NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F036716

Metagenome / Metatranscriptome Family F036716

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F036716
Family Type Metagenome / Metatranscriptome
Number of Sequences 169
Average Sequence Length 96 residues
Representative Sequence MDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF
Number of Associated Samples 146
Number of Associated Scaffolds 169

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 4.79 %
% of genes near scaffold ends (potentially truncated) 39.64 %
% of genes from short scaffolds (< 2000 bps) 78.11 %
Associated GOLD sequencing projects 121
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (57.988 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(29.586 % of family members)
Environment Ontology (ENVO) Unclassified
(66.864 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(75.740 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 12.87%    β-sheet: 30.69%    Coil/Unstructured: 56.44%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 169 Family Scaffolds
PF00145DNA_methylase 14.20
PF00856SET 6.51
PF01555N6_N4_Mtase 5.33
PF04098Rad52_Rad22 5.33
PF05869Dam 1.18

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 169 Family Scaffolds
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 14.20
COG0863DNA modification methylaseReplication, recombination and repair [L] 5.33
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 5.33
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 5.33


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.27 %
UnclassifiedrootN/A4.73 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10072419All Organisms → Viruses → Predicted Viral1576Open in IMG/M
3300000115|DelMOSum2011_c10069292All Organisms → Viruses → Predicted Viral1281Open in IMG/M
3300000116|DelMOSpr2010_c10080467All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1292Open in IMG/M
3300000949|BBAY94_10057269All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1081Open in IMG/M
3300001460|JGI24003J15210_10033622All Organisms → Viruses → Predicted Viral1846Open in IMG/M
3300004097|Ga0055584_100341709All Organisms → Viruses → Predicted Viral1542Open in IMG/M
3300005182|Ga0069000_10096460All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium729Open in IMG/M
3300005214|Ga0069002_10194109All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium558Open in IMG/M
3300005215|Ga0069001_10101540All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium743Open in IMG/M
3300005239|Ga0073579_1189735All Organisms → cellular organisms → Bacteria42071Open in IMG/M
3300005837|Ga0078893_10235385All Organisms → Viruses → Predicted Viral1352Open in IMG/M
3300006025|Ga0075474_10083982All Organisms → Viruses → Predicted Viral1042Open in IMG/M
3300006027|Ga0075462_10198703All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium603Open in IMG/M
3300006400|Ga0075503_1696558All Organisms → Viruses → Predicted Viral1873Open in IMG/M
3300006403|Ga0075514_1073529All Organisms → Viruses → Predicted Viral1549Open in IMG/M
3300006405|Ga0075510_10049843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1211Open in IMG/M
3300006735|Ga0098038_1026265All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium2193Open in IMG/M
3300006735|Ga0098038_1091877All Organisms → Viruses → Predicted Viral1054Open in IMG/M
3300006752|Ga0098048_1051425All Organisms → Viruses → Predicted Viral1294Open in IMG/M
3300006802|Ga0070749_10620222All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium582Open in IMG/M
3300006803|Ga0075467_10179978All Organisms → Viruses → Predicted Viral1191Open in IMG/M
3300006810|Ga0070754_10167387All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1041Open in IMG/M
3300006867|Ga0075476_10269374All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium603Open in IMG/M
3300006868|Ga0075481_10053953All Organisms → Viruses → Predicted Viral1534Open in IMG/M
3300006919|Ga0070746_10453271All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium569Open in IMG/M
3300006920|Ga0070748_1243290All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium649Open in IMG/M
3300006921|Ga0098060_1010612Not Available3009Open in IMG/M
3300006925|Ga0098050_1014235All Organisms → Viruses → Predicted Viral2276Open in IMG/M
3300006925|Ga0098050_1108116All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium709Open in IMG/M
3300006929|Ga0098036_1003885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium5164Open in IMG/M
3300007236|Ga0075463_10143783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium770Open in IMG/M
3300007344|Ga0070745_1053531All Organisms → Viruses → Predicted Viral1655Open in IMG/M
3300007623|Ga0102948_1130169All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium770Open in IMG/M
3300007725|Ga0102951_1035547All Organisms → Viruses → Predicted Viral1514Open in IMG/M
3300007778|Ga0102954_1018094All Organisms → Viruses → Predicted Viral1967Open in IMG/M
3300007963|Ga0110931_1040124All Organisms → Viruses → Predicted Viral1415Open in IMG/M
3300008050|Ga0098052_1084218All Organisms → Viruses → Predicted Viral1314Open in IMG/M
3300009000|Ga0102960_1115353All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium975Open in IMG/M
3300009001|Ga0102963_1018267All Organisms → Viruses → Predicted Viral2960Open in IMG/M
3300009074|Ga0115549_1192080All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium653Open in IMG/M
3300009077|Ga0115552_1384008All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium555Open in IMG/M
3300009079|Ga0102814_10488108All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium671Open in IMG/M
3300009124|Ga0118687_10023651All Organisms → Viruses → Predicted Viral2014Open in IMG/M
3300009423|Ga0115548_1064147All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1266Open in IMG/M
3300009426|Ga0115547_1174623All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium682Open in IMG/M
3300009433|Ga0115545_1133414All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium876Open in IMG/M
3300009433|Ga0115545_1179614All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium728Open in IMG/M
3300009434|Ga0115562_1150399All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium868Open in IMG/M
3300009437|Ga0115556_1117244All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1004Open in IMG/M
3300009443|Ga0115557_1202367All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium777Open in IMG/M
3300009445|Ga0115553_1090194All Organisms → Viruses → Predicted Viral1320Open in IMG/M
3300009447|Ga0115560_1282250All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium633Open in IMG/M
3300009449|Ga0115558_1184301All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium867Open in IMG/M
3300009498|Ga0115568_10050634All Organisms → Viruses → Predicted Viral2193Open in IMG/M
3300009507|Ga0115572_10418251All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium749Open in IMG/M
3300009508|Ga0115567_10079460All Organisms → Viruses → Predicted Viral2343Open in IMG/M
3300009515|Ga0129286_10014897All Organisms → Viruses → Predicted Viral1789Open in IMG/M
3300010148|Ga0098043_1122581All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium748Open in IMG/M
3300010297|Ga0129345_1038847All Organisms → Viruses → Predicted Viral1842Open in IMG/M
3300010392|Ga0118731_111360241All Organisms → Viruses → Predicted Viral2236Open in IMG/M
3300010430|Ga0118733_100881375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1786Open in IMG/M
3300011127|Ga0151665_1002947All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium636Open in IMG/M
3300011254|Ga0151675_1100190Not Available676Open in IMG/M
3300011258|Ga0151677_1095628All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium544Open in IMG/M
3300012525|Ga0129353_1437429All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium584Open in IMG/M
3300012528|Ga0129352_10608910All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium778Open in IMG/M
3300017706|Ga0181377_1008662All Organisms → Viruses → Predicted Viral2531Open in IMG/M
3300017713|Ga0181391_1042152All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1092Open in IMG/M
3300017714|Ga0181412_1153288All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium518Open in IMG/M
3300017741|Ga0181421_1104097All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.739Open in IMG/M
3300017742|Ga0181399_1170001All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium519Open in IMG/M
3300017758|Ga0181409_1212123All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium556Open in IMG/M
3300017772|Ga0181430_1061913All Organisms → Viruses → Predicted Viral1147Open in IMG/M
3300017950|Ga0181607_10638692All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium557Open in IMG/M
3300019700|Ga0194006_1046030All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium535Open in IMG/M
3300019723|Ga0194004_1033625All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium644Open in IMG/M
3300019751|Ga0194029_1008405All Organisms → Viruses → Predicted Viral1441Open in IMG/M
3300019765|Ga0194024_1081337All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium732Open in IMG/M
3300019938|Ga0194032_1034833All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium528Open in IMG/M
3300020178|Ga0181599_1016624All Organisms → Viruses → Predicted Viral4506Open in IMG/M
3300020421|Ga0211653_10244858All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium782Open in IMG/M
3300020438|Ga0211576_10081002All Organisms → Viruses → Predicted Viral1810Open in IMG/M
3300021347|Ga0213862_10000089All Organisms → cellular organisms → Bacteria34710Open in IMG/M
3300021365|Ga0206123_10115654All Organisms → Viruses → Predicted Viral1262Open in IMG/M
3300021375|Ga0213869_10031453All Organisms → cellular organisms → Bacteria2888Open in IMG/M
3300021378|Ga0213861_10052275All Organisms → Viruses → Predicted Viral2617Open in IMG/M
3300021957|Ga0222717_10029174All Organisms → cellular organisms → Bacteria3656Open in IMG/M
3300021958|Ga0222718_10050997All Organisms → Viruses → Predicted Viral2627Open in IMG/M
3300021958|Ga0222718_10052643All Organisms → Viruses → Predicted Viral2574Open in IMG/M
3300021958|Ga0222718_10075475All Organisms → Viruses → Predicted Viral2047Open in IMG/M
3300021959|Ga0222716_10112761All Organisms → Viruses → Predicted Viral1822Open in IMG/M
3300021960|Ga0222715_10021847All Organisms → Viruses → Predicted Viral4771Open in IMG/M
3300021964|Ga0222719_10070800All Organisms → Viruses → Predicted Viral2608Open in IMG/M
3300021964|Ga0222719_10817322Not Available510Open in IMG/M
3300022050|Ga0196883_1002274All Organisms → cellular organisms → Bacteria2173Open in IMG/M
3300022057|Ga0212025_1019469All Organisms → Viruses → Predicted Viral1091Open in IMG/M
3300022065|Ga0212024_1022928All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1028Open in IMG/M
3300022067|Ga0196895_1003017All Organisms → Viruses → Predicted Viral1744Open in IMG/M
3300022067|Ga0196895_1008490All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1100Open in IMG/M
3300022069|Ga0212026_1022334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium900Open in IMG/M
3300022071|Ga0212028_1006421All Organisms → Viruses → Predicted Viral1731Open in IMG/M
3300022072|Ga0196889_1077169All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium623Open in IMG/M
3300022072|Ga0196889_1080043All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium609Open in IMG/M
3300022158|Ga0196897_1002000All Organisms → Viruses → Predicted Viral2590Open in IMG/M
3300022158|Ga0196897_1019824All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium822Open in IMG/M
3300022158|Ga0196897_1035865All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium594Open in IMG/M
3300022159|Ga0196893_1014788All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium701Open in IMG/M
3300022183|Ga0196891_1053260All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium733Open in IMG/M
3300022206|Ga0224499_10266569All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium581Open in IMG/M
3300022208|Ga0224495_10145240All Organisms → Viruses → Predicted Viral1016Open in IMG/M
3300022217|Ga0224514_10094510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1026Open in IMG/M
3300022306|Ga0224509_10103233All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium992Open in IMG/M
(restricted) 3300022938|Ga0233409_10256554All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium602Open in IMG/M
(restricted) 3300023112|Ga0233411_10351323All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium500Open in IMG/M
(restricted) 3300024340|Ga0255042_10142854All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium709Open in IMG/M
3300024346|Ga0244775_10340693All Organisms → Viruses → Predicted Viral1239Open in IMG/M
(restricted) 3300024519|Ga0255046_10268442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium791Open in IMG/M
(restricted) 3300024519|Ga0255046_10425987All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium632Open in IMG/M
(restricted) 3300024520|Ga0255047_10705911All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium504Open in IMG/M
(restricted) 3300024529|Ga0255044_10028368All Organisms → Viruses → Predicted Viral1704Open in IMG/M
3300025070|Ga0208667_1004326All Organisms → Viruses → Predicted Viral4043Open in IMG/M
3300025070|Ga0208667_1024363All Organisms → Viruses → Predicted Viral1139Open in IMG/M
3300025120|Ga0209535_1040766All Organisms → Viruses → Predicted Viral2078Open in IMG/M
3300025128|Ga0208919_1023563All Organisms → Viruses → Predicted Viral2285Open in IMG/M
3300025133|Ga0208299_1212470All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium566Open in IMG/M
3300025543|Ga0208303_1049288All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1030Open in IMG/M
3300025590|Ga0209195_1088598All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium701Open in IMG/M
3300025610|Ga0208149_1015734All Organisms → Viruses → Predicted Viral2209Open in IMG/M
3300025610|Ga0208149_1039737All Organisms → Viruses → Predicted Viral1253Open in IMG/M
3300025645|Ga0208643_1019290All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium2413Open in IMG/M
3300025645|Ga0208643_1043632All Organisms → Viruses → Predicted Viral1410Open in IMG/M
3300025645|Ga0208643_1122175All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium689Open in IMG/M
3300025652|Ga0208134_1056917All Organisms → Viruses → Predicted Viral1214Open in IMG/M
3300025653|Ga0208428_1020058All Organisms → Viruses → Predicted Viral2211Open in IMG/M
3300025653|Ga0208428_1166496All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium582Open in IMG/M
3300025671|Ga0208898_1182837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium527Open in IMG/M
3300025769|Ga0208767_1106606All Organisms → cellular organisms → Bacteria1108Open in IMG/M
3300025769|Ga0208767_1221416All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium617Open in IMG/M
3300025815|Ga0208785_1017754Not Available2389Open in IMG/M
3300025815|Ga0208785_1048647All Organisms → Viruses → Predicted Viral1195Open in IMG/M
3300025816|Ga0209193_1125430All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium617Open in IMG/M
3300025828|Ga0208547_1019897All Organisms → Viruses → Predicted Viral2737Open in IMG/M
3300025828|Ga0208547_1167174All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium616Open in IMG/M
3300025830|Ga0209832_1143799All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium709Open in IMG/M
3300025881|Ga0209309_10195810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium981Open in IMG/M
3300025890|Ga0209631_10322673All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium739Open in IMG/M
3300025894|Ga0209335_10243478All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium796Open in IMG/M
3300026125|Ga0209962_1065457Not Available595Open in IMG/M
3300026130|Ga0209961_1048512All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium833Open in IMG/M
3300026138|Ga0209951_1043099All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium977Open in IMG/M
3300026183|Ga0209932_1017731All Organisms → Viruses → Predicted Viral1883Open in IMG/M
3300026187|Ga0209929_1007487All Organisms → Viruses → Predicted Viral3646Open in IMG/M
3300026187|Ga0209929_1165601Not Available531Open in IMG/M
(restricted) 3300027837|Ga0255041_10315745All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium567Open in IMG/M
(restricted) 3300027856|Ga0255054_10212636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium948Open in IMG/M
3300027917|Ga0209536_101295865All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium891Open in IMG/M
(restricted) 3300027996|Ga0233413_10143987All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium983Open in IMG/M
3300028196|Ga0257114_1048898All Organisms → cellular organisms → Bacteria1882Open in IMG/M
3300028599|Ga0265309_10977134All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium584Open in IMG/M
3300031851|Ga0315320_10052948All Organisms → Viruses → Predicted Viral3162Open in IMG/M
3300031851|Ga0315320_10332796All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1073Open in IMG/M
3300032136|Ga0316201_10045121All Organisms → cellular organisms → Bacteria3822Open in IMG/M
3300032255|Ga0316209_1021859All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium2486Open in IMG/M
3300034374|Ga0348335_047151All Organisms → Viruses → Predicted Viral1697Open in IMG/M
3300034374|Ga0348335_080290All Organisms → cellular organisms → Bacteria1101Open in IMG/M
3300034375|Ga0348336_064420All Organisms → Viruses → Predicted Viral1413Open in IMG/M
3300034375|Ga0348336_195895All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium544Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous29.59%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine11.24%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine10.65%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater6.51%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water4.73%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water3.55%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater2.96%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water2.96%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment2.37%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.78%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.78%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.78%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.78%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.78%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.78%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.78%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment1.18%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.18%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.18%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment1.18%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.59%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.59%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.59%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.59%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.59%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.59%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow0.59%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water0.59%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.59%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.59%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.59%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.59%
SedimentEnvironmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment0.59%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.59%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005182Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordA_D2EnvironmentalOpen in IMG/M
3300005214Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordC_D2EnvironmentalOpen in IMG/M
3300005215Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordB_D2EnvironmentalOpen in IMG/M
3300005239Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of MaineEnvironmentalOpen in IMG/M
3300005837Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18EnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006400Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006405Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007623Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MGEnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300007778Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MGEnvironmentalOpen in IMG/M
3300007963Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2)EnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300009000Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MGEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009074Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300009423Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423EnvironmentalOpen in IMG/M
3300009426Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420EnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009437Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414EnvironmentalOpen in IMG/M
3300009443Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421EnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009447Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509EnvironmentalOpen in IMG/M
3300009449Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426EnvironmentalOpen in IMG/M
3300009498Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009508Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412EnvironmentalOpen in IMG/M
3300009515Microbial community of beach aquifer sediment core from Cape Shores, Lewes, Delaware, USA - CF-2EnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010297Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNAEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300011127Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_5, 0.02EnvironmentalOpen in IMG/M
3300011254Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02EnvironmentalOpen in IMG/M
3300011258Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeateEnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019700Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_2-3_MGEnvironmentalOpen in IMG/M
3300019723Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_0-1_MGEnvironmentalOpen in IMG/M
3300019751Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MGEnvironmentalOpen in IMG/M
3300019765Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MGEnvironmentalOpen in IMG/M
3300019938Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW8Nov16_MGEnvironmentalOpen in IMG/M
3300020178Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041405US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020421Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300021347Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022050Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3)EnvironmentalOpen in IMG/M
3300022057Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2)EnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022067Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3)EnvironmentalOpen in IMG/M
3300022069Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2)EnvironmentalOpen in IMG/M
3300022071Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2)EnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022158Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v3)EnvironmentalOpen in IMG/M
3300022159Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v3)EnvironmentalOpen in IMG/M
3300022183Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3)EnvironmentalOpen in IMG/M
3300022206Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_24EnvironmentalOpen in IMG/M
3300022208Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022217Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_24EnvironmentalOpen in IMG/M
3300022306Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24EnvironmentalOpen in IMG/M
3300022938 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MGEnvironmentalOpen in IMG/M
3300023112 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MGEnvironmentalOpen in IMG/M
3300024340 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_5EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024519 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27EnvironmentalOpen in IMG/M
3300024520 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1EnvironmentalOpen in IMG/M
3300024529 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21EnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025133Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025590Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 (SPAdes)EnvironmentalOpen in IMG/M
3300025610Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025653Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025815Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025816Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes)EnvironmentalOpen in IMG/M
3300025828Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025830Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes)EnvironmentalOpen in IMG/M
3300025881Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300025894Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes)EnvironmentalOpen in IMG/M
3300026125Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026130Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026138Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026183Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026187Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300027837 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3EnvironmentalOpen in IMG/M
3300027856 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300027996 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MGEnvironmentalOpen in IMG/M
3300028196Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10mEnvironmentalOpen in IMG/M
3300028599Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M
3300032136Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrowEnvironmentalOpen in IMG/M
3300032255Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month chalcopyriteEnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1007241933300000101MarineMDLEQVGGLFDADKLKAKLQKKFPNYNFDVPQPPDTKCKAPFYCKQNEIKYTDMEGDLYCGYRYKLTDEKNPFAWEWKVCHALLEPMDIQAKHQEDEVELF*
DelMOSum2011_1006929223300000115MarineMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGNLYCGYRYKMTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF*
DelMOSpr2010_1008046723300000116MarineMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYTDMEGNLYCGYRYKMTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF*
BBAY94_1005726923300000949Macroalgal SurfaceMDLERAGESINIEKLKARLQKRFPDYNFDIPPEPDTKCKAPFYCEQNEVKYTDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLDPVDIQAKHKEDEVELF*
JGI24003J15210_1003362253300001460MarineMDLEPVGGLFDVDKLKAKLRKKFPNHNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGNLYCGYRYKLTDEKNPFAWEYKVCHALLEPIDVQAKHKEDEVELF*
Ga0055584_10034170923300004097Pelagic MarineMALEQAGGLFDVNKLKARLKERYPEYNFDVPAPLDTKCKSPFYCKDNEIRYTDTEGNLFCGLKYKESDDKDPYKWEWKVCHALIKPVDIQTKHQKDEVELF*
Ga0069000_1009646013300005182Natural And Restored WetlandsAGSLFNLDKFKERLKKRFPDYNFDVAPPPDTRCKAPFYCSKNEIKYTDTEGNLYCGYRFKLADEKNPFRFEWKVCHALIKPVDVQEKHKEDEVELF*
Ga0069002_1019410913300005214Natural And Restored WetlandsMDLERAGSLFNVDKFKERLKKRFPDYNFDVAPPPDTRCKAPFYCSKNEIKYTDTEGNLYCGYRFKLADEKNPFSFEWKVCHALIQPVDVQEKHKEDEVELF*
Ga0069001_1010154023300005215Natural And Restored WetlandsMDLERAGSLFNLDKFKERLKKRFPDYNFDVAPPPDTRCKAPFYCSKNEIKYTDTEGNLYCGYRFKLADEKNPFSFEWKVCHALIQPVNVQEKHKEDEVELF*
Ga0073579_118973513300005239MarineMDLEQVGGLFDADKLKAKLQKKFPNYNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGDLYCGYRYKLTDEKNPFAWEWKVCHALLEPMDIQAKHQEDEVELF*
Ga0078893_1023538543300005837Marine Surface WaterMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYTDMEGNLYCGYRYKLTDEKNPFAWEWKVCHALIKPIDVQAKHKEEEVELF*
Ga0075474_1008398213300006025AqueousMALEQAGGLFDVNKLKARLKERYPEYNFDVPAPLDTKCKSPYYCKDNEIRYTDTEGNLFCGLKYKESDDKDPYKWEWKVCHALIKPVDIQTKHQKDEVELF*
Ga0075462_1019870323300006027AqueousIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYSDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLEPIDIQAKHKEDEVELF*
Ga0075503_169655823300006400AqueousMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNDIKYTDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF*
Ga0075514_107352923300006403AqueousMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCDQNEIKYTDMEGNLYCGYRYKMTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF*
Ga0075510_1004984323300006405AqueousMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYSDMEGNLYCGYRYKMTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF*
Ga0098038_102626543300006735MarineGYLGRQCRLSRRMDLERAGESINIEKLKARLQKRFPDYNFDIPPEPDTKCKAPFYCKQNDIKYTDMEGNLYCGYRYKLTDEKNPFAWEYKVCHALLEPVDVQAKHKEDEVELF*
Ga0098038_109187723300006735MarineMDLERAGESINIEKLKARLQKRFPDFNFDVPQPPDTKCKAPFYCKQNDIKYTDMEGNLYCGYRYKLTDEKNPFAWEYKVCHALLEPIDVQAKHKEDEVELF*
Ga0098048_105142523300006752MarineMDLEPVGGLFDVDKLKARLQKRFPTHNFDVPAPPDTRCKSQFYCKDNDIRYTDTDGNLYCGLRYKEADDKDPYKWEWKVCHALLKPVDIQAKHKEEEVELF*
Ga0098054_112614013300006789MarineIPPEPDTKCKAPFYCKQNDIKYTDMEGNLYCGYRYKLTDEKNPFAWEYKVCHALLEPVDVQAKHKEDEVELF*
Ga0070749_1062022213300006802AqueousNIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYSDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLKPVDIQAKHKEDEVELF*
Ga0075467_1017997813300006803AqueousVGGLFDADKLKAKLQKKFPNYNFDVPAPPDTKCKAPFYCEQNEIKYTDMEGNLYCGYRYKMTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF*
Ga0070754_1016738713300006810AqueousMALEQAGGLFDVNKLKARLKERYPEYNFDVPAPLDTKCKSPYYCKDNEIRYTDTEGNLFCGLKYKESDDKDPYKWEWKVCHALIKPVDIQTKH
Ga0075476_1026937423300006867AqueousIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYSDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLKPVDIQAKHKEDEVELF*
Ga0075481_1005395333300006868AqueousMALEQAGGLFDVNKLKARLKERYPEYNFDVPAPLDTKCKSSFYCKDNEIRYTDTEGNLFCGLKYKESDDKDPYKWEWKVCHALIKPVDIQTKHQKDEVELF*
Ga0070746_1045327113300006919AqueousNRMALEQAGGLFDVNKLKARLKERYPEYNFDVPAPLDTKCKSPYYCKDNEIRYTDTEGNLFCGLKYKESDDKDPYKWEWKVCHALIKPVDIQTKHQKDEVELF*
Ga0070748_124329023300006920AqueousMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCDQNEIKYTDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF*
Ga0098060_101061223300006921MarineMDLERAGESINIEKLKARLQKRFPDYNFDIPPEPDTKCKAPFYCKQNDIKYTDMEGNLYCGYRYKLTDEKNPFAWEYKVCHALLEPVDVQAKHKEDEVELF*
Ga0098050_101423523300006925MarineMWLGYLGRQCRLSRRMDLEPVGGLFDVDKLKARLQKRFPTHNFDVPAPPDTRCKSQFYCKDNDIRYTDTDGNLYCGLRYKEADDKDPYKWEWKVCHALLKPVDIQAKHKEEEVELF*
Ga0098050_110811623300006925MarineMDLERAGESINIEKLKARLQKRFPDYNFDIPPEPDTKCKAPFYCKQNDIKYTDMEGNLYCGYRYKLTDEKNPFAWEYKVCHALLEPIDVQAKHKEDEVELF*
Ga0098036_100388513300006929MarineMDLERAGESINIEKLKARLQKRFPDFNFDVPQPPDTKCKAPFYCKQNDIKYTDMEGNLYCGYRYKLTDEKNPFAWEYKVCHALLKPIDVQAKHKEDEVELF*
Ga0075463_1014378323300007236AqueousMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYSDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLEPIDIQAKHKEDEVELF*
Ga0070745_105353123300007344AqueousMALEQAGGLFDVNKLKARLKERYPEYNFDVPAPLDTKCKSPYYCKDNEIRYTDTEGNLFCGLKYKESDDKDPYKWEWKVCHALIKPVDIQTKHKKDEVELF*
Ga0102948_113016923300007623WaterMDLERAGSLFNLNKFKERLKKRFPDYNFDVAPPPDTRCKAPFYCSKNEIKYTDTEGNLYCGYRFKLADEKNPFRFEWKVCHALIQPVDVQEKHKEDEVELF*
Ga0102951_103554723300007725WaterMDLERAGSLFNLDKFKERLKKRFPDYNFDVAPPPDTRCKAPFYCSKNEIKYTDTEGNLYCGYRFKLADEKNPFSFEWKVCHALIQPVDVQEKHKEDEVELF*
Ga0102954_101809433300007778WaterMDLERAGSLFNLDKFKERLKKRFPDYNFDVAPPPDTRCKAPFYCSKNEIKYTDTEGNLYCGYRFKLADEKNPFRFEWKVCHALIQPVNVQEKHKEDEVELF*
Ga0110931_104012413300007963MarineMDLERAGESINIEKLKARLQKRFPNYNFDIPPEPDTKCKAPFYCKQNDIKYTDMEGNLYCGYRYKLTDEKNPFAWEYKVCHALLEPIDVQAKHKEDEVELF*
Ga0098052_108421843300008050MarineLGYLGRQCRLSRRMDLERAGVSINIEKLKARLQKRFPDFNFDVPQPPDTKCKAPFYCKQNDIKYTDMEGNLYCGYRYKLTDEKNPFAWEYKVCHALLEPIDVQAKHKEDEVELF*
Ga0102960_111535333300009000Pond WaterMDLEPVGNLFDADKLKAKLQKKFPDYNFDVPAPPDTKCKAPYYCKQNEIKYTDMEGNLYCGYRYKLTDEKTPFIWEWKVCHALLDPVDIQAKHKEDEVELF*
Ga0102963_101826743300009001Pond WaterMDLEPVGNLFDADKLKAKLQKKFPDYNFDVPAPPDTKCKAPYYCKQNEIKYTDMEGNLYCGYRYKLTDEKTPFIWEWKVCHALLEPVDIQAKHKEDEVELF*
Ga0115549_119208023300009074Pelagic MarineMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYTDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF*
Ga0115552_138400813300009077Pelagic MarineLQKKFPNYNFDLPQPPDTKCKAPFYCKQNEIKYTDMEGDLYCGYRYKLTDEKNPFAWEWKVCHALLEPMDIQAKHQEDEVELF*
Ga0102814_1048810823300009079EstuarineMDLEPVGGLFDVDKLKAKLRKKFPDYNFDVAPPPDTRCKAPFYCKQNEIKYTDMEGNLYCGYRYKLTDEKNPFAWEYRVCHALLEPIDVQAKHKEDEVELF*
Ga0118687_1002365123300009124SedimentMDLERAGSLFNLDKFKERLKKRFPDYNFDVAPPPDTRCKAPFYCSKNEIKYTDTEGNLYCGYRFKLADEKNPFSFEWKVCHALIQAVDVQEKHKEDEVELF*
Ga0115548_106414723300009423Pelagic MarineMDLEPVGGLFDADKLKAKLQKKFPNYNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGDLYCGYRYKLNDEKNPFAWEWKVCHALLEPMDIQAKHQEDEVELF*
Ga0115547_117462313300009426Pelagic MarineNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGDLYCGYRYKLNDEKNPFAWEWKVCHALLEPMDIQAKHQEDEVELF*
Ga0115545_113341423300009433Pelagic MarineMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGNLYCGYRYKLTDEKNLFTWEWKVCHALLEPVDIQAKHKEDEVELF*
Ga0115545_117961423300009433Pelagic MarineMDLEQVGGLFDADKLKAKLQKKFPNYNFDVPQPPDTKCKAPFYCKQNEIKYTDMEGDLYCGYRYKLNDEKNPFAWEWKVCHALLEPMDIQAKHQEDEVELF*
Ga0115562_115039923300009434Pelagic MarineMDLEQVGGLFDADKLKAKLQKKFPNYNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGDLYCGYRYKLNDEKNPFAWEWKVCHALLEPMDIQAKHQEDEVELF*
Ga0115556_111724423300009437Pelagic MarineMDLERAEESINIEKRKARLQKRFPDYTFDVPAPPDTKCKAPFYCDQNEIKYTDMEGNLYCGYRYKLTDEKNLFTWEWKVCHALLEPVDIQAKHKEDEVELF*
Ga0115557_120236723300009443Pelagic MarineMDLEPVGGLFDADKLKAKLQKKFPHYNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGDLYCGYRYKLNDEKNPFAWEWKVCHALLEPMDIQAKHQEDEVELF*
Ga0115553_109019423300009445Pelagic MarineMDLEPVGGLFDADKLKAKLQKKFPNYNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGDLYCGYRYKLTDEKNPFAWEWKVCHALLEPMDIQAKHQEDEVELF*
Ga0115560_128225023300009447Pelagic MarineFPNYNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGDLYCGYRYKLTDEKNPFAWEWKVCHALLEPMDIQAKHQEDEVELF*
Ga0115558_118430123300009449Pelagic MarineMDLEQVGGLFDADKLKAKLQKKFPNYNFDVPQPPDTKCKAPFYCEQNEIKYTDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLEPMDIQAKHQEDEVELF*
Ga0115568_1005063413300009498Pelagic MarineMDLEPVGGLFDADKLKAKLQKKFPNYNFDVPQPPDTKCKAPFYCKQNEIKYTDMEGDLYCGYRYKLNDEKNPFAWEWKVCHALLEPMDIQAKHQEDEVELF*
Ga0115572_1041825123300009507Pelagic MarineMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYTDMEGNLYCGYRYKLTDEKNLFTWEWKVCHALLEPVDIQAKHKED
Ga0115567_1007946053300009508Pelagic MarineMDLEPVGGLFDADKLKAKLQKKFPNYNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGDLYCGYRYKLTDEKNPFAWEWKVCHALLEPMDIQAKYQEDEVELF*
Ga0129286_1001489743300009515SedimentMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF*
Ga0098043_112258113300010148MarineRFPDFNFDVPQPPDTKCKAPFYCKQNDIKYTDMEGNLYCGYRYKLTDEKNPFAWEYKVCHALLEPIDVQAKHKEDEVELF*
Ga0129345_103884713300010297Freshwater To Marine Saline GradientMDLERAGESINIDKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGNLYCGYRYKMTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF*
Ga0118731_11136024123300010392MarineMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGDLYCGYRYKLTDEKNPFAWEWKVCHALLEPMDIQAKHQEDEVELF*
Ga0118733_10088137523300010430Marine SedimentMDLEQVGGLFDADKLKAKLQKKFPNYNFDVPQPPDTKCKAPFYCKQNEIKYTDMEGDLYCGYRYKLSDEKNPFAWEWKVCHALLEPMDIQAKHQEDEVELF*
Ga0151665_100294723300011127MarineRMALEQAGQSLNIKKLKEKLQKRFPQHNFDVAPKPDTRCKAPYFCKDNTIKYTDVEGNTFCGLRYKETDDKDPYRWEYKVCHALIKPVDIQAKQKEDEVELF*
Ga0151675_110019013300011254MarineMDLERAGSLFNLDKFKERLKKRFPDYNFDVAPPPDTRCKAPYYYSKNEIKYTDTEGNLYCGYRFKLADEKNPFSFEWKVCHALIQPVNVQEKHKEDEVELF*
Ga0151677_109562823300011258MarineKKRFPDYNFDVEPPPDTRCKAPYYCSKNEIKYTDKEGNLYCGYRFKLADEKNPFSFEWKVCHALIQSVNVQEINKEDE*
Ga0129353_143742913300012525AqueousGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGNLYCGYRYKMTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF*
Ga0129352_1060891023300012528AqueousVAIDDGISINVEKLKAKLQEKYPNHNFDIPPPPDTKCKAPFYCKQNEIKYTDMEGNLYCGYRYKMTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF*
Ga0181377_100866233300017706MarineMDLERAGESINIDKLKARLQKRFPDFNFDVPQPPDTKCKAPFYCKQNDIKYTDMEGNLYCGYRYKLTDEKNPFAWEYKVCHALIKPIDVQAKHKEDEVELF
Ga0181391_104215213300017713SeawaterMDLEPVGGLFDVDKLKAKLRKKFPDHNFDVPAPPDTKCKAPFYCKQNDIKYTDMEGNLYCGYRYKLTDEKNPFAWEYKVCHALLEPIDVQAKHKEDEVELF
Ga0181412_115328813300017714SeawaterMDLERAGESINIEKLKARLQKRFPDYNFDIPPEPDTKCKAPFYCEQNEIKYTDMEGNLYCGYRYKLTDEKNPFAWEWKVCHALI
Ga0181421_110409713300017741SeawaterHNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGNLYCGYRYKLTDEKNPFAWEYRVCHALLEPIDVQAKHKEDEVELF
Ga0181399_117000113300017742SeawaterTKRMDLEPVGGLFDVDKLKAKLRKKFPDHNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGNLYCGYRYKLTDEKNPFAWEYRVCHALLEPIDVQAKHKEDEVELF
Ga0181409_121212323300017758SeawaterMDLEPVGGLFDVDKLKAKLRKKFPNHNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGNLYCGYRYKLTDEKNPFAWEYRVCHALLEPIDVQAKH
Ga0181430_106191323300017772SeawaterMDLEPVGGLFDVDKLKAKLRKKFPNHNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGNLYCGYRYKLTDEKNPFAWEYRVCHALLEP
Ga0181607_1063869213300017950Salt MarshKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYSDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLEPIDIQAKHKEDEVELF
Ga0194006_104603023300019700SedimentMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYSDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF
Ga0194004_103362523300019723SedimentMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYSDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLEPIDIQAKHKEDEVELF
Ga0194029_100840523300019751FreshwaterMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYTDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF
Ga0194024_108133723300019765FreshwaterMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYTDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLEPVNIQAKHKEDEVELF
Ga0194032_103483313300019938FreshwaterNFDVPAPPDTKCKAPFYCEQNEIKYTDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLEPIDIQAKHKEDEVELF
Ga0181599_101662413300020178Salt MarshKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYSDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLEPVDIQAKHKKDEVELF
Ga0211653_1024485823300020421MarineMDLERAGESINIEKLKARLQKRFPDYNFDIPPEPDTKCKAPFYCKQNDIKYTDMEGNLYCGYRYKLTDEKNPFAWEYKVCHALLEPIDVQAKHKEDEVELF
Ga0211576_1008100233300020438MarineMDLEPVGGLFDVDKLKAKLRKKFPNYNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGNLYCGYRYKLTDEKNPFAWEYRVCHALLEPIDVQAKHKEDEVELF
Ga0213862_10000089233300021347SeawaterMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGNLYCGYRYKMTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF
Ga0206123_1011565453300021365SeawaterLKAKLQKKFPNYNFDVPQPPDTKCKAPFYCKQNEIKYTDMEGDLYCGYRYKLTDEKNPFAWEWKVCHALLEPMDIQAKHQEDEVELF
Ga0213869_1003145333300021375SeawaterMDLEQVGGLFDADKLKAKLQKKFPNYNFDVPQPPDTKCKAPFYCKQNEIKYTDMEGDLYCGYRYKLTDEKNPFAWEWKVCHALLEPMDIQAKHQEDEVELF
Ga0213861_1005227543300021378SeawaterMDLEQVGGLFDADKLKAKLQKKFPNYNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGDLYCGYRYKLTDEKNPFAWEWKVCHALLEPMDIQAKHQEDEVELF
Ga0222717_1002917473300021957Estuarine WaterMALEQAGQSLNIKKLKEKLQKRFPQHNFDVAPKPDTRCKAPYFCKDNTIKYTDVEGNTFCGLRYKQTDDKDPYRWEYKVCHALIKPVDIQAKHKEDEVELF
Ga0222718_1005099723300021958Estuarine WaterMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYTDIEGNLYCGYRYKMTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF
Ga0222718_1005264363300021958Estuarine WaterMDLEPVGGLFDVDKLKARLQKRFPTYNFDVPAPPDTRCKSQFYCKDNDIRYTDTDGNLYCGLRYKESDDKDPYKWEWKVCHALLKPVDIQAKHKEEEVELF
Ga0222718_1007547533300021958Estuarine WaterMDLERAGESINIEKLKARLQKRFPDYNFDIPPEPDTKCKAPFYCEQNEIKYTDMEGNLYCGYRYKLTDEKNPFAWEWKVCHALIKPIDVQAKHKEEEVELF
Ga0222716_1011276133300021959Estuarine WaterMDLERAGSLFNLDKFKERLKKRFPDYNFDVAPPPDTRCKAPFYCSKNEIKYTDTEGNLYCGYRFKLADEKNPFSFEWKVCHALIQPVDVQEKHKEDEVELF
Ga0222715_1002184713300021960Estuarine WaterMDLERAGSLFNLDKFKERLKKRFPDYNFDVAPPPDTRCKAPFYCSKNEIKYTDTEGNLYCGYRFKLADEKNPFRFEWKVCHALIQPVNVQEKHKEDEVELF
Ga0222719_1007080013300021964Estuarine WaterFNLYKFKERLKKRFPEYNFDVAPPPDTRCKAPFYCSKNEIKYTDTEGNLYCGYRFKLADEKNPFSFEWKVCHALIQPVDVQEKHKEDEVELF
Ga0222719_1081732223300021964Estuarine WaterFPDYNFDVAPPPDTRCKAPFYCSKNEIKYTDTEGNLYCGYRFKLADEKNPFSFEWKVCHALIQPVDVQEKHKEDEVELF
Ga0196883_100227453300022050AqueousINIEKLKARLQKRFPHYNFDVPAPPDTKCKAPFYCEQNEIKYSDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLKPVDIQAKHKEDEVELF
Ga0212025_101946923300022057AqueousMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYTDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLKPVDIQAKHKEDEVELF
Ga0212024_102292833300022065AqueousIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYTDMEGNLYCGYRYKMTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF
Ga0196895_100301723300022067AqueousMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYSDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLKPVDIQAKHKEDEVELF
Ga0196895_100849013300022067AqueousKRFPDYNFDVPAPPDTKCKAPFYCKQNEIKYSDMEGNLYCGYRYKMTDEKNPFTWEWKVCHALLEPVNIQAKHKEDEVELF
Ga0212026_102233423300022069AqueousMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYSDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLKPVDIQ
Ga0212028_100642123300022071AqueousMALEQAGGLFDVNKLKARLKERYPEYNFDVPAPLDTKCKSSFYCKDNEIRYTDTEGNLFCGLKYKESDDKDPYKWEWKVCHALIKPVDIQTKHQKDEVELF
Ga0196889_107716923300022072AqueousHTKRMDLEQVGGLFDADKLKAKLQKKFPNYNFDVPAPPDTKCKAPFYCEQNEIKYTDMEGNLYCGYRYKMTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF
Ga0196889_108004323300022072AqueousMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYSDMEGNLYCGYRYKMTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF
Ga0196897_100200013300022158AqueousLKARLQKRFPHYNFDVPAPPDTKCKAPFYCEQNEIKYSDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLKPVDIQAKHKEDEVELF
Ga0196897_101982413300022158AqueousMDLERAGESINIEKLKARLQKRFPDYNFDVPAPLDTKCKAPFYCKQNEIKYTDMEGNLYCGYRYKMTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF
Ga0196897_103586513300022158AqueousMALEQAGGLFDVNKLKARLKERYPEYNFDVPAPLDTKCKSPYYCKDNEIRYTDTEGNLFCGLKYKESDDKDPYKWEWKVCHALIKPVDIQTKHQKDEVELF
Ga0196893_101478823300022159AqueousMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYTDMEGNLYCGYRYKMTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF
Ga0196891_105326023300022183AqueousLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYSDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLEPIDIQAKHKEDEVELF
Ga0224499_1026656923300022206SedimentMDLERAGSLFNLDKFKERLKKRFPDYNFDVAPPPDTRCKAPFYCSKNEIKYTDTEGNLYCGYRFKLADEKNPFSFEWKVCHALIQPVNVQEKHKEDEVELF
Ga0224495_1014524033300022208SedimentSLFNLDKFKERLKKRFPDYNFDVAPPPDTRCKAPFYCSKNEIKYTDTEGNLYCGYRFKLADEKNPFRFEWKVCHALIQPVNVQEKHKEDEVELF
Ga0224514_1009451023300022217SedimentMDLERAGSLFNLDKFKERLKKRFPDYNFDVAPPPDTRCKAPFYCSKNEIKYTDTEGNLYCGYRFKLADEKNPFRFEWKVCHALIQPVDVQEKHKEDEVELF
Ga0224509_1010323323300022306SedimentMDLERAGSLFNLDKFKERLKKRFPDYNFDVAPPPDTRCKAPFYCSKNEIKYTDTEGNLYCGYRFKLADEKNPFSFEWKVCHALIQAVDVQEKHKEDEVELF
(restricted) Ga0233409_1025655423300022938SeawaterMDLEPVGGLFDVDKLKAKLRKKFPNHNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGNLYCGYRYKLTDEKNPFAWEYRVCHALLEPIDVQAKHKEDEVELF
(restricted) Ga0233411_1035132323300023112SeawaterMDLEPVGGLFDVDKLKAKLRKKFPDHNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGNLYCGYRYKLTDEKNPFAWEYRVCHALLEPIDVQAKHKEDEVELF
(restricted) Ga0255042_1014285423300024340SeawaterMDLEPVGGLFDVDKLKAKLRKKFPNHNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGNLYCGYRYKLTDEKNHFAWEYKVCHALLEPIDVQAKHKEDEVELF
Ga0244775_1034069323300024346EstuarineMDLEPVGGLFDVDKLKAKLRKKFPDYNFDVAPPPDTRCKAPFYCKQNEIKYTDMEGNLYCGYRYKLTDEKNPFAWEYRVCHALLEPIDVQAKHKEDEVELF
(restricted) Ga0255046_1026844223300024519SeawaterMDLEPVGGLFDVDKLKAKLRKKFPNYNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGNLYCGYRYKLTDEKNPFAWEYKVCHALLEPIDVQAKHKEDEVELF
(restricted) Ga0255046_1042598723300024519SeawaterKEKLQKRFPQHNFDVAPKPDTRCKAPYFCKDNTIKYTDVEGNTFCGLRYKQTDDKDPYRWEYKVCHALIKPVDIQAKHKEDEVELF
(restricted) Ga0255047_1070591113300024520SeawaterMDLELVGGLFDVDKLKAKLRKKFPNHNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGNLYCGYRYKLTDEKNPFAWEYRVCHALLEPIDVQAKHKEDEVELF
(restricted) Ga0255044_1002836823300024529SeawaterMDLEPVGGLFDVDKLKAKLRKKFPDHNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGNLYCGYRYKLTDEKNPFAWEYKVCHALLEPIDVQAKHKEDEVELF
Ga0208667_100432623300025070MarineMDLERAGESINIEKLKARLQKRFPDFNFDVPQPPDTKCKAPFYCKQNDIKYTDMEGNLYCGYRYKLTDEKNPFAWEYKVCHALLEPIDVQAKHKEDEVELF
Ga0208667_102436323300025070MarineMDLEPVGGLFDVDKLKARLQKRFPTHNFDVPAPPDTRCKSQFYCKDNDIRYTDTDGNLYCGLRYKEADDKDPYKWEWKVCHALLKPVDIQAKHKEEEVELF
Ga0209535_104076653300025120MarineMDLEPVGGLFDVDKLKAKLRKKFPNHNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGNLYCGYRYKLTDEKNPFAWEYKVCHALLEPIDVQAKHKEDEVELF
Ga0208919_102356313300025128MarineMDLERAGESINIEKLKARLQKRFPDFNFDVPQPPDTKCKAPFYCKQNDIKYTDMEGNLYCGYRYKLTDEKNPFAWEYKVCHALLKPIDVQAKHKEDEVELF
