphere	QARVVTIDFADLPTHFDAFLKGTVRGRTVVRVGADTAGL
Ga0207658_114625322	3300025986	Switchgrass Rhizosphere	WRPDRVHDQVRTIDFEELPTHFDPYLKGLVRGRTVVRVAPDSHGG
Ga0208541_10266112	3300026061	Natural And Restored Wetlands	WRPDRVHDQVRTIDFDDLPTHFDPYIKGMVRGRTVVRIAPDSHP
Ga0207678_105070622	3300026067	Corn Rhizosphere	ANEWRPSRVQARVVTIDFADLPTHFDAFLKGTVRCRTVVRVGADTAGL
Ga0207702_104852722	3300026078	Corn Rhizosphere	DQVHDQVRTIDFDELPTHFDAYLKGTVRGRTVVRIAADTHP
Ga0207641_101072811	3300026088	Switchgrass Rhizosphere	VHDQVRTIDFDELPTHFDPYLKGMVRGRTVVRIAPDTHP
Ga0207641_105260221	3300026088	Switchgrass Rhizosphere	VHDQVRTIDFDELPTHFDPYLKGLVRGRTVVRIAPDTHGG
Ga0207676_107437631	3300026095	Switchgrass Rhizosphere	DQVRTIDFDELPEHFDAYIKGMVRGRMVVRIGADSHP
Ga0207675_1011622422	3300026118	Switchgrass Rhizosphere	LWDRLANEWRPSRVQARVVTIDFADLPTHFDAFLKGTVRCRTVVRVGADTAGL
Ga0207698_104539821	3300026142	Corn Rhizosphere	QWRPDVVHDQVRTIDFADLPTHFDAYLKGMVRGRTVVKIGSDPVGL
Ga0209647_10526161	3300026319	Grasslands Soil	LAVEWRPDRVHDLVRTIDFDELPTHFDPYLKGLVRGRTVVRIASDTHP
Ga0209152_103109502	3300026325	Soil	AWRPDRVHDQVRTIDFEDLPTHFDAYIKGLVRGRTVVRIGADTHP
Ga0209178_11698532	3300027725	Agricultural Soil	EWRPDRVHDEVRTIDFEELPTHFDAYLKGMARGRTVVRVGADSHP
Ga0209254_103350852	3300027897	Freshwater Lake Sediment	DRVHDQVRTIDFEDLPTHFDAYLKGMVRGRTVVRIGRDPHP
Ga0268264_101015973	3300028381	Switchgrass Rhizosphere	QVRTIDFEELPTHFDPYLKGLVRGRTVVRVAPDSHGG
Ga0247828_100945891	3300028587	Soil	EVRTIDFDELPTHFDAYLKGMARGRTVVRVGADTHP
Ga0302264_11824372	3300028732	Fen	PDRVHDLVRTIDFDDLPTHFDPYLKGLVRGRTVVRIAPDSHGG
Ga0302208_101386561	3300028774	Fen	AVEWRPDRVHDLVRTIDFDDLPTHFDPYLKGLVRGRTVVRIAPDSHGG
Ga0307503_102866741	3300028802	Soil	LVRTIDFDELPTHFDAYLKGLVRGRTVVRIAPDTHGG
Ga0302259_10840012	3300028861	Fen	LVRTIDFDDLPTHFDPYLKGLVRGRTVVRIAPDSHGG
Ga0311333_105682182	3300030114	Fen	RPDRVHDLVRTIDFDELPTHFDPFLKGLVRGRTVVRIAPDTHGG
Ga0311360_107170531	3300030339	Bog	DRVHDLVRTIDFDDLPTHFDPYLKGLVRGRTVVRIAPDSHGG
Ga0307501_100183152	3300031152	Soil	PDRVHDQVLTIDFDELPTHFDSYIKGTVRGRTVVRIGADSHP
Ga0265339_103420191	3300031249	Rhizosphere	DKVHDQVRTIDFDDLPTHFDPYLKGMVRGRTVVRIAPDTHP
Ga0311364_118680732	3300031521	Fen	LAVEWRPDRVHDLVRTIDFEELPTHFDPYLKGLVRGRTVVRIAPDSHGG
Ga0318515_104813062	3300031572	Soil	QVRTIDFEDLPTHFDPYLKGMVRGRTVVRIAPDTHP
Ga0307469_105070401	3300031720	Hardwood Forest Soil	EWRPDRVHDQVRTIDFEDLPTHFDPYLKGMVRGRTVVRIAPDTHP
Ga0302321_1001787721	3300031726	Fen	VEWRPDRVHDLVRTIDFDDLPTHFDPYLKGLVRGRTVVRIAPDSHGG
Ga0302321_1004281541	3300031726	Fen	VRTIDFDDLPTHFDPYLKGLVRGRTVVRIAPDSHGG
Ga0307405_102533522	3300031731	Rhizosphere	QVHDQVRTIDFDELPTHFDTYLKGMVRGRTVVRIGSDSHP
