| Basic Information | |
|---|---|
| Family ID | F036634 |
| Family Type | Metagenome |
| Number of Sequences | 169 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MIRVDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREAAARLQKLAEQP |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 169 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 63.91 % |
| % of genes near scaffold ends (potentially truncated) | 34.91 % |
| % of genes from short scaffolds (< 2000 bps) | 63.91 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (99.408 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (28.994 % of family members) |
| Environment Ontology (ENVO) | Unclassified (57.396 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.355 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 74.51% β-sheet: 0.00% Coil/Unstructured: 25.49% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 169 Family Scaffolds |
|---|---|---|
| PF07690 | MFS_1 | 17.75 |
| PF05866 | RusA | 9.47 |
| PF02769 | AIRS_C | 7.10 |
| PF12706 | Lactamase_B_2 | 6.51 |
| PF00118 | Cpn60_TCP1 | 1.78 |
| PF03551 | PadR | 1.18 |
| PF00464 | SHMT | 0.59 |
| PF05995 | CDO_I | 0.59 |
| PF01423 | LSM | 0.59 |
| PF13240 | zinc_ribbon_2 | 0.59 |
| PF13650 | Asp_protease_2 | 0.59 |
| PF00483 | NTP_transferase | 0.59 |
| PF01871 | AMMECR1 | 0.59 |
| PF00326 | Peptidase_S9 | 0.59 |
| PF13483 | Lactamase_B_3 | 0.59 |
| COG ID | Name | Functional Category | % Frequency in 169 Family Scaffolds |
|---|---|---|---|
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 9.47 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 1.78 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.18 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.18 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.18 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.59 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.59 |
| COG2078 | Predicted RNA modification protein, AMMECR1 domain | General function prediction only [R] | 0.59 |
| COG5553 | Predicted metal-dependent enzyme of the double-stranded beta helix superfamily | General function prediction only [R] | 0.59 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.41 % |
| Unclassified | root | N/A | 0.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002557|JGI25381J37097_1001224 | All Organisms → cellular organisms → Archaea | 4037 | Open in IMG/M |
| 3300002558|JGI25385J37094_10042062 | All Organisms → cellular organisms → Archaea | 1567 | Open in IMG/M |
| 3300002558|JGI25385J37094_10109382 | All Organisms → cellular organisms → Archaea | 805 | Open in IMG/M |
| 3300002558|JGI25385J37094_10221714 | All Organisms → cellular organisms → Archaea | 504 | Open in IMG/M |
| 3300002560|JGI25383J37093_10004632 | All Organisms → cellular organisms → Archaea | 4285 | Open in IMG/M |
| 3300002560|JGI25383J37093_10012812 | All Organisms → cellular organisms → Archaea | 2769 | Open in IMG/M |
| 3300002561|JGI25384J37096_10025261 | All Organisms → cellular organisms → Archaea | 2313 | Open in IMG/M |
| 3300002562|JGI25382J37095_10006487 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae → Thermococcus | 4205 | Open in IMG/M |
| 3300002562|JGI25382J37095_10116324 | All Organisms → cellular organisms → Archaea | 919 | Open in IMG/M |
| 3300002908|JGI25382J43887_10054180 | All Organisms → cellular organisms → Archaea | 2179 | Open in IMG/M |
| 3300002908|JGI25382J43887_10081571 | All Organisms → cellular organisms → Archaea | 1737 | Open in IMG/M |
| 3300002909|JGI25388J43891_1002907 | All Organisms → cellular organisms → Archaea | 3541 | Open in IMG/M |
| 3300002909|JGI25388J43891_1018454 | All Organisms → cellular organisms → Archaea | 1241 | Open in IMG/M |
| 3300002911|JGI25390J43892_10000341 | All Organisms → cellular organisms → Archaea | 8838 | Open in IMG/M |
| 3300002912|JGI25386J43895_10009978 | All Organisms → cellular organisms → Archaea | 2698 | Open in IMG/M |
| 3300002912|JGI25386J43895_10015573 | All Organisms → cellular organisms → Archaea | 2212 | Open in IMG/M |
| 3300002914|JGI25617J43924_10022443 | All Organisms → cellular organisms → Archaea | 2193 | Open in IMG/M |
| 3300005167|Ga0066672_10006010 | All Organisms → cellular organisms → Archaea | 5425 | Open in IMG/M |
| 3300005167|Ga0066672_10722629 | All Organisms → cellular organisms → Archaea | 635 | Open in IMG/M |
| 3300005172|Ga0066683_10463713 | All Organisms → cellular organisms → Archaea | 775 | Open in IMG/M |
| 3300005174|Ga0066680_10005344 | All Organisms → cellular organisms → Archaea | 6121 | Open in IMG/M |
| 3300005174|Ga0066680_10140870 | All Organisms → cellular organisms → Archaea | 1504 | Open in IMG/M |
| 3300005176|Ga0066679_10232541 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 1183 | Open in IMG/M |
| 3300005176|Ga0066679_10760095 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 622 | Open in IMG/M |
| 3300005186|Ga0066676_10327153 | All Organisms → cellular organisms → Archaea | 1020 | Open in IMG/M |
| 3300005445|Ga0070708_100019843 | All Organisms → cellular organisms → Archaea | 5656 | Open in IMG/M |
| 3300005445|Ga0070708_100037987 | All Organisms → cellular organisms → Archaea | 4203 | Open in IMG/M |
| 3300005447|Ga0066689_10015975 | All Organisms → cellular organisms → Archaea | 3563 | Open in IMG/M |
| 3300005450|Ga0066682_10336842 | All Organisms → cellular organisms → Archaea | 972 | Open in IMG/M |
| 3300005451|Ga0066681_10001106 | All Organisms → cellular organisms → Archaea | 10411 | Open in IMG/M |
| 3300005454|Ga0066687_10262915 | All Organisms → cellular organisms → Archaea | 966 | Open in IMG/M |
| 3300005468|Ga0070707_100120057 | All Organisms → cellular organisms → Archaea | 2552 | Open in IMG/M |
| 3300005468|Ga0070707_100413911 | All Organisms → cellular organisms → Archaea | 1308 | Open in IMG/M |
| 3300005471|Ga0070698_101024824 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 773 | Open in IMG/M |
| 3300005536|Ga0070697_100005686 | All Organisms → cellular organisms → Archaea | 9604 | Open in IMG/M |
| 3300005540|Ga0066697_10401198 | All Organisms → cellular organisms → Archaea | 796 | Open in IMG/M |
| 3300005552|Ga0066701_10061637 | All Organisms → cellular organisms → Archaea | 2097 | Open in IMG/M |
| 3300005552|Ga0066701_10095798 | All Organisms → cellular organisms → Archaea | 1726 | Open in IMG/M |
| 3300005552|Ga0066701_10714212 | All Organisms → cellular organisms → Archaea | 601 | Open in IMG/M |
| 3300005558|Ga0066698_11104408 | All Organisms → cellular organisms → Archaea | 501 | Open in IMG/M |
| 3300006046|Ga0066652_100616261 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 1025 | Open in IMG/M |
| 3300006791|Ga0066653_10325477 | All Organisms → cellular organisms → Archaea | 775 | Open in IMG/M |
| 3300006791|Ga0066653_10327537 | All Organisms → cellular organisms → Archaea | 773 | Open in IMG/M |
| 3300006800|Ga0066660_10741515 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 802 | Open in IMG/M |
| 3300006804|Ga0079221_10268538 | All Organisms → cellular organisms → Archaea | 981 | Open in IMG/M |
| 3300007258|Ga0099793_10038476 | All Organisms → cellular organisms → Archaea | 2068 | Open in IMG/M |
| 3300007258|Ga0099793_10142975 | All Organisms → cellular organisms → Archaea | 1130 | Open in IMG/M |
| 3300007258|Ga0099793_10271325 | All Organisms → cellular organisms → Archaea | 821 | Open in IMG/M |
| 3300007258|Ga0099793_10326001 | All Organisms → cellular organisms → Archaea | 748 | Open in IMG/M |
| 3300007265|Ga0099794_10091723 | All Organisms → cellular organisms → Archaea | 1508 | Open in IMG/M |
| 3300007265|Ga0099794_10438006 | All Organisms → cellular organisms → Archaea | 685 | Open in IMG/M |
| 3300009012|Ga0066710_100054709 | All Organisms → cellular organisms → Archaea | 4979 | Open in IMG/M |
| 3300009012|Ga0066710_101358695 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 1102 | Open in IMG/M |
| 3300009012|Ga0066710_103013375 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 655 | Open in IMG/M |
| 3300009012|Ga0066710_104866070 | All Organisms → cellular organisms → Archaea | 502 | Open in IMG/M |
| 3300009038|Ga0099829_11081144 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 665 | Open in IMG/M |
| 3300009038|Ga0099829_11608145 | All Organisms → cellular organisms → Archaea | 536 | Open in IMG/M |
| 3300009088|Ga0099830_11235373 | All Organisms → cellular organisms → Archaea | 621 | Open in IMG/M |
| 3300009089|Ga0099828_10675686 | All Organisms → cellular organisms → Archaea | 928 | Open in IMG/M |
| 3300009089|Ga0099828_11632467 | All Organisms → cellular organisms → Archaea | 567 | Open in IMG/M |
| 3300009090|Ga0099827_11474984 | All Organisms → cellular organisms → Archaea | 592 | Open in IMG/M |
| 3300009137|Ga0066709_100460183 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 1781 | Open in IMG/M |
| 3300009137|Ga0066709_102230677 | All Organisms → cellular organisms → Archaea | 754 | Open in IMG/M |
| 3300009137|Ga0066709_104254994 | All Organisms → cellular organisms → Archaea | 522 | Open in IMG/M |
| 3300010301|Ga0134070_10157986 | All Organisms → cellular organisms → Archaea | 816 | Open in IMG/M |
| 3300010304|Ga0134088_10096155 | All Organisms → cellular organisms → Archaea | 1391 | Open in IMG/M |
| 3300010320|Ga0134109_10045925 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 1433 | Open in IMG/M |
| 3300010320|Ga0134109_10047716 | All Organisms → cellular organisms → Archaea | 1410 | Open in IMG/M |
| 3300010320|Ga0134109_10124222 | All Organisms → cellular organisms → Archaea | 914 | Open in IMG/M |
| 3300010321|Ga0134067_10458440 | All Organisms → cellular organisms → Archaea | 521 | Open in IMG/M |
| 3300010323|Ga0134086_10345491 | All Organisms → cellular organisms → Archaea | 587 | Open in IMG/M |
| 3300010326|Ga0134065_10005434 | All Organisms → cellular organisms → Archaea | 3224 | Open in IMG/M |
| 3300010326|Ga0134065_10006142 | All Organisms → cellular organisms → Archaea | 3065 | Open in IMG/M |
| 3300010336|Ga0134071_10593545 | All Organisms → cellular organisms → Archaea | 579 | Open in IMG/M |
| 3300011270|Ga0137391_10369176 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1231 | Open in IMG/M |
| 3300011270|Ga0137391_10450528 | All Organisms → cellular organisms → Archaea | 1095 | Open in IMG/M |
| 3300011270|Ga0137391_10930796 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 710 | Open in IMG/M |
| 3300011270|Ga0137391_11034809 | All Organisms → cellular organisms → Archaea | 667 | Open in IMG/M |
| 3300012096|Ga0137389_10713437 | All Organisms → cellular organisms → Archaea | 862 | Open in IMG/M |
| 3300012189|Ga0137388_10792544 | All Organisms → cellular organisms → Archaea | 878 | Open in IMG/M |
| 3300012189|Ga0137388_11466642 | All Organisms → cellular organisms → Archaea | 620 | Open in IMG/M |
| 3300012199|Ga0137383_10268863 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 1249 | Open in IMG/M |
| 3300012199|Ga0137383_10343635 | All Organisms → cellular organisms → Archaea | 1093 | Open in IMG/M |
| 3300012199|Ga0137383_10921086 | All Organisms → cellular organisms → Archaea | 638 | Open in IMG/M |
| 3300012203|Ga0137399_10075974 | All Organisms → cellular organisms → Archaea | 2534 | Open in IMG/M |
| 3300012203|Ga0137399_10320985 | All Organisms → cellular organisms → Archaea | 1282 | Open in IMG/M |
| 3300012204|Ga0137374_10942119 | All Organisms → cellular organisms → Archaea | 630 | Open in IMG/M |
| 3300012206|Ga0137380_10073007 | All Organisms → cellular organisms → Archaea | 3138 | Open in IMG/M |
| 3300012206|Ga0137380_11598792 | All Organisms → cellular organisms → Archaea | 536 | Open in IMG/M |
| 3300012207|Ga0137381_10732412 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 859 | Open in IMG/M |
| 3300012349|Ga0137387_10041710 | All Organisms → cellular organisms → Archaea | 3020 | Open in IMG/M |
| 3300012349|Ga0137387_10048630 | All Organisms → cellular organisms → Archaea | 2821 | Open in IMG/M |
| 3300012351|Ga0137386_10033655 | All Organisms → cellular organisms → Archaea | 3497 | Open in IMG/M |
| 3300012351|Ga0137386_10065814 | All Organisms → cellular organisms → Archaea | 2523 | Open in IMG/M |
| 3300012353|Ga0137367_10026560 | All Organisms → cellular organisms → Archaea | 4488 | Open in IMG/M |
| 3300012354|Ga0137366_10023302 | All Organisms → cellular organisms → Archaea | 4817 | Open in IMG/M |
| 3300012355|Ga0137369_10798619 | All Organisms → cellular organisms → Archaea | 643 | Open in IMG/M |
| 3300012356|Ga0137371_10482450 | All Organisms → cellular organisms → Archaea | 957 | Open in IMG/M |
| 3300012357|Ga0137384_10277013 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 1397 | Open in IMG/M |
| 3300012357|Ga0137384_10458690 | All Organisms → cellular organisms → Archaea | 1049 | Open in IMG/M |
| 3300012359|Ga0137385_10051565 | All Organisms → cellular organisms → Archaea | 3678 | Open in IMG/M |
| 3300012359|Ga0137385_10183073 | All Organisms → cellular organisms → Archaea | 1835 | Open in IMG/M |
| 3300012918|Ga0137396_10147133 | All Organisms → cellular organisms → Archaea | 1713 | Open in IMG/M |
| 3300012975|Ga0134110_10060657 | All Organisms → cellular organisms → Archaea | 1498 | Open in IMG/M |
| 3300014150|Ga0134081_10005229 | All Organisms → cellular organisms → Archaea | 3314 | Open in IMG/M |
| 3300014154|Ga0134075_10127155 | All Organisms → cellular organisms → Archaea | 1084 | Open in IMG/M |
| 3300014154|Ga0134075_10278945 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 726 | Open in IMG/M |
| 3300015359|Ga0134085_10528488 | All Organisms → cellular organisms → Archaea | 542 | Open in IMG/M |
| 3300017656|Ga0134112_10095998 | All Organisms → cellular organisms → Archaea | 1111 | Open in IMG/M |
| 3300017934|Ga0187803_10354305 | All Organisms → cellular organisms → Archaea → TACK group | 590 | Open in IMG/M |
| 3300018433|Ga0066667_10119883 | All Organisms → cellular organisms → Archaea | 1796 | Open in IMG/M |
| 3300018468|Ga0066662_10038826 | All Organisms → cellular organisms → Archaea | 2919 | Open in IMG/M |
| 3300018468|Ga0066662_11788551 | All Organisms → cellular organisms → Archaea | 643 | Open in IMG/M |
| 3300018482|Ga0066669_10031883 | All Organisms → cellular organisms → Archaea | 3124 | Open in IMG/M |
| 3300018482|Ga0066669_11010647 | All Organisms → cellular organisms → Archaea | 750 | Open in IMG/M |
| 3300021046|Ga0215015_10618908 | All Organisms → cellular organisms → Archaea | 987 | Open in IMG/M |
| 3300021088|Ga0210404_10010717 | All Organisms → cellular organisms → Archaea | 3756 | Open in IMG/M |
| 3300021088|Ga0210404_10146474 | All Organisms → cellular organisms → Archaea | 1234 | Open in IMG/M |
| 3300024330|Ga0137417_1438818 | All Organisms → cellular organisms → Archaea | 4675 | Open in IMG/M |
| 3300025922|Ga0207646_10000003 | All Organisms → cellular organisms → Archaea | 537256 | Open in IMG/M |
| 3300025922|Ga0207646_10006383 | All Organisms → cellular organisms → Archaea | 12193 | Open in IMG/M |
| 3300025922|Ga0207646_10016489 | All Organisms → cellular organisms → Archaea | 6932 | Open in IMG/M |
| 3300025922|Ga0207646_10094471 | All Organisms → cellular organisms → Archaea | 2678 | Open in IMG/M |
| 3300026295|Ga0209234_1223296 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 624 | Open in IMG/M |
| 3300026295|Ga0209234_1223835 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 623 | Open in IMG/M |
| 3300026296|Ga0209235_1000117 | All Organisms → cellular organisms → Archaea | 35119 | Open in IMG/M |
| 3300026296|Ga0209235_1005048 | All Organisms → cellular organisms → Archaea | 7376 | Open in IMG/M |
| 3300026296|Ga0209235_1022792 | All Organisms → cellular organisms → Archaea | 3324 | Open in IMG/M |
| 3300026296|Ga0209235_1029996 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 2813 | Open in IMG/M |
| 3300026297|Ga0209237_1001060 | All Organisms → cellular organisms → Archaea | 16159 | Open in IMG/M |
| 3300026297|Ga0209237_1028541 | All Organisms → cellular organisms → Archaea | 3077 | Open in IMG/M |
| 3300026298|Ga0209236_1023624 | All Organisms → cellular organisms → Archaea | 3394 | Open in IMG/M |
| 3300026301|Ga0209238_1107798 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 936 | Open in IMG/M |
| 3300026307|Ga0209469_1001483 | Not Available | 12572 | Open in IMG/M |
| 3300026313|Ga0209761_1126737 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 1233 | Open in IMG/M |
| 3300026314|Ga0209268_1087863 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 888 | Open in IMG/M |
| 3300026317|Ga0209154_1005199 | All Organisms → cellular organisms → Archaea | 6769 | Open in IMG/M |
| 3300026318|Ga0209471_1051690 | All Organisms → cellular organisms → Archaea | 1905 | Open in IMG/M |
| 3300026324|Ga0209470_1014607 | All Organisms → cellular organisms → Archaea | 4484 | Open in IMG/M |
| 3300026326|Ga0209801_1017083 | All Organisms → cellular organisms → Archaea | 3620 | Open in IMG/M |
| 3300026326|Ga0209801_1291842 | All Organisms → cellular organisms → Archaea | 585 | Open in IMG/M |
| 3300026332|Ga0209803_1031693 | All Organisms → cellular organisms → Archaea | 2493 | Open in IMG/M |
| 3300026332|Ga0209803_1055346 | All Organisms → cellular organisms → Archaea | 1737 | Open in IMG/M |
| 3300026342|Ga0209057_1015185 | All Organisms → cellular organisms → Archaea | 4559 | Open in IMG/M |
| 3300026342|Ga0209057_1182338 | All Organisms → cellular organisms → Archaea | 604 | Open in IMG/M |
| 3300026343|Ga0209159_1199258 | All Organisms → cellular organisms → Archaea | 647 | Open in IMG/M |
| 3300026524|Ga0209690_1084475 | All Organisms → cellular organisms → Archaea | 1330 | Open in IMG/M |
| 3300026529|Ga0209806_1072345 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 1548 | Open in IMG/M |
| 3300026532|Ga0209160_1097851 | All Organisms → cellular organisms → Archaea | 1494 | Open in IMG/M |
| 3300026547|Ga0209156_10236257 | All Organisms → cellular organisms → Archaea | 856 | Open in IMG/M |
| 3300026548|Ga0209161_10182822 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 1181 | Open in IMG/M |
| 3300026548|Ga0209161_10347442 | All Organisms → cellular organisms → Archaea | 667 | Open in IMG/M |
| 3300026548|Ga0209161_10507800 | All Organisms → cellular organisms → Archaea | 534 | Open in IMG/M |
| 3300026551|Ga0209648_10019655 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 5903 | Open in IMG/M |
| 3300027643|Ga0209076_1193916 | All Organisms → cellular organisms → Archaea | 559 | Open in IMG/M |
| 3300027655|Ga0209388_1108408 | All Organisms → cellular organisms → Archaea | 795 | Open in IMG/M |
| 3300027725|Ga0209178_1291230 | All Organisms → cellular organisms → Archaea | 599 | Open in IMG/M |
| 3300027875|Ga0209283_10003622 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae → Thermococcus | 8743 | Open in IMG/M |
| 3300027875|Ga0209283_10110208 | All Organisms → cellular organisms → Archaea | 1806 | Open in IMG/M |
| 3300027875|Ga0209283_10165100 | All Organisms → cellular organisms → Archaea | 1470 | Open in IMG/M |
| 3300028536|Ga0137415_10232261 | All Organisms → cellular organisms → Archaea | 1656 | Open in IMG/M |
| 3300028536|Ga0137415_10386514 | All Organisms → cellular organisms → Archaea | 1203 | Open in IMG/M |
| 3300031720|Ga0307469_10004279 | All Organisms → cellular organisms → Archaea | 6175 | Open in IMG/M |
| 3300031720|Ga0307469_10017735 | All Organisms → cellular organisms → Archaea | 3764 | Open in IMG/M |
| 3300031720|Ga0307469_10177968 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 1631 | Open in IMG/M |
| 3300031962|Ga0307479_10069128 | All Organisms → cellular organisms → Archaea | 3408 | Open in IMG/M |
| 3300032180|Ga0307471_100026720 | All Organisms → cellular organisms → Archaea | 4362 | Open in IMG/M |
| 3300032180|Ga0307471_100978304 | All Organisms → cellular organisms → Archaea | 1013 | Open in IMG/M |
| 3300032180|Ga0307471_101236057 | All Organisms → cellular organisms → Archaea | 910 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 28.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 24.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 23.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 9.47% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.14% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.18% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.59% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25381J37097_10012242 | 3300002557 | Grasslands Soil | VDKKDPLSVIRAELNSLALHVAKXGYNAEVKGKLREAAXRLQKLAEQP* |
| JGI25385J37094_100420622 | 3300002558 | Grasslands Soil | MIRVDKKDPLSVIRSELNSLALHVAKSGYNAEVKGKLKDVAGRLQKLADGS* |
| JGI25385J37094_101093821 | 3300002558 | Grasslands Soil | MIRVDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREAAARLQKLGEQP* |
| JGI25385J37094_102217141 | 3300002558 | Grasslands Soil | MIRVDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREAAARLQKLAEQP* |
| JGI25383J37093_100046321 | 3300002560 | Grasslands Soil | MIRVDKKDPLSVIRAELNSLALHVAKAGYNTEVKGKLREAAARLQKLAEQP* |
| JGI25383J37093_100128122 | 3300002560 | Grasslands Soil | VDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREAAARLQKLAEQP* |
| JGI25384J37096_100252614 | 3300002561 | Grasslands Soil | VDKKDPLSVIRSELNSLALHVAKSGYNAEVKGKLKDVAGRLQKLADGS* |
| JGI25382J37095_100064872 | 3300002562 | Grasslands Soil | MIRVDKKDPLSVIRAELNSLALHVAKSGYNTEVKGKLREAAARLQKLSEQP* |
| JGI25382J37095_101163242 | 3300002562 | Grasslands Soil | VDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKXREAAARLQKLAXQP* |
| JGI25382J43887_100541801 | 3300002908 | Grasslands Soil | MIRADKKDPLSVIRAELNNVALLAAKNGYTSDVKTKLRDAATKLQKLAEG* |
| JGI25382J43887_100815713 | 3300002908 | Grasslands Soil | VDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKIREAAARLQXLAEXP* |
| JGI25388J43891_10029071 | 3300002909 | Grasslands Soil | MIRVDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKIREAAARLQKLAEQP* |
| JGI25388J43891_10184542 | 3300002909 | Grasslands Soil | VDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKIREAAARLQKLAEQP* |
| JGI25390J43892_100003417 | 3300002911 | Grasslands Soil | MCQTCFGGMIRVDKKDPLSTIRAELNSLALHVAKSGYNAEVKGKLREVAGQLQKLAEGS* |
| JGI25386J43895_100099782 | 3300002912 | Grasslands Soil | VDKKDPLSVIRAELNSLALHVAKAGYNTEVKGKLREAAARLQKLAEQP* |
| JGI25386J43895_100155731 | 3300002912 | Grasslands Soil | VDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREAAARLQKLGEQP* |
| JGI25617J43924_100224432 | 3300002914 | Grasslands Soil | MIRVDKKDPLSTIRAELNSLALHVAKSGYNAEVKGKLREVAGRLQKLAESS* |
| Ga0066672_100060105 | 3300005167 | Soil | VCQTCFGGMIRVDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREAAARLQKLAEQP* |
| Ga0066672_107226292 | 3300005167 | Soil | MIRVDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREAA |
| Ga0066683_104637132 | 3300005172 | Soil | MIRADKKDPLSVIRAELNGMALHVAKSGYTADVKTKLRDAATK |
| Ga0066680_100053446 | 3300005174 | Soil | GMIRVDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREAASRLQKLAEQP* |
| Ga0066680_101408702 | 3300005174 | Soil | MIRVDKKDPLSVIRSELNSLALHVAKAGYNAEVKGKLREAAARLQKLAEQP* |
| Ga0066679_102325412 | 3300005176 | Soil | RVDKKDPLSVIRAELNSLALHIAKAGYNTEVKGKLREAAARLQKLAEQP* |
| Ga0066679_107600951 | 3300005176 | Soil | PLSVIRAELNSLALHVAKSGYNAEVKGKLREAAARLQKLGEQP* |
| Ga0066676_103271531 | 3300005186 | Soil | VDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKIREAAARLQKL |
| Ga0070708_1000198437 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLRDVSGRLQKLAEGS* |
| Ga0070708_1000379873 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRVDKKDPLSTIRAELNSLALHVAKSGYNAEVKGKLREVAGQLQKLAEGS* |
| Ga0066689_100159756 | 3300005447 | Soil | VDKKDPLSVIRSELNSLALHVAKSGYNAEVKGKLKDVAGRLQKLADG |
| Ga0066682_103368421 | 3300005450 | Soil | MIRVDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREAAA |
| Ga0066681_100011069 | 3300005451 | Soil | VDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREAASRLQKLAEQP* |
| Ga0066687_102629152 | 3300005454 | Soil | VDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREAAARL |
| Ga0070707_1001200571 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRVDKKDPLSVIRADLNSLALHVAKSGYNAEVKGKLREVAARMQKLAEG* |
| Ga0070707_1004139111 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRVDKKDPLSVIRSELNSLALHVAKSGYNAEVKGKLREIAVRMQKLAEGL* |
| Ga0070698_1010248241 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | KDPLSTIRAELNSLALHVAKSGYNAEVKGKLREVAGQLQKLAEGS* |
| Ga0070697_1000056869 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRVDKKDPLSAIRAELNSLALHVAKSGYNPEVKGKLREIAVRMQKLAEGS* |