Ga0208299_121247023300025133MarineERAGVSINIEKLKARLQKRFPDFNFDVPQPPDTKCKAPFYCKQNDIKYTDMEGNLYCGYRYKLTDEKNPFAWEYKVCHALLEPIDVQAKHKEDEVELF
Ga0208303_104928823300025543AqueousMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCDQNEIKYTDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF
Ga0209195_108859823300025590Pelagic MarineMDLEPVGGLFDADKLKAKLQKKFPNYNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGDLYCGYRYKLTDEKNPFAWEWKVCHALLEPMDIQAKHQEDEVELF
Ga0208149_101573413300025610AqueousFPDYNFDVPAPPDTKCKAPFYCEQNEIKYTDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLKPVDIQAKHKEDEVELF
Ga0208149_103973713300025610AqueousFPDYNFDVPAPPDTKCKAPFYCEQNEIKYTDMEGNLYCGYRYKMTDEKNPFSWEWKVCHALLEPVDIQAKHKEDEVELF
Ga0208643_101929063300025645AqueousEQVGGLFDADKLKAKLQKKFPNYNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGDLYCGYRYKLTDEKNPFAWEWKVCHALLEPMDIQAKHQEDEVELF
Ga0208643_104363223300025645AqueousMDLEQVGGLFDADKLKAKLQKKFPNYNFDVPAPPDTKCKAPFYCEQNEIKYTDMEGNLYCGYRYKMTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF
Ga0208643_112217523300025645AqueousMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYTDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLKPVDIQAKHK
Ga0208134_105691713300025652AqueousPDYNFDVPAPPDTKCKAPFYCEQNEIKYSDMEGNLYCGYRYKMTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF
Ga0208428_102005853300025653AqueousFPDYNFDVPAPPDTKCKAPFYCEQNEIKYSDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLKPVDIQAKHKEDEVELF
Ga0208428_116649613300025653AqueousINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCDQNEIKYTDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF
Ga0208898_118283713300025671AqueousMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYTDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALL
Ga0208767_110660613300025769AqueousINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYTDMEGNLYCGYRYKMTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF
Ga0208767_122141613300025769AqueousINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYSDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLEPIDIQAKHKEDEVELF
Ga0208785_101775413300025815AqueousINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYTDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF
Ga0208785_104864733300025815AqueousINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYSDMEGNLYCGYRYKLTDEKNPFTWEWKVCHALLKPVDIQAKHKEDEVELF
Ga0209193_112543023300025816Pelagic MarineMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGNLYCGYRYKLTDEKNLFTWEWKVCHALLEPVDIQAKHKEDEVELF
Ga0208547_101989743300025828AqueousMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYTDMEGNLYCGYRYKMTDEKNPFSWEWKVCHALLEPVDIQAKHKEDEVELF
Ga0208547_116717413300025828AqueousNTKRMDLERAGESINIEKLKARLQKRFPDYNFDVPTPPDTKCKAPFYCEQNEIKYSDMEGNLYCGYRYKMTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF
Ga0209832_114379923300025830Pelagic MarineMDLEQVGGLFDADKLKAKLQKKFPNYNFDVPQPPDTKCKAPFYCKQNEIKYTDMEGDLYCGYRYKLTDEKNPFAWEWKVCHALLEPMDIQ
Ga0209309_1019581013300025881Pelagic MarineMDLEQVGGLFDADKLKAKLQKKFPNYNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGDLYCGYRYKLTDEKNPFAWEWKVCHALLEPMDIQAKYQEDEVELF
Ga0209631_1032267323300025890Pelagic MarineMDLEQVGGLFDADKLKAKLQKKFPNYNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGDLYCGYRYKLTDEKNPFAWEWKVCHALLEPMDIQAK
Ga0209335_1024347813300025894Pelagic MarineMDLEPVGGLFDADKLKAKLQKKFPNYNFDVPQPPDTKCKAPFYCKQNEIKYTDMEGDLYCGYRYKLTDEKNPFAWEWKVCHALLEPMDIQAKHQEDEVELF
Ga0209962_106545723300026125WaterFPDYNFDVAPPPDTRCKAPFYCSKNEIKYTDTEGNLYCGYRFKLADEKNPFSFEWKVCHALIQPVNVQEKHKEDEVELF
Ga0209961_104851223300026130WaterMDLERAGSLFNLDKFKERLKKRFPDYNFDVAPPPDTRCKAPFYCSKNEIKYTDTEGNLYCGYRFKLADEKNPFSFEWKVCHALIQPVDVQEKHKE
Ga0209951_104309913300026138Pond WaterERLKKRFPDYNFDVAPPPDTRCKAPFYCSKNEIKYTDTEGNLYCGYRFKLADEKNPFRFEWKVCHALIQPVDVQEKHKEDEVELF
Ga0209932_101773113300026183Pond WaterKRFPDYNFDVAPPPDTRCKAPFYCSKNEIKYTDTEGNLYCGYRFKLADEKNPFRFEWKVCHALIQPVDVQEKHKEDEVELF
Ga0209929_100748753300026187Pond WaterMDLEPVGNLFDADKLKAKLQKKFPDYNFDVPAPPDTKCKAPYYCKQNEIKYTDMEGNLYCGYRYKLTDEKTPFIWEWKVCHALLEPVDIQAKHKEDEVELF
Ga0209929_116560113300026187Pond WaterFNLNKFKERLKKRFPDYNFDVAPAPDTRCKAPFYCSKNEIKYTDTEGNLYCGYRFKLADEKNPFSFEWKVCHALIQPVNVQEKHKEDEVELF
(restricted) Ga0255041_1031574523300027837SeawaterFPNHNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGNLYCGYRYKLTDEKNPFAWEYKVCHALLEPIDVQAKHKEDEVELF
(restricted) Ga0255054_1021263623300027856SeawaterMDLEPVGGLFDVDKLKAKLRKKFPNYNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGNLYCGYRYKLTDEKNPFAWEYRVCHALLEPIDVQAKHKKDEVELF
Ga0209536_10129586513300027917Marine SedimentKERYPEYNFDVPAPLDTKCKSPFYCKDNEIRYTDTEGNLFCGLKYKESDDKDPYKWEWKVCHALIKPVDIQAKHQEDEVELF
(restricted) Ga0233413_1014398733300027996SeawaterMALEQAGQSLNIKKLKEKLQKRFPQHNFDVAPKPDTRCKAPYFCKNNSIKYTDVEGNTFCGLRYKQTDDKDPYRWEYKVCHALIKPVDIQAKHKEDEVELF
Ga0257114_104889833300028196MarineMDLELVGGLFDVDKLKAKLRKKFPNHNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGNLYCGYRYKLTDEKNPFAWEYKVCHALLEPIDVQAKHKEDEVELF
Ga0265309_1097713423300028599SedimentMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGDLYCGYRYKLTDEKNPFAWEWKVCHALLEPMDIQAKHQEDEVELF
Ga0315320_1005294823300031851SeawaterMDLEPVGGLFDVDKLKAKLRKKFPDHNFDVPAPPDTKCKAPFYCKQNDIKYTDMEGNLYCGYRYKLTDEKNHFAWEYKVCHALLEPIDVQAKHKEDEVELF
Ga0315320_1033279623300031851SeawaterRMDLEPVGGLFDVDKLKAKLRKKFPNHNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGNLYCGYRYKLTDEKNPFAWEYRVCHALLEPIDVQAKHKEDEVELF
Ga0315315_1136770913300032073SeawaterPAPPDTKCKAPFYCKQNDIKYTDMEGNLYCGYRYKLTDEKNPFAWEYKVCHALLEPIDVQAKHKEDEVELF
Ga0316201_1004512173300032136Worm BurrowMDLERAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCEQNEIKYTDIEGNLYCGYRYKLTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF
Ga0316209_102185963300032255Microbial MatLQKKFPNYNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGDLYCGYRYKLTDEKNPFAWEWKVCHALLEPMDIQAKHQEDEVELF
Ga0348335_047151_1456_16953300034374AqueousFPDYNFDVPAPPDTKCKAPFYCEQNEIKYTDMEGNLYCGYRYKMTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF
Ga0348335_080290_2_2923300034374AqueousAGESINIEKLKARLQKRFPDYNFDVPAPPDTKCKAPFYCKQNEIKYTDMEGNLYCGYRYKMTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF
Ga0348336_064420_1172_14113300034375AqueousFPDYNFDVPAPPDTKCKAPFYCEQNEIKYTDMEGNLYCGYRYKMTDEKNPFTWEWKVCHALLEPVNIQAKHKEDEVELF
Ga0348336_195895_318_5423300034375AqueousFDVPAPPDTKCKAPFYCKQNEIKYTDMEGNLYCGYRYKMTDEKNPFTWEWKVCHALLEPVDIQAKHKEDEVELF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.