Ga0318501_105228531	3300031736	Soil	VHDQARTIDFVDLPTHFDAYLKGLVRGRTVVRIGADTHP
Ga0318503_100463642	3300031794	Soil	HVHDLARTIDFIDLPTHFDAYLKGLVRGRTVVRIGADTHP
Ga0315290_101985062	3300031834	Sediment	RTIDFADLPTHFDAYIKGLVRGRTVVKIAADPVGL
Ga0315290_108697492	3300031834	Sediment	EWRPDRVHDQVRTIDFEDLPTHFDPYIKGMVRGRTVVRIGPDSHP
Ga0315290_117289441	3300031834	Sediment	EWRPDRVHDQVRTIDFDDLPTHFDPYLKGMVRGRTVVRIAPDTHP
Ga0315297_112503151	3300031873	Sediment	WRPDRVHDQVRTIDFDDLPTHFDPYLKGMVRGRTVVRIAPDSHP
Ga0315285_105470491	3300031885	Sediment	QVRTIDFEDLPTHFDPYIKGMVRGRTVVRIAPDSHP
Ga0311367_117947491	3300031918	Fen	EWRPDRVHDLVRTIDFDDLPTHFDPYLKGLVRGRTVVRIAPDSHGG
Ga0307416_1034920152	3300032002	Rhizosphere	QVRTIDFDELPTHFDAYLKGMVRGRTVVRIGPDTHP
Ga0310902_102346152	3300032012	Soil	VRTIDFDELPTHFDAYLKGMVRGRTVVRVAADTHP
Ga0310899_100494262	3300032017	Soil	RPDRVHDEVRTIDFDELPTHFDAYLKGMARGRTVVRVGADTHP
Ga0315272_102022321	3300032018	Sediment	WRPDQVHDQVRTIDFGDLPTHFDAYIKGLVRGRTVVKIAADPVGL
Ga0318570_104522882	3300032054	Soil	RVQSKVRTIDFAELPTHFDAFLKGMVRGRTVVRIGADPVGN
Ga0315292_102537841	3300032143	Sediment	AVEWRPDRVHDQVRTIDFDDLPTHFDPYLKGMVRGRTVVRIAPDSHP
Ga0315292_105977821	3300032143	Sediment	PDRVHDQVRTIDFEDLPTHFDPYIKGMVRGRTVVRIAPDSHP
Ga0315276_100843481	3300032177	Sediment	VRTIDFDDLPTHFDPYLKGMVRGRTVVRIAPDTHP
Ga0315276_114221821	3300032177	Sediment	NKLAVEWRPDRVHDQVRTIDFEDLPTHFDPYIKGMVRGRTVVRIAPDSHP
Ga0315271_108303251	3300032256	Sediment	RPDQVHDQVRTIDFDELPTHFDAYIKGLVRGRTVVKIAADPVGL
Ga0315270_108662871	3300032275	Sediment	AVEWRPDRVHDQVRTIDFEDLPTHFDPYIKGMVRGRTVVRIAPDSHP
Ga0315275_109283802	3300032401	Sediment	DWRPDKVHDQVRTIDFDELPTHFDAYIKGLVRGRTVVKIAADPVGL
Ga0315273_105878592	3300032516	Sediment	RVHDQVRTIDFEDLPTHFDPYIKGMVRGRTVVRIAPDSHP
Ga0315273_115266941	3300032516	Sediment	VEWRPDRVHDQVRTIDFEDLPTHFDPYIKGMVRGRTVVRIAPDSHP
Ga0315273_122636031	3300032516	Sediment	VHDQVRTIDFEDLPTHFDPYIKGMVRGRTVVRIAPDSHP
Ga0318519_100202211	3300033290	Soil	SHVHDLARTIDFIDLPTHFDAYLKGLVRGRTVVRIGADTHP
Ga0316605_111386321	3300033408	Soil	VHDLVRTIDFDELPTHFDPYLKGMVRGRTVVRIAPDTHP
Ga0316605_114295112	3300033408	Soil	QVRTIDFEDLPTHFDPYLKGMVRGRTVVRIAPDSHP
Ga0316625_1020720232	3300033418	Soil	VHDLVRTIDFDELPTHFDPYLKGMVRGRTVVRIGADTHP
Ga0316625_1025927662	3300033418	Soil	PDQVHDQVRTIDFDELPTHFDAYLKGLVRGRTVVKIAADPVGL
Ga0310811_102739971	3300033475	Soil	HDEVRTIDFDELPTHFDAYLKGMARGRTVVRVGADTHP
Ga0316628_1035081242	3300033513	Soil	WRPDQVHDQVRTIDFDDLPTHFEPYLKGMVRGRTVVRIAPDTHP
Ga0316617_1021983112	3300033557	Soil	PDIVHDQVRTIDFDELPTHFDAYIKGLVRGRTVVKVAADHVGL
Ga0364943_0038978_1400_1540	3300034354	Sediment	VEWRPDQVHDLVRTIDFDDLPTHFDPYIKGMVRGRTVVRIAPDTHP

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign