| Basic Information | |
|---|---|
| Family ID | F036618 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 169 |
| Average Sequence Length | 39 residues |
| Representative Sequence | GPGDKVPNVNGTPIHGPVRLNDGDLIEVSGVRLNFIFRE |
| Number of Associated Samples | 137 |
| Number of Associated Scaffolds | 169 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.82 % |
| % of genes from short scaffolds (< 2000 bps) | 82.84 % |
| Associated GOLD sequencing projects | 130 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.083 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (19.527 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.811 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.621 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 17.91% Coil/Unstructured: 82.09% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 169 Family Scaffolds |
|---|---|---|
| PF05226 | CHASE2 | 59.76 |
| PF00873 | ACR_tran | 19.53 |
| PF03150 | CCP_MauG | 1.18 |
| PF12700 | HlyD_2 | 0.59 |
| PF00498 | FHA | 0.59 |
| PF13533 | Biotin_lipoyl_2 | 0.59 |
| PF05036 | SPOR | 0.59 |
| COG ID | Name | Functional Category | % Frequency in 169 Family Scaffolds |
|---|---|---|---|
| COG4252 | Extracytoplasmic sensor domain CHASE2 (specificity unknown) | Signal transduction mechanisms [T] | 59.76 |
| COG1858 | Cytochrome c peroxidase | Posttranslational modification, protein turnover, chaperones [O] | 1.18 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.08 % |
| Unclassified | root | N/A | 5.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101304099 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 992 | Open in IMG/M |
| 3300000955|JGI1027J12803_106353367 | All Organisms → cellular organisms → Bacteria | 3546 | Open in IMG/M |
| 3300001089|JGI12683J13190_1001834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_61_5 | 2994 | Open in IMG/M |
| 3300001565|A35518A_1025586 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300002910|JGI25615J43890_1000623 | All Organisms → cellular organisms → Bacteria | 4336 | Open in IMG/M |
| 3300005178|Ga0066688_10617794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 696 | Open in IMG/M |
| 3300005184|Ga0066671_10321770 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300005332|Ga0066388_106043680 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300005450|Ga0066682_10801829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300005561|Ga0066699_10187127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1435 | Open in IMG/M |
| 3300005569|Ga0066705_10339093 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300005764|Ga0066903_102981347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 917 | Open in IMG/M |
| 3300005764|Ga0066903_104487875 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300005921|Ga0070766_10567792 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300006102|Ga0075015_100059404 | All Organisms → cellular organisms → Bacteria | 1832 | Open in IMG/M |
| 3300006102|Ga0075015_100421797 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300006796|Ga0066665_10175352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | 1646 | Open in IMG/M |
| 3300006797|Ga0066659_10430493 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1044 | Open in IMG/M |
| 3300006806|Ga0079220_10032722 | All Organisms → cellular organisms → Bacteria | 2320 | Open in IMG/M |
| 3300006854|Ga0075425_100656249 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1206 | Open in IMG/M |
| 3300007255|Ga0099791_10110348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1271 | Open in IMG/M |
| 3300007265|Ga0099794_10019117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_61_5 | 3081 | Open in IMG/M |
| 3300007265|Ga0099794_10390378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300009038|Ga0099829_11119135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300009038|Ga0099829_11688003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300009088|Ga0099830_10442168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1055 | Open in IMG/M |
| 3300009088|Ga0099830_11530581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 555 | Open in IMG/M |
| 3300009088|Ga0099830_11563879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 549 | Open in IMG/M |
| 3300009089|Ga0099828_10188833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1835 | Open in IMG/M |