| Ga0066697_104011981 | 3300005540 | Soil | MIRVDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREAAARLQKLAEQQ* |
| Ga0066701_100616372 | 3300005552 | Soil | MIRVDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLRDAAARLQKLGEQP* |
| Ga0066701_100957982 | 3300005552 | Soil | VDKKDPLSVIRSELNSLALHVAKAGYNAEVKGKLREAAARLQKLAEQP* |
| Ga0066701_107142121 | 3300005552 | Soil | VDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREAAARLQKLGEQ |
| Ga0066698_111044081 | 3300005558 | Soil | PLSVIRAELNSLALHVAKSGYNAEVKGKIREAAARLQKLAEQP* |
| Ga0066652_1006162612 | 3300006046 | Soil | MIRADKKDPLSVLRAELNNVALLVAKNGYTSDVKTKLRDAATKLQKLAEG* |
| Ga0066653_103254771 | 3300006791 | Soil | MIRADKKDPFSVIRAELNNVALLVAKNGYTSDVKTKLRDAATKLQKLAEG* |
| Ga0066653_103275371 | 3300006791 | Soil | MIRADKKDPLSVIRAELNNVALLVAKNGYTSDVKTKLRDAATKLQKLAEG* |
| Ga0066660_107415151 | 3300006800 | Soil | KKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREAAARLQKLVEQP* |
| Ga0079221_102685382 | 3300006804 | Agricultural Soil | MIRVDKKDPLSAIRAELNSLALHVAKSGYNAEVKGKLREISVRMQKLAE* |
| Ga0099793_100384762 | 3300007258 | Vadose Zone Soil | MIRVDKKDPLSTIRAELNSLALHVAKSGYNAEVKGKLREVAGQLQKLADGV* |
| Ga0099793_101429752 | 3300007258 | Vadose Zone Soil | MIRVDKKDPLSVIRSELNSLALHVAKAGYNAEVKGKLREAAGRLQKLAEQQ* |
| Ga0099793_102713251 | 3300007258 | Vadose Zone Soil | MIRVDKKDPLSTIRAELNSLALHVAKSGYNAEVKGKLR |
| Ga0099793_103260011 | 3300007258 | Vadose Zone Soil | MIRVDKKDPLSVIRAELNSLALHVAKAGYNAEVKGKLREAAGRLQKLAEQQ* |
| Ga0099794_100917232 | 3300007265 | Vadose Zone Soil | MIRVDKKDPLSTIRAELNSLALHVAKSGYKAEVKGKLREAAGRLQKLAEGS* |
| Ga0099794_104380061 | 3300007265 | Vadose Zone Soil | MIRVDKKDPLSTIRAELNSLALHVAKAGYNAEVKGKLREAAARLQKLAEQP* |
| Ga0066710_1000547096 | 3300009012 | Grasslands Soil | MIRADKKDPLSVIRAELNNVAVLAAKNGYTSDVKTKLRDAATKLQKLAEG |
| Ga0066710_1013586951 | 3300009012 | Grasslands Soil | MIRADKKDPLSVIRAELNNVALLVAKNGYTSDVKTKLRDAATKLQKLDEG |
| Ga0066710_1030133752 | 3300009012 | Grasslands Soil | DPLSVIRAELNSLALHVAKSGYNAEVKGKIREAAARLQKLAEQP |
| Ga0066710_1048660702 | 3300009012 | Grasslands Soil | DPLSVIRAELNSLALHVAKSGYNAEVKGKLREAAARLQKLGEQP |
| Ga0099829_110811442 | 3300009038 | Vadose Zone Soil | CFGGMIRVDKKDPLSAIRAELNSLALHVAKAGYNAEVKGKLREAAGRLQKLAEQP* |
| Ga0099829_116081451 | 3300009038 | Vadose Zone Soil | MIRVDKKDPLSVIRAELNSLALHVAKAGYNAEVKGKLREAAGRLQKLAEQP* |
| Ga0099830_112353731 | 3300009088 | Vadose Zone Soil | MIRVDKKDPLSVIRSELNSLALHVAKSGYNAEVKGKLREVAGRLQKLAEGS* |
| Ga0099828_106756861 | 3300009089 | Vadose Zone Soil | MIRVDKKDPLSTIRAELNSLALHVAKSGYNAEVKGKLGEVAGQLQKLAEGS* |
| Ga0099828_116324671 | 3300009089 | Vadose Zone Soil | MIRVDKKDPLSVIRSELNSLALHVAKSGYNPEVKGKLREVAGRLQKLAEGS* |
| Ga0099827_114749841 | 3300009090 | Vadose Zone Soil | MIRVDKKDPLSVIRAELNSLALHVAKAGYNAEVKEKLREAAGRLQKLAEQP* |
| Ga0066709_1004601831 | 3300009137 | Grasslands Soil | AELNSLALHVAKSGYNAEVKGKIREAAARLQKLAEQP* |
| Ga0066709_1022306771 | 3300009137 | Grasslands Soil | MIRVDKKDPLSTIRAELNGLALHVAKSGYNAEVKGKLREVAGQLQKLAEGS* |
| Ga0066709_1042549942 | 3300009137 | Grasslands Soil | DPLSVIRAELNSLALHVAKSGYNAEVKGKLREAAARLQKLGEQP* |
| Ga0134070_101579862 | 3300010301 | Grasslands Soil | MIRADKKDPLSVVRAELNNVALLVAKNGYTSDVKTKLRDAATKLQKLAEG* |
| Ga0134088_100961552 | 3300010304 | Grasslands Soil | MIRVDKKDPLSTIRAELNSLALHVAKSGYNAEVKGK |
| Ga0134109_100459252 | 3300010320 | Grasslands Soil | RADKKDPLSVIRAELNTMALHVAKSGYTADVKTKLRDAATKLQKLAEG* |
| Ga0134109_100477162 | 3300010320 | Grasslands Soil | MIRADKKDPLSVIRAELNNVALLVAKNGYTSDVKTKLRDAATKLQKLAAG* |
| Ga0134109_101242221 | 3300010320 | Grasslands Soil | MIRVDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREAASRLQKLAEQP* |
| Ga0134067_104584401 | 3300010321 | Grasslands Soil | CQTCFGGMIRADKKDPLSVLRAELNNVALLVAKNGYTSDVKTKLRDAATKLQKLAEG* |
| Ga0134086_103454911 | 3300010323 | Grasslands Soil | MIRADKKDPLSVIRAELTNVALLVAKNGYTSDVKTKLRDAATKLQKLAEG* |
| Ga0134065_100054341 | 3300010326 | Grasslands Soil | MIRVDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKIREAAARLQKLAEQ |
| Ga0134065_100061421 | 3300010326 | Grasslands Soil | LSVIRAELNSLALHVAKSGYNAEVKGKLREAAARLQKLAEQP* |
| Ga0134071_105935452 | 3300010336 | Grasslands Soil | MIRADRKDPLSIIRAELSTLALHVAKNGYNAEVKAVLRDIAGRLQQLAERS* |
| Ga0137391_103691762 | 3300011270 | Vadose Zone Soil | TIRAELNSLALHVAKSGYNAEVKGKLREVAGQLQKLAERS* |
| Ga0137391_104505281 | 3300011270 | Vadose Zone Soil | MIRVDKKDPLSTIRAELNSLALHVAKSGYNAEVKGKLREVAGQLQKL |
| Ga0137391_109307961 | 3300011270 | Vadose Zone Soil | TIRAELNSLALHVAKSGYNAEVKGKLREVAGQLQKLAEGS* |
| Ga0137391_110348091 | 3300011270 | Vadose Zone Soil | MIRVDKKDPLSTIRAELNSLALHVAKSGYNAEVKGKLREVAG |
| Ga0137389_107134371 | 3300012096 | Vadose Zone Soil | MIRVDKKDPLSTIRAELNSLALHVAKSGYNAEVKGKLREVAGQLQKLADGS* |
| Ga0137388_107925441 | 3300012189 | Vadose Zone Soil | MIRVDKKDPLSAIRAELNSLALHVAKAGYNAEVKGKLREAAGRLQKLAEQP* |
| Ga0137388_114666421 | 3300012189 | Vadose Zone Soil | MIRVDKKDPLSVIRSELNSLALHVAKSGYNAEVKGKLREVAGQLQKLAEGS* |
| Ga0137383_102688632 | 3300012199 | Vadose Zone Soil | SVIRAELNSLALHVAKSGYNAEVKGKLREAAARLQKLAEQP* |
| Ga0137383_103436352 | 3300012199 | Vadose Zone Soil | MIRVDKKDPLSVIRAELNSLALHIAKAGYNTEVKGKLREAAARLQKLAEQP* |
| Ga0137383_109210862 | 3300012199 | Vadose Zone Soil | MIRVDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREAAARLQ |
| Ga0137399_100759742 | 3300012203 | Vadose Zone Soil | MIRVDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREVAGQLQKLAEGS* |
| Ga0137399_103209852 | 3300012203 | Vadose Zone Soil | MIRVDKKDPLSTIRAELNSLALHVAKSGYNAEVKGKLREVAGQLQKLAEAS* |
| Ga0137374_109421191 | 3300012204 | Vadose Zone Soil | MIRADKKDPLSVIRAELNSMALHVAKSGYTSGVKTKLRDAATKLQKLAEG* |
| Ga0137380_100730072 | 3300012206 | Vadose Zone Soil | MIRADKKDPLSVIRAELNSMALHVAKSGYTPDVKTKLREVASRLQKLAEA* |
| Ga0137380_115987921 | 3300012206 | Vadose Zone Soil | MIRVDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKIREAAARLQKLAEQL* |
| Ga0137381_107324121 | 3300012207 | Vadose Zone Soil | ELNSLALHVAKSGYNAEVKGKIREAAARLQKLAEQP* |
| Ga0137387_100417102 | 3300012349 | Vadose Zone Soil | MIRADKKDPLSVIRAELNNVALLAAKKGYTSDVKTKLRDAATKLQKLAEG* |
| Ga0137387_100486303 | 3300012349 | Vadose Zone Soil | QTCFGGMIRVDKKDPLSVIRAELNSLALHVAKAGYNAEVKGKLREAAERLQKLSEQP* |
| Ga0137386_100336551 | 3300012351 | Vadose Zone Soil | RAELNSLALHVAKSGYNAEVKGKLREAAARLQKLAEQP* |
| Ga0137386_100658141 | 3300012351 | Vadose Zone Soil | MIRADKKDPLSVIRAELNNVALLAAKNGYTSDVKTKLRDAATKLQKQAEG* |
| Ga0137367_100265604 | 3300012353 | Vadose Zone Soil | MIRADKKDPLSVIRAELNSMALHVAKSGYTADVKTKLRDAATKLQKLAEG* |
| Ga0137366_100233027 | 3300012354 | Vadose Zone Soil | MIRADKKDPLSVIRAELNSMALHVAKSGYTSDVKTKLRDAATKLQKLAEG* |
| Ga0137369_107986191 | 3300012355 | Vadose Zone Soil | MIRVDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKIREAAARLQKLAEQQ* |
| Ga0137371_104824502 | 3300012356 | Vadose Zone Soil | MIRADKKDPLSVIRAELNNVALLVAKNGYTSGVKTKLRDAATKLQKLAEG* |
| Ga0137384_102770131 | 3300012357 | Vadose Zone Soil | GGMIRVDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREAAARLQKLAEQP* |
| Ga0137384_104586901 | 3300012357 | Vadose Zone Soil | LNSLALHVAKSGYNAEVKGKLREAAARLQKLAEQQ* |
| Ga0137385_100515651 | 3300012359 | Vadose Zone Soil | LNSLALHVAKSGYNAEVKGKLREAAARLQKLAEQP* |
| Ga0137385_101830733 | 3300012359 | Vadose Zone Soil | MIRVDKKDPLSVIRAELNSLALHVAKAGYNAEVKGKLREAAERLQKLSEQP* |
| Ga0137396_101471332 | 3300012918 | Vadose Zone Soil | MIRVDKKDPLSIIRAELNSLALHVAKSGYNAEVKGKLREVAGQLQKLAEGA* |
| Ga0134110_100606571 | 3300012975 | Grasslands Soil | MIRADKKDPFSVIRAELNNVALLVAKNGYTSDVKTKLRDASTKLQKLAEG* |
| Ga0134081_100052291 | 3300014150 | Grasslands Soil | QTCFGGMIRVDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKIREAAARLQKLAEQP* |
| Ga0134075_101271551 | 3300014154 | Grasslands Soil | MIRVDKKDPLSTIRAELNSLALHVAKSGYNAEVKGKLREVAGQLQKLAESS* |
| Ga0134075_102789451 | 3300014154 | Grasslands Soil | GMIRVDKKDPLSVIRSELNSLALHVAKSGYNAEVKGKLKDVAGRLQKLADGS* |
| Ga0134085_105284881 | 3300015359 | Grasslands Soil | MIRADKKDPLSVIRAELNGMALHVAKSGYTADVKTKLRDAATKLQKLAEG* |
| Ga0134112_100959982 | 3300017656 | Grasslands Soil | MIRVDKKDPLSTIRAELNSLALHVAKSGYNAEVKGKLREVAGQLQKLAESS |
| Ga0187803_103543052 | 3300017934 | Freshwater Sediment | VIRAELNGLALQIAKSGYSPDVKSKLREAAAQIQKLAERQ |
| Ga0066667_101198832 | 3300018433 | Grasslands Soil | MIRADKKDPLSVIRAELNNVALLAAKNGYTSDVKTKLRDAATKLQKLAEG |
| Ga0066662_100388263 | 3300018468 | Grasslands Soil | VDKKDPLSVIRSELNSLALHVAKSGYNAEVKGKLKDVAGRLQKLADGS |
| Ga0066662_117885511 | 3300018468 | Grasslands Soil | MIRVDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREAAARLQKLAEQP |
| Ga0066669_100318832 | 3300018482 | Grasslands Soil | VDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREAASRLQKLAEQP |
| Ga0066669_110106471 | 3300018482 | Grasslands Soil | VDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKIREAAARLQKLAEQP |
| Ga0215015_106189081 | 3300021046 | Soil | MIRVDKKDPLSMIRAELNSLALHVAKSGYNAEVKGKLREVAGRLQKLAEGS |
| Ga0210404_100107175 | 3300021088 | Soil | MIRVDKKDPLSIIRADLNSLALHVAKSGYNAEVKGKLREVAGRLQKLAEGS |
| Ga0210404_101464741 | 3300021088 | Soil | MIRVDKKDPLSTIRAELNSLALHVAKSGYNAEVKGKLREVAGRLQKLAEGS |
| Ga0137417_14388188 | 3300024330 | Vadose Zone Soil | MIRVDKKDPLSVIRSELNSLALHVAKAGYNAEVKGKLREAAARLQKLAEQP |
| Ga0207646_10000003203 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRVDKKDPLSAIRAELNSLALHVAKSGYNAEVKGKLREIAVRMQKLAE |
| Ga0207646_100063838 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRVDKKDPLSTIRAELNSLALHVAKSGYNAEVKGKLREVAGQLQKLAEGS |
| Ga0207646_100164891 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRVDKKDPLSVIRADLNSLALHVAKSGYNAEVKGKLREVAARMQKLAEG |
| Ga0207646_100944712 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLRDVSGRLQKLAEGS |
| Ga0209234_12232961 | 3300026295 | Grasslands Soil | PLSVIRAELNSLALHVAKSGYNAEVKGKLREAAARLQKLGEQP |
| Ga0209234_12238351 | 3300026295 | Grasslands Soil | PLSVIRAELNSLALHVAKSGYNAEVKGKLREAASRLQKLAEQP |
| Ga0209235_100011732 | 3300026296 | Grasslands Soil | VDKKDPLSVIRAELNSLALHVAKAGYNTEVKGKLREAAARLQKLAEQP |
| Ga0209235_10050487 | 3300026296 | Grasslands Soil | VDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREAAARLQKLAEQP |
| Ga0209235_10227923 | 3300026296 | Grasslands Soil | MIRVDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKIREAAARLQKLAEQP |
| Ga0209235_10299961 | 3300026296 | Grasslands Soil | CFGGMIRVDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREAAARLQKLGEQP |
| Ga0209237_10010609 | 3300026297 | Grasslands Soil | VDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREAAARLQKLGEQP |
| Ga0209237_10285415 | 3300026297 | Grasslands Soil | CQTCFGGMIRADKKDPLSVIRAELNNVALLAAKNGYTSDVKTKLRDAATKLQKLAEG |
| Ga0209236_10236244 | 3300026298 | Grasslands Soil | MIRVDKKDPLSVIRSELNSLALHVAKSGYNAEVKGKLKDVAGRLQKLADGS |
| Ga0209238_11077982 | 3300026301 | Grasslands Soil | MIRADKKDPLSVIRAELNNVALLAAKNGYTSDVKTKLRDAAT |
| Ga0209469_10014833 | 3300026307 | Soil | MIRADKKDPLSVIRAELNNVALLVAKNGYTSDVKTKLRDAATKLQKLAEG |
| Ga0209761_11267371 | 3300026313 | Grasslands Soil | MIRVDKKDPLSVIRAELNSLALHVAKSGYNTEVKGKLREAAARLQKLAEQP |
| Ga0209268_10878631 | 3300026314 | Soil | CQTCCGGMIRADKKDPFSVIRAELNNVALLVAKNGYTSDVKTKLRDAATKLQKLAEG |
| Ga0209154_10051996 | 3300026317 | Soil | AWVCQTCFGGMIRVDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREAAARLQKLAEQ |
| Ga0209471_10516903 | 3300026318 | Soil | GMIRVDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREAATRLQKLAEQP |
| Ga0209470_10146074 | 3300026324 | Soil | MIRADKKDPFSVIRAELNNVALLVAKNGYTSDVKTKLRDAATKLQKLAEG |
| Ga0209801_10170833 | 3300026326 | Soil | MIRVDKKDPLSVIRAELNSLALHVAKAGYNTEVKGKLREAAARLQKLAEQP |
| Ga0209801_12918422 | 3300026326 | Soil | CFGGMIRVDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREAASRLQKLAEQP |
| Ga0209803_10316934 | 3300026332 | Soil | VDKKDPLSVIRSELNSLALHVAKAGYNAEVKGKLREAAARLQKLAEQP |
| Ga0209803_10553462 | 3300026332 | Soil | MIRVDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREAASRLQKLAEQP |
| Ga0209057_10151854 | 3300026342 | Soil | MIRADKKDPLSVLRAELNNVALLVAKNGYTSDVKTKLRDAATKLQKLAEG |
| Ga0209057_11823381 | 3300026342 | Soil | MIRADKKDPLSVIRAELNTMALHVAKSGYTADVKTKLRDAATKLQKLAEG |
| Ga0209159_11992581 | 3300026343 | Soil | MIRADKKDPLSVIRAELNGMALHVAKSGYTADVKTKLRDAATKLQKLAEG |
| Ga0209690_10844751 | 3300026524 | Soil | VDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLRDAAARLQKLGEQP |
| Ga0209806_10723451 | 3300026529 | Soil | CFGGMIRVDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKIREAAARLQKLAEQP |
| Ga0209160_10978511 | 3300026532 | Soil | VDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREAAARLQ |
| Ga0209156_102362571 | 3300026547 | Soil | MIRADKKDPLSVIRAELNTMALHVAKSGYTADVKTKLRDAATKLQTLAEG |
| Ga0209161_101828222 | 3300026548 | Soil | KKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREAAARLQKLGEQP |
| Ga0209161_103474422 | 3300026548 | Soil | VDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREAAARLQKL |
| Ga0209161_105078001 | 3300026548 | Soil | PLSVIRAELNSLALHVAKSGYNAEVKGKLREAAARLQKLAEQP |
| Ga0209648_100196555 | 3300026551 | Grasslands Soil | MIRVDKKDPLSTIRAELNSLALHVAKSGYNAEVKGKLREVAGRLQKLAESS |
| Ga0209076_11939162 | 3300027643 | Vadose Zone Soil | GGMIRVDKKDPLSTIRAELNSLALHVAKSGYNAEVKGKLREVAGQLQKLAEGS |
| Ga0209388_11084082 | 3300027655 | Vadose Zone Soil | MIRVDKKDPLSTIRAELNSLALHVAKSGYNAEVKGKLREVAGQLQK |
| Ga0209178_12912302 | 3300027725 | Agricultural Soil | MIRVDKKDPLSAIRAELNSLALHVAKSGYNAEVKGKLREISVRMQKLAE |
| Ga0209283_100036225 | 3300027875 | Vadose Zone Soil | VDKKDPLSAIRAELNSLALHVAKAGYNAEVKGKLREAAGRLQKLAEQP |
| Ga0209283_101102083 | 3300027875 | Vadose Zone Soil | MIRVDKKDPLSTIRAELNSLALHVAKSGYNAEVKGKLGEVAGQLQKLAEGS |
| Ga0209283_101651002 | 3300027875 | Vadose Zone Soil | MIRVDKKDPLSVIRSELNSLALHVAKSGYNAEVKGKLREVAGRLQKLAEGS |
| Ga0137415_102322612 | 3300028536 | Vadose Zone Soil | MIRVDKKDPLSTIRAELNSLALHVAKSGYNAEVKGKLREVAGQLQKLAEGA |
| Ga0137415_103865142 | 3300028536 | Vadose Zone Soil | MIRVDKKDPLSVIRAELNSLALHVAKSGYNAEVKGKLREVAGQLQKLAEGS |
| Ga0307469_100042791 | 3300031720 | Hardwood Forest Soil | MIRVDKKDPLSTIRAELNSLALHVAKSGYNAEVKGKLRKVAGQLQKLAEGS |
| Ga0307469_100177352 | 3300031720 | Hardwood Forest Soil | MIRVDKRDPLSAIRAELNSLALHVAKSGYNAEVKGKLREIAVRMQKLAEGT |
| Ga0307469_101779681 | 3300031720 | Hardwood Forest Soil | MIRVDKKDPLSAIRAELNSLALHVAKSGYNAEVKGKLREIAVRMQKLAEGT |
| Ga0307479_100691282 | 3300031962 | Hardwood Forest Soil | MIRVDKKDPLSAIRAELNSLALHVAKSGYNAETKGKIREIAVRMQKLAE |
| Ga0307471_1000267203 | 3300032180 | Hardwood Forest Soil | VDKKDPLSTIRAELNSLALHVAKSGYNAEVKGKLRDVAARMQKLAESS |
| Ga0307471_1009783042 | 3300032180 | Hardwood Forest Soil | MIRVDKKDPLSIIRSELNSLALHVAKSGYSAEVKGKLRDVAGRLQKLAEGT |
| Ga0307471_1012360572 | 3300032180 | Hardwood Forest Soil | VDKKDPLSAIRAELNSLALHVAKSGYNAEVKGKLRDVAARMQKLAESS |
| ⦗Top⦘ |