| Basic Information | |
|---|---|
| Family ID | F036607 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 169 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEA |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 169 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 8.38 % |
| % of genes near scaffold ends (potentially truncated) | 68.05 % |
| % of genes from short scaffolds (< 2000 bps) | 90.53 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.213 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (40.237 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.296 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (64.497 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.19% β-sheet: 0.00% Coil/Unstructured: 60.81% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 169 Family Scaffolds |
|---|---|---|
| PF13546 | DDE_5 | 2.96 |
| PF00589 | Phage_integrase | 2.37 |
| PF13565 | HTH_32 | 1.78 |
| PF01610 | DDE_Tnp_ISL3 | 1.78 |
| PF13384 | HTH_23 | 1.18 |
| PF01797 | Y1_Tnp | 1.18 |
| PF13508 | Acetyltransf_7 | 1.18 |
| PF02776 | TPP_enzyme_N | 1.18 |
| PF13701 | DDE_Tnp_1_4 | 1.18 |
| PF14362 | DUF4407 | 1.18 |
| PF14104 | DUF4277 | 1.18 |
| PF04851 | ResIII | 1.18 |
| PF01850 | PIN | 0.59 |
| PF01844 | HNH | 0.59 |
| PF13614 | AAA_31 | 0.59 |
| PF08973 | TM1506 | 0.59 |
| PF02796 | HTH_7 | 0.59 |
| PF14269 | Arylsulfotran_2 | 0.59 |
| PF13751 | DDE_Tnp_1_6 | 0.59 |
| PF13358 | DDE_3 | 0.59 |
| PF08241 | Methyltransf_11 | 0.59 |
| PF13340 | DUF4096 | 0.59 |
| PF06108 | DUF952 | 0.59 |
| PF03400 | DDE_Tnp_IS1 | 0.59 |
| PF02899 | Phage_int_SAM_1 | 0.59 |
| PF12759 | HTH_Tnp_IS1 | 0.59 |
| PF13518 | HTH_28 | 0.59 |
| PF02371 | Transposase_20 | 0.59 |
| PF08309 | LVIVD | 0.59 |
| PF05168 | HEPN | 0.59 |
| PF13586 | DDE_Tnp_1_2 | 0.59 |
| PF01575 | MaoC_dehydratas | 0.59 |
| PF07859 | Abhydrolase_3 | 0.59 |
| PF16117 | DUF4833 | 0.59 |
| PF08028 | Acyl-CoA_dh_2 | 0.59 |
| PF02567 | PhzC-PhzF | 0.59 |
| PF00730 | HhH-GPD | 0.59 |
| PF13527 | Acetyltransf_9 | 0.59 |
| PF04255 | DUF433 | 0.59 |
| PF13408 | Zn_ribbon_recom | 0.59 |
| COG ID | Name | Functional Category | % Frequency in 169 Family Scaffolds |
|---|---|---|---|
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 1.78 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 1.18 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.59 |
| COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 0.59 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.59 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.59 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.59 |
| COG3502 | Uncharacterized conserved protein, DUF952 family | Function unknown [S] | 0.59 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.59 |
| COG2250 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.59 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.59 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.59 |
| COG1895 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.59 |
| COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 0.59 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.59 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.59 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.59 |
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 0.59 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.59 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.21 % |
| All Organisms | root | All Organisms | 43.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002558|JGI25385J37094_10222601 | Not Available | 503 | Open in IMG/M |
| 3300002562|JGI25382J37095_10265642 | Not Available | 516 | Open in IMG/M |
| 3300004479|Ga0062595_102474307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 517 | Open in IMG/M |
| 3300005180|Ga0066685_10417625 | Not Available | 932 | Open in IMG/M |
| 3300005294|Ga0065705_10130554 | All Organisms → cellular organisms → Bacteria | 2478 | Open in IMG/M |
| 3300005294|Ga0065705_10552731 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → unclassified Planctomycetales → Planctomycetales bacterium | 738 | Open in IMG/M |
| 3300005294|Ga0065705_11176959 | Not Available | 506 | Open in IMG/M |
| 3300005332|Ga0066388_100704179 | Not Available | 1616 | Open in IMG/M |
| 3300005332|Ga0066388_105764989 | Not Available | 626 | Open in IMG/M |
| 3