| 3300009092|Ga0105250_10307328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300009137|Ga0066709_101993645 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300009615|Ga0116103_1085822 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300010046|Ga0126384_11135551 | Not Available | 718 | Open in IMG/M |
| 3300010048|Ga0126373_10049227 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3739 | Open in IMG/M |
| 3300010321|Ga0134067_10018090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2092 | Open in IMG/M |
| 3300010325|Ga0134064_10218860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 691 | Open in IMG/M |
| 3300010335|Ga0134063_10186556 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300010339|Ga0074046_10307447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 973 | Open in IMG/M |
| 3300010360|Ga0126372_13149883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300010366|Ga0126379_12235379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 648 | Open in IMG/M |
| 3300010376|Ga0126381_100106369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3596 | Open in IMG/M |
| 3300010398|Ga0126383_11238796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
| 3300011271|Ga0137393_10188478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia bryophila | 1737 | Open in IMG/M |
| 3300011271|Ga0137393_11331251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300012189|Ga0137388_11136651 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300012201|Ga0137365_11215997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300012205|Ga0137362_10230764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1597 | Open in IMG/M |
| 3300012205|Ga0137362_11546346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 550 | Open in IMG/M |
| 3300012209|Ga0137379_10104463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2726 | Open in IMG/M |
| 3300012211|Ga0137377_11010075 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300012362|Ga0137361_10105513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_61_5 | 2459 | Open in IMG/M |
| 3300012362|Ga0137361_11958297 | Not Available | 502 | Open in IMG/M |
| 3300012683|Ga0137398_10573647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
| 3300012923|Ga0137359_10130459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2234 | Open in IMG/M |
| 3300012927|Ga0137416_11018967 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300012931|Ga0153915_10630046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1235 | Open in IMG/M |
| 3300012931|Ga0153915_10866478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1049 | Open in IMG/M |
| 3300012944|Ga0137410_10004665 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9329 | Open in IMG/M |
| 3300012971|Ga0126369_10614035 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300012971|Ga0126369_12755214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300015054|Ga0137420_1494005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2523 | Open in IMG/M |
| 3300015264|Ga0137403_11151358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300016270|Ga0182036_10874764 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300016319|Ga0182033_12092725 | Not Available | 516 | Open in IMG/M |
| 3300016341|Ga0182035_10664360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 905 | Open in IMG/M |
| 3300017659|Ga0134083_10461461 | Not Available | 563 | Open in IMG/M |
| 3300017822|Ga0187802_10413722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300017823|Ga0187818_10232153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300017930|Ga0187825_10386821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300017933|Ga0187801_10415368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300017944|Ga0187786_10141813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 858 | Open in IMG/M |
| 3300017959|Ga0187779_11271426 | Not Available | 520 | Open in IMG/M |
| 3300017973|Ga0187780_10738015 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300017975|Ga0187782_11066150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300018015|Ga0187866_1042613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2108 | Open in IMG/M |
| 3300018088|Ga0187771_11076144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300018088|Ga0187771_11910510 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300018090|Ga0187770_10034794 | All Organisms → cellular organisms → Bacteria | 3550 | Open in IMG/M |
| 3300018090|Ga0187770_11790827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300018433|Ga0066667_10273344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1296 | Open in IMG/M |
| 3300018468|Ga0066662_10300159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1349 | Open in IMG/M |
| 3300018468|Ga0066662_11181240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 773 | Open in IMG/M |
| 3300018482|Ga0066669_11660334 | Not Available | 585 | Open in IMG/M |
| 3300019789|Ga0137408_1410658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2127 | Open in IMG/M |
| 3300020580|Ga0210403_11345641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300020581|Ga0210399_10274554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1407 | Open in IMG/M |
| 3300020583|Ga0210401_10043389 | All Organisms → cellular organisms → Bacteria | 4257 | Open in IMG/M |
| 3300021168|Ga0210406_10308971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1284 | Open in IMG/M |
| 3300021180|Ga0210396_10905833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300021180|Ga0210396_10988627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300021402|Ga0210385_10856710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300021404|Ga0210389_10038722 | All Organisms → cellular organisms → Bacteria | 3658 | Open in IMG/M |
| 3300021404|Ga0210389_10128770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1958 | Open in IMG/M |
| 3300021405|Ga0210387_10494667 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300021407|Ga0210383_10444543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1119 | Open in IMG/M |
| 3300021433|Ga0210391_11407256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 536 | Open in IMG/M |
| 3300021479|Ga0210410_10632825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 948 | Open in IMG/M |
| 3300021559|Ga0210409_10117498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_61_5 | 2447 | Open in IMG/M |
| 3300021559|Ga0210409_10142572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2197 | Open in IMG/M |
| 3300021559|Ga0210409_10561079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
| 3300024227|Ga0228598_1098987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 588 | Open in IMG/M |
| 3300024323|Ga0247666_1038152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 990 | Open in IMG/M |
| 3300025905|Ga0207685_10252214 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300025916|Ga0207663_10181405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1504 | Open in IMG/M |
| 3300026318|Ga0209471_1025603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_61_5 | 2931 | Open in IMG/M |
| 3300026320|Ga0209131_1142935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1220 | Open in IMG/M |
| 3300026335|Ga0209804_1114041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1231 | Open in IMG/M |
| 3300026342|Ga0209057_1212985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300026490|Ga0257153_1111914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300026514|Ga0257168_1082056 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300026523|Ga0209808_1237293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300026557|Ga0179587_10003491 | All Organisms → cellular organisms → Bacteria | 7610 | Open in IMG/M |
| 3300026557|Ga0179587_10896786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300026557|Ga0179587_11106449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300026868|Ga0207818_1024925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300026880|Ga0209623_1016387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300026942|Ga0207783_1005722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia bryophila | 1303 | Open in IMG/M |
| 3300027074|Ga0208092_108484 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300027587|Ga0209220_1020365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1772 | Open in IMG/M |
| 3300027643|Ga0209076_1041440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1297 | Open in IMG/M |
| 3300027671|Ga0209588_1276954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300027681|Ga0208991_1146224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300027738|Ga0208989_10084430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1085 | Open in IMG/M |
| 3300027765|Ga0209073_10013689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2262 | Open in IMG/M |
| 3300027821|Ga0209811_10163389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
| 3300027846|Ga0209180_10271688 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300027855|Ga0209693_10291919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
| 3300027879|Ga0209169_10563661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 597 | Open in IMG/M |
| 3300027882|Ga0209590_10883692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 564 | Open in IMG/M |
| 3300027889|Ga0209380_10482519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300027895|Ga0209624_10108896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1813 | Open in IMG/M |
| 3300027898|Ga0209067_10439228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300028781|Ga0302223_10160675 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300030524|Ga0311357_10619055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 994 | Open in IMG/M |
| 3300030879|Ga0265765_1013941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 923 | Open in IMG/M |
| 3300030945|Ga0075373_11565971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 823 | Open in IMG/M |
| 3300030991|Ga0073994_10010994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2260 | Open in IMG/M |
| 3300031231|Ga0170824_107731045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300031231|Ga0170824_125336626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1825 | Open in IMG/M |
| 3300031231|Ga0170824_125357194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 515 | Open in IMG/M |
| 3300031715|Ga0307476_10924044 | Not Available | 644 | Open in IMG/M |
| 3300031718|Ga0307474_11587093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300031720|Ga0307469_10868527 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
| 3300031736|Ga0318501_10315680 | Not Available | 836 | Open in IMG/M |
| 3300031744|Ga0306918_10226382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia bryophila | 1419 | Open in IMG/M |
| 3300031753|Ga0307477_10983522 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300031765|Ga0318554_10310234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
| 3300031879|Ga0306919_10025547 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3647 | Open in IMG/M |
| 3300031879|Ga0306919_10504037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia bryophila | 933 | Open in IMG/M |
| 3300031879|Ga0306919_11290370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 553 | Open in IMG/M |
| 3300031879|Ga0306919_11528807 | Not Available | 502 | Open in IMG/M |
| 3300031941|Ga0310912_11134869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300031942|Ga0310916_10131116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2050 | Open in IMG/M |
| 3300031942|Ga0310916_10278274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia bryophila | 1414 | Open in IMG/M |
| 3300031962|Ga0307479_10066979 | All Organisms → cellular organisms → Bacteria | 3463 | Open in IMG/M |
| 3300031962|Ga0307479_10526557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1165 | Open in IMG/M |
| 3300031962|Ga0307479_10829693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 899 | Open in IMG/M |
| 3300031962|Ga0307479_11007905 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300031962|Ga0307479_11023355 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300032001|Ga0306922_10409236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1452 | Open in IMG/M |
| 3300032001|Ga0306922_10538987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1241 | Open in IMG/M |
| 3300032052|Ga0318506_10393728 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300032091|Ga0318577_10006931 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4275 | Open in IMG/M |
| 3300032174|Ga0307470_10283120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1114 | Open in IMG/M |
| 3300032180|Ga0307471_100325448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1636 | Open in IMG/M |
| 3300032180|Ga0307471_102862773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300032261|Ga0306920_103366080 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300032898|Ga0335072_11452839 | Not Available | 589 | Open in IMG/M |
| 3300033004|Ga0335084_10030606 | All Organisms → cellular organisms → Bacteria | 5506 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.51% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.73% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.73% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.14% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.37% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.37% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.37% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.78% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.18% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.18% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.18% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.18% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.18% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.59% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.59% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.59% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.59% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.59% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.59% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.59% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001089 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 | Environmental | Open in IMG/M |
| 3300001565 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-5cm-18A)- 1 week illumina new | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009615 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026868 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 32 (SPAdes) | Environmental | Open in IMG/M |
| 3300026880 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026942 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 63 (SPAdes) | Environmental | Open in IMG/M |
| 3300027074 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028781 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3 | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030945 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1013040992 | 3300000364 | Soil | GSGDKIPVVNGVAIPGPTRLNDGDLVELSGVRLNFIVRE* |
| JGI1027J12803_1063533676 | 3300000955 | Soil | PGDKVPTVNGAPIQGPVRLNDGDLIEVSGVRLNFIFRE* |
| JGI12683J13190_10018341 | 3300001089 | Forest Soil | GYYIGPGDKTPLVNSKPIQGPVRLNDGDVIEICGLRLSFVFRE* |
| A35518A_10255861 | 3300001565 | Permafrost | KVPSVNGAPITGQVLLKDGDKIAVSGVRLHFIFRD* |
| JGI25615J43890_10006233 | 3300002910 | Grasslands Soil | GYYIGPGDKTPLVNSKPIQGPARLNDGDVIEICGLRLSFSFRE* |
| Ga0066688_106177942 | 3300005178 | Soil | GPGDKVPSVNGRFIGGPTRLNDGDLIEVSGVKLNFIFRE* |
| Ga0066671_103217703 | 3300005184 | Soil | LGPGDKVPSVNGRPIGGPTRLNDGDLIDVSGVKLNFIFRE* |
| Ga0066388_1060436802 | 3300005332 | Tropical Forest Soil | GYYLGTGTKIPVVNGSPIPGPVRLNDGDLIEICGVRMNFVIRE* |
| Ga0066682_108018291 | 3300005450 | Soil | GPGDKTPNINGTPIAGPVRLNDGDLVEVSGVRLNFVFRG* |
| Ga0066699_101871272 | 3300005561 | Soil | VPSVNGRPIGGPTRLNDGDVIEVSGVRLNFIFRE* |
| Ga0066705_103390932 | 3300005569 | Soil | GDKVPSINGKPITGPVRLNDGDLVEVSGVRLNFVFRE* |
| Ga0066903_1029813471 | 3300005764 | Tropical Forest Soil | KIPVVNGSPIPGPVRLNDGDTIEICGVRMNFVIRE* |
| Ga0066903_1044878752 | 3300005764 | Tropical Forest Soil | FLGPGDKVPSVNGRLIGGPTRLNTGDVIEVSGVKLNFIFRE* |
| Ga0070766_105677922 | 3300005921 | Soil | GPGDKVPNVNGTPIHGPVRLNDGDLIEVSGVRLNFIFRE* |
| Ga0075015_1000594044 | 3300006102 | Watersheds | VGPGDKTPAVNGTPIPGPTKLNSGDVIEVSGVRLNFVIRE* |
| Ga0075015_1004217972 | 3300006102 | Watersheds | GDKVPVVNGNPISGTVRLNDGDLIEVCGVRMNFIFRE* |
| Ga0066665_101753522 | 3300006796 | Soil | YYLGPGDKVPKINGAPVSGPVRLNDGDLVEVSGVRLNFIFRE* |
| Ga0066659_104304933 | 3300006797 | Soil | YYIGPGDKVPKVNGTPVSGPVRLNDGDLVEVSGVRLNFIFRE* |
| Ga0079220_100327221 | 3300006806 | Agricultural Soil | GPGDKVPTVNGRLIGGPTRLNDGDLIEVSGVKLNFIFRE* |
| Ga0075425_1006562492 | 3300006854 | Populus Rhizosphere | GYYVGSGAKVPAVNGVAISGPTKLNDGDLIEVAGIRLNFIVRE* |
| Ga0099791_101103482 | 3300007255 | Vadose Zone Soil | LGPGDKVPNVNGTPISGPVRLNDGDLVEVSGVRLNFIFRE* |
| Ga0099794_100191171 | 3300007265 | Vadose Zone Soil | KVPNINGTPISGPVRLNDGDLLEVSGVRLNFIFRE* |
| Ga0099794_103903782 | 3300007265 | Vadose Zone Soil | YLGPGDKVPRINGNPISGPVRLNDGDLVEVSGVRLNFLFRE* |
| Ga0099829_111191352 | 3300009038 | Vadose Zone Soil | DGYYLGPGDKMPSINGTPISGPVRLSDGDIVEVSGVRLNFIFRE* |
| Ga0099829_116880032 | 3300009038 | Vadose Zone Soil | KVPRVNGTPITGTVRLNDGDLIEICGVRMNFIFRE* |
| Ga0099830_104421681 | 3300009088 | Vadose Zone Soil | KVPKVNGTPVSGPVRLNDGDLVEVSGVRLNFIFRE* |
| Ga0099830_115305811 | 3300009088 | Vadose Zone Soil | TPSVNGVRLRGTLRLTDGDVIEVCGVRMNFLFRK* |
| Ga0099830_115638793 | 3300009088 | Vadose Zone Soil | GPGDKVPSVNGRPIRGPVRLNDGDLIEVSGVRLNFIFRE* |
| Ga0099828_101888332 | 3300009089 | Vadose Zone Soil | LGPGDKVPIVNGTPIPGPVRLSDGDVIQVSGVRLSFVFRE* |
| Ga0105250_103073282 | 3300009092 | Switchgrass Rhizosphere | GSGARVPAVNGVAIPGPTRLNDGDLIEVAGIRLNFIVRE* |
| Ga0066709_1019936452 | 3300009137 | Grasslands Soil | SGDKVPSINGKPITGPVRLNDGDLVEVSGVRLNFVFRE* |
| Ga0116103_10858221 | 3300009615 | Peatland | TGDKVPTVNSTPIPGPTRLNDGDLIEICGVRLNFIFRE* |
| Ga0126384_111355511 | 3300010046 | Tropical Forest Soil | GPGDKVPKVNGAPITGPKKLNDGDVIEVSGLRMNFIFRE* |
| Ga0126373_100492273 | 3300010048 | Tropical Forest Soil | KIPSVNGNPIPGPTKLNDGDLIEVAGVRLNFIVRE* |
| Ga0134067_100180902 | 3300010321 | Grasslands Soil | YLGAGDKVPKINGAPISGQVRLNDGDLVEVCGVRLNFVFRE* |
| Ga0134064_102188602 | 3300010325 | Grasslands Soil | DKVPSINGKPITGPVRLNDGDLVEVSGVRLNFVFRE* |
| Ga0134063_101865562 | 3300010335 | Grasslands Soil | GSGDKVPSINGKPITGPVRLNDGDLVEVSGVRLNFVFRE* |
| Ga0074046_103074472 | 3300010339 | Bog Forest Soil | GYYLVAGDKIPSVNAAPISGPVRLNDGDLIEICGVRVNFIFRE* |
| Ga0126372_131498831 | 3300010360 | Tropical Forest Soil | VPTVNGTPIPGPVRLNDGDVIEVAGMRLNFIFRD* |
| Ga0126379_122353791 | 3300010366 | Tropical Forest Soil | DKVPLVNGRLIGGPTRLNTGDVIEVSGVKLNFIFRE* |
| Ga0126381_1001063691 | 3300010376 | Tropical Forest Soil | VPSVNGSPIHGPIRLNDGDVIEVCGVGLNFIFRE* |
| Ga0126383_112387962 | 3300010398 | Tropical Forest Soil | TGDTVPMVNGTPIPGTVRLNDGDLIEVCGVRMNFIFRE* |
| Ga0137393_101884781 | 3300011271 | Vadose Zone Soil | KVPSVNGRPIRGPVRLNDGDLIEVSGVRLNFIFRE* |
| Ga0137393_113312511 | 3300011271 | Vadose Zone Soil | DDGYYLGPGDKVPKVNGTPVSGPVRLNDGDLVEVSGVRLNFIFRE* |
| Ga0137388_111366511 | 3300012189 | Vadose Zone Soil | YYIGPGDKTPLVNSKPIQGPVRLNDGDVIEVCGLRLSFAFRE* |
| Ga0137365_112159972 | 3300012201 | Vadose Zone Soil | GDKTPNINGTPIAGPVRLNDGDLVEVSGVRLNFVFRG* |
| Ga0137362_102307642 | 3300012205 | Vadose Zone Soil | DGYYLGPGDKAPKINGKSISGPVRLNDGDLIEVSGVRLNFIFRE* |
| Ga0137362_115463462 | 3300012205 | Vadose Zone Soil | DKVPSVNGRPIRGPVRLNDGDLIEVSGVRLNFIFRE* |
| Ga0137379_101044633 | 3300012209 | Vadose Zone Soil | DGYFLGPGDKVPSVNGRPIGGPTRLNDGDLIEVSGVKLNFIYRE* |
| Ga0137377_110100752 | 3300012211 | Vadose Zone Soil | GYYLGPGDKVPSVNGRPIRGPVRLNDGDLIEVSGVRLNFIFRE* |
| Ga0137361_101055131 | 3300012362 | Vadose Zone Soil | GDKTPLVNSKPIQGPARLNDGDVIEVCGLRLSFVFRE* |
| Ga0137361_119582971 | 3300012362 | Vadose Zone Soil | DKTPRVNSKPIHGPVRLNDGDVIEICGLRLSFVFRE* |
| Ga0137398_105736471 | 3300012683 | Vadose Zone Soil | GYYLGPGDKVPNVNGAPIAGPVRLNDGDLVEVSGVRLSFIFRE* |
| Ga0137359_101304591 | 3300012923 | Vadose Zone Soil | GYYIGPGDKIPTLNGAPIPGPTRLNDGDIVEVCGIRMNFIFRE* |
| Ga0137416_110189671 | 3300012927 | Vadose Zone Soil | IGPADKTPLVNDKPIQGPVRLNDGDVIEVCGLRLNFLFRE* |
| Ga0153915_106300462 | 3300012931 | Freshwater Wetlands | GPGDKIPTVNGMPIHGPTRLNDGDLIEVCGVRLNFFFRE* |
| Ga0153915_108664781 | 3300012931 | Freshwater Wetlands | GDKIPTVNGMPIHGPTRLNDGDLIEVCGVRLNFFFRE* |
| Ga0137410_100046656 | 3300012944 | Vadose Zone Soil | PGDKLPNINGTPISGQVRLNDGDLVEISGVRLNFIFRE* |
| Ga0126369_106140351 | 3300012971 | Tropical Forest Soil | RDDGYFLGPGDKVPSVNGRLIGGPTRLNTGDVIEVSGVKLNFIFRE* |
| Ga0126369_127552142 | 3300012971 | Tropical Forest Soil | LGPGDKVPSVNGRAIAGPTRLNDGDLIEVSGVKLNFIFRE* |
| Ga0137420_14940054 | 3300015054 | Vadose Zone Soil | VPNINGTPISGPVRLNDGDLVEVSGVRLNFIFRE* |
| Ga0137403_111513581 | 3300015264 | Vadose Zone Soil | YYLGPGDKVPTINGSPIQGPVRLNDGDLIEVSGVRLNFIFRE* |
| Ga0182036_108747641 | 3300016270 | Soil | YYLGTGTKIPVVNGSPIPGPVRLNDGDLIEICGVRMNFVIRE |
| Ga0182033_120927252 | 3300016319 | Soil | YYLGTGSKIPSVNGAPIQGPVRLNDGDLIEISGIRMNFVFRE |
| Ga0182035_106643602 | 3300016341 | Soil | QIPAVNGVAIGGPTKLNDGDLIEVAGIRVNFIVRE |
| Ga0134083_104614611 | 3300017659 | Grasslands Soil | DKVPSINGKPITGPVRLSDGDLVEVSGVRLNFVFRE |
| Ga0187802_104137221 | 3300017822 | Freshwater Sediment | GDKMPLVNGKPIPGPSRLNDGDLTEVCRVRMNFVYRE |
| Ga0187818_102321531 | 3300017823 | Freshwater Sediment | LGPGDKTPTVNGTLIPGPVRLNDGDLIEVSGVRLNFIFRE |
| Ga0187825_103868212 | 3300017930 | Freshwater Sediment | FYIGPGDKVPSVNGSPIHGPLRLSDGDVIEVSGVRLNFIFRE |
| Ga0187801_104153682 | 3300017933 | Freshwater Sediment | GDKVPTVNGTPIPGTVRLNDGDLIEVCGVRLNFIFRE |
| Ga0187786_101418131 | 3300017944 | Tropical Peatland | GDKVPSVNGTPIPGTVRLNDGDLIEVCGVRMNFIFRE |
| Ga0187779_112714261 | 3300017959 | Tropical Peatland | KIPSVNGKPITSPVRLNDGDVIEVCGVKLNFIVRE |
| Ga0187780_107380151 | 3300017973 | Tropical Peatland | DGYYLGTGDKVPTINGTPIQGSTRLNDGDLIEVCGVRLNFIFRE |
| Ga0187782_110661501 | 3300017975 | Tropical Peatland | YLGPGDKVPSVNGTPIPGPVRLNDGDLIEVSGIKLNFIFRE |
| Ga0187866_10426131 | 3300018015 | Peatland | GAGERTPTLNYMPIHGPTRLNDGDMIEVCGVRMSFLIRE |
| Ga0187771_110761442 | 3300018088 | Tropical Peatland | GTGAKIPMVNGSPIQGPVRLNDGDLIEVCGIRMNFVFRE |
| Ga0187771_119105101 | 3300018088 | Tropical Peatland | TGDKVPTINGTPIQGSTRLNDGDLIEVCGVRLNFIFRE |
| Ga0187770_100347941 | 3300018090 | Tropical Peatland | LGTGDKVPTINGTPIQGSTRLNDGDLIEVCGVRLNFIFRE |
| Ga0187770_117908272 | 3300018090 | Tropical Peatland | DKVPSVNGTPIPGPVRLNDGDLIEVSGIKLNFIFRE |
| Ga0066667_102733443 | 3300018433 | Grasslands Soil | RYGGYFLGPGDKVPSVNGRPIGGPTRLNDGDLIEVSGVKLNFIFRE |
| Ga0066662_103001591 | 3300018468 | Grasslands Soil | YYLGPGDKVPKVNDTPVSGPVRLNDGDLIEVSAVRLSFIFRE |
| Ga0066662_111812402 | 3300018468 | Grasslands Soil | GDKVPSVNGRLIGGPTRLNDGDLIEVSGVKLNFIFRE |
| Ga0066669_116603341 | 3300018482 | Grasslands Soil | KVPSINGKPITGPVRLNDGDLVEVSGVRLNFVFRE |
| Ga0137408_14106582 | 3300019789 | Vadose Zone Soil | PGAKTPAVNGTPIAGPVRLNDGDLIEVSGVRMNFIFRE |
| Ga0210403_113456411 | 3300020580 | Soil | SGDKIPTVNGTPISGTVRLNDGDLIDVCGVRLNFIFRE |
| Ga0210399_102745541 | 3300020581 | Soil | KMPTVNGAPITGPVRLNDGDVIEISGVRMNFIFRE |
| Ga0210401_100433891 | 3300020583 | Soil | KTPLVNDKPIHGPARLNDGDVIEICGLRLNFLFRE |
| Ga0210406_103089712 | 3300021168 | Soil | PGDKMPTVNGVPITGPARLSDGDVIEVSGVRMNFIFRE |
| Ga0210396_109058331 | 3300021180 | Soil | SKIPTVNGAPIQGAVRLNDGDLIEVCGIRMNFIVRE |
| Ga0210396_109886272 | 3300021180 | Soil | GDKVPTVNGTPITGTVRLNDGDLIEICGVRMNFIFRE |
| Ga0210385_108567102 | 3300021402 | Soil | GDKVPNVNGTPIPGPVRLSDGDLIEVSGVRLNFIFRE |
| Ga0210389_100387223 | 3300021404 | Soil | KMPTVNGTAITGPVRLNDGDVIEVCGVRMNFIFRE |
| Ga0210389_101287701 | 3300021404 | Soil | DGYYIGPGDKMPTVNGTPITGPVRLNDGDLIEVSGVRMNFIYRE |
| Ga0210387_104946672 | 3300021405 | Soil | GDKVPKVNGASITGPMRLNDGDVIEVTGLRMNFIFRE |
| Ga0210383_104445431 | 3300021407 | Soil | KMPTVNGTSITGPVRLNDGDLIEICGVRMNFVFRE |
| Ga0210391_114072561 | 3300021433 | Soil | FYLGPGDKVPNVNGTPIPGPVRLNDGDLIEVSGVRLNFIFRE |
| Ga0210410_106328251 | 3300021479 | Soil | DDGYYIGPGDKMPIVNGTPITGPVRLNDGDVIEVSGVRMNFIFRE |
| Ga0210409_101174982 | 3300021559 | Soil | LGPGDKTPLVNDKPIHGPARLNDGDVIEICGLRLNFLFRE |
| Ga0210409_101425722 | 3300021559 | Soil | GYYLGPGDKVPNINGAPISGPVRLNDGDLVEVSGVRLSFIFRE |
| Ga0210409_105610791 | 3300021559 | Soil | GDKVPTVNGMAISGPVRLNDGDLIEICGLRMNFVFRD |
| Ga0228598_10989871 | 3300024227 | Rhizosphere | GDKMPTVNGAPITGPVRLNDGDLIEVSGVRMNFVFRE |
| Ga0247666_10381522 | 3300024323 | Soil | YYIGPGDKMPLVNGKPITGPVRLNDGDVIEVGGARMNFVYRE |
| Ga0207685_102522142 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | YYLGPAAKTPLVNDKPIQGPVRLNNGDVIEVCGLRLNFLFRE |
| Ga0207663_101814051 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | DGYYIGSGDKIPVVNGVAIPGPTRLDDGDLVEVSGVRLNFIVRE |
| Ga0209471_10256032 | 3300026318 | Soil | GSGDKVPSINGKPITGPVRLNDGDLVEVSGVRLNFVFRE |
| Ga0209131_11429352 | 3300026320 | Grasslands Soil | GPGDKIPTVNGAPIHGPKRLNDGDIVEVCGVRMNFIFRE |
| Ga0209804_11140412 | 3300026335 | Soil | DKVPSINGKPITGPVRLNDGDLVEVSGVRLNFVFRE |
| Ga0209057_12129852 | 3300026342 | Soil | DGYYIGSGDKIPVVNGVAIPGPTRLNDGDVVELSGVRLNFIVRE |
| Ga0257153_11119141 | 3300026490 | Soil | RDDGYYIGSGDKVPVVNGVSIPGPTKLDDGDLVEVSGVRLNFIVRE |
| Ga0257168_10820562 | 3300026514 | Soil | YIGPGDKTPLVNSKPIHGPVRLNDGDVIEVCGLRLNFMFRE |
| Ga0209808_12372931 | 3300026523 | Soil | LGAGDKVPKINGAPISGQVRLNDGDLVEVCGVRLNFVFRE |
| Ga0179587_100034915 | 3300026557 | Vadose Zone Soil | LGPGDKVPRINGNPISGPVRLNDGDLVEVSGVRLNFIFRE |
| Ga0179587_108967862 | 3300026557 | Vadose Zone Soil | YYLGTGDKVPRVNGTPITGTVRLNDGDLIEICGVRMNFIFRE |
| Ga0179587_111064491 | 3300026557 | Vadose Zone Soil | KVPNINGTPISGPVRLNDGDLVEVSGVRLNFIFRE |
| Ga0207818_10249252 | 3300026868 | Tropical Forest Soil | KIPLVNGAPIQGPVRLNDGDLIEVSGIRMNFIFRE |
| Ga0209623_10163872 | 3300026880 | Forest Soil | LGAGDKVPSVNGSPIQGPVQLKDGDQVEVCGVRLNFIFRE |
| Ga0207783_10057222 | 3300026942 | Tropical Forest Soil | YYLGTGAKIPVVNGSPIPGPVRLNDGDLIEICGVRMNFVIRE |
| Ga0208092_1084842 | 3300027074 | Forest Soil | GPGDKVPAVNGAPIHGPVRLNDGDVIEVGGVRLNFIFRE |
| Ga0209220_10203651 | 3300027587 | Forest Soil | GPGDKVPNVNGTPISGPVRLKDGDLVEVSGVRLNFIFRE |
| Ga0209076_10414401 | 3300027643 | Vadose Zone Soil | GYYLGPGDKVPHVNGAPIQGPVRLNDGDLIEVSGVRLNFIFRG |
| Ga0209588_12769541 | 3300027671 | Vadose Zone Soil | GYYLGPGDKVPKINGNPISGPVRLNDGDLVEVSGVRLNFLFRE |
| Ga0208991_11462241 | 3300027681 | Forest Soil | GPGEKVPSVNGSPVTGQVLLKDGDLIDVCGVRLKFIFRD |
| Ga0208989_100844301 | 3300027738 | Forest Soil | IGPGEKVPSVNGSPVTGQVLLKDGDLIDVCGVRLKFIFRD |
| Ga0209073_100136891 | 3300027765 | Agricultural Soil | DKVPTVNGRLIGGPTRLNDGDLIEVSGVKLNFIFRE |
| Ga0209811_101633891 | 3300027821 | Surface Soil | YYIGSGDKIPVVNGNPIPGPTHLNDGDLIEVSGIRLNFIVRE |
| Ga0209180_102716881 | 3300027846 | Vadose Zone Soil | GPGDKVPSVNGRPIRGPVRLNDGDLIEVSGVRLNFIFRE |
| Ga0209693_102919192 | 3300027855 | Soil | PGDKMPLVNGAAITGPVRLNDGDVIEISGVRMNFVYRE |
| Ga0209169_105636612 | 3300027879 | Soil | GYYIGPGDKMPLVNGAPITGPVRLNDGDLIEVSGVRMNFVFRE |
| Ga0209590_108836921 | 3300027882 | Vadose Zone Soil | YLGPGDKVPSVNGRPIRGPVRLNDGDLIEVSGVRLNFIFRE |
| Ga0209380_104825191 | 3300027889 | Soil | GPGDKVPNVNGTPIHGPVRLNDGDLIEVSGVRLNFIFRE |
| Ga0209624_101088961 | 3300027895 | Forest Soil | VGPGDKVPVVNGAPITGPLRLNDGDVVEVCGLRMNFIFRD |
| Ga0209067_104392282 | 3300027898 | Watersheds | YLGTGDKVPVVNGNPISGTVRLNDGDLIEVCGVRMNFIFRE |
| Ga0302223_101606751 | 3300028781 | Palsa | GYYVVAGDKIPTVNGSPINGPVRLNDGDLIEISGVRLNFIFRE |
| Ga0311357_106190552 | 3300030524 | Palsa | GYYIVAGDKIPTVNSAPISGPVRLNDGDLIEICGVRLNFIFRE |
| Ga0265765_10139411 | 3300030879 | Soil | GPGDKMPTVNGTPITGPVRLSDGDLIEICGVRMNFVFRE |
| Ga0075373_115659711 | 3300030945 | Soil | DRVPAVNGTPISGAVRLNDGDLIEVCGVRLNFIIRE |
| Ga0073994_100109942 | 3300030991 | Soil | DDGYYLGPGDKVPNINGTPISGPVRLNDGDLVEVSGVRLNFIFRG |
| Ga0170824_1077310452 | 3300031231 | Forest Soil | AGSKVPTVNGIPVTGQVQLKDGDVVAVCGVRLNFIFRD |
| Ga0170824_1253366262 | 3300031231 | Forest Soil | DKMPTVNGAAITGPVRLNDGDVIEISGVRMNFVFRE |
| Ga0170824_1253571942 | 3300031231 | Forest Soil | DKVPHVNGAPIQGPVRLNDGDLIEVSGVRLNFIFRE |
| Ga0307476_109240441 | 3300031715 | Hardwood Forest Soil | GPGDKIPKVNGAPITGPKKLNDGDVIEVSGLRMNFIFRE |
| Ga0307474_115870931 | 3300031718 | Hardwood Forest Soil | GTGDKVPTVNGTPITGTVRLNDGDLIEVCGVRMNFIFRE |
| Ga0307469_108685271 | 3300031720 | Hardwood Forest Soil | GYYIGPGDKMPLVNGKPITGPVRLNDGDVIEVGGARMSFVYRE |
| Ga0318501_103156801 | 3300031736 | Soil | GYYLGTGAKIPVVNGSPIPGPVRLNDGDLIEICGVRMNFVIRE |
| Ga0306918_102263822 | 3300031744 | Soil | TGAKIPVVNGSPIPGPVRLNDGDLIEICGVRMNFVIRE |
| Ga0307477_109835222 | 3300031753 | Hardwood Forest Soil | YIGPGDKTPLVNSKPIQGPVRLNNGDTIEVCGLKLNFVFRE |
| Ga0318554_103102342 | 3300031765 | Soil | VGSGAQIPAVNGVAIGGPTKLNDGDLIEVAGIRVNFIVRE |
| Ga0306919_100255471 | 3300031879 | Soil | DKVPSVNGRLIGGPTRLNDGDVIEVSGVKLNFIFRE |
| Ga0306919_105040371 | 3300031879 | Soil | AKIPVVNGSPIPGPVRLNDGDLIEICGVRMNFVIRE |
| Ga0306919_112903702 | 3300031879 | Soil | DGYYLGPGDKVPTINGRPISGPTRLNDGDLIEVSGVKLNFIFRE |
| Ga0306919_115288071 | 3300031879 | Soil | LGTGAKIPSVNGSPIPGPVRLNDGDLIEICGVRMNFVIRE |
| Ga0310912_111348691 | 3300031941 | Soil | KIPTVNGSPIQGPVRLNDGDLIEVCGIRMNFVFRE |
| Ga0310916_101311162 | 3300031942 | Soil | TGAKIPTVNGSPIQGPVRLNDGDLIEVCGIRMNFVFRE |
| Ga0310916_102782741 | 3300031942 | Soil | GAKIPVVNGSPIPGPVRLNDGDLIEICGVRMNFVIRE |
| Ga0307479_100669792 | 3300031962 | Hardwood Forest Soil | GPGDKVPNVNGKPISGPVRLSDGDLVEVSGVRLNFIFRE |
| Ga0307479_105265571 | 3300031962 | Hardwood Forest Soil | GDKVPTVNGAPIPGPVRLNDGDLIEVSGVRLNFIFRE |
| Ga0307479_108296932 | 3300031962 | Hardwood Forest Soil | YIGSGDKVPVVNGVSIPGPTRLDDGDLVEVSGVRLNFIVRE |
| Ga0307479_110079052 | 3300031962 | Hardwood Forest Soil | YIGPGDKTPLVNSKPIQGPVRLNDGDVIEVCGLRLSFMFRE |
| Ga0307479_110233551 | 3300031962 | Hardwood Forest Soil | YIGPGDKTPVVNSKAIQGPVRLNDGDVIEICGLRLSFAFRE |
| Ga0306922_104092361 | 3300032001 | Soil | DDGYYIGSGDKVPIVNGVTIPGPTKLDDGDLVEVCGVRLNFIVRE |
| Ga0306922_105389872 | 3300032001 | Soil | FLGPGDKVPSVNGRLIGGPTRLNDGDVIEVSGVKLNFIFRE |
| Ga0318506_103937282 | 3300032052 | Soil | GTGAKIPVVNGSPIPGPVRLNDGDLIEICGVRMNFVIRE |
| Ga0318577_100069313 | 3300032091 | Soil | LGPGDKVPSVNGRLIGGPTRLNDGDVIEVSGVKLNFIFRE |
| Ga0307470_102831201 | 3300032174 | Hardwood Forest Soil | DKTPLVNDRPIQGPVRLNHGDVIEVCGLRLNFLFRE |
| Ga0307471_1003254482 | 3300032180 | Hardwood Forest Soil | IGPGDKTPVVNSKPIQGPVRLNDGDVIEICGLRLSFAFRE |
| Ga0307471_1028627731 | 3300032180 | Hardwood Forest Soil | DKVPNVNGAPIQGPVRLNDGDLIEVSGVRLNFIFRE |
| Ga0306920_1033660801 | 3300032261 | Soil | GTKIPVVNGSPIPGPVRLNDGDLIEICGVRMNFVIRE |
| Ga0335072_114528391 | 3300032898 | Soil | GDKVPSVNGTRIPGPVRLNDGDVIDVAGVRMNFLFRD |
| Ga0335084_100306064 | 3300033004 | Soil | KVPSVNGNPIAGTVRLNDGDLIEVCGVRMNFIFRE |
| ⦗Top⦘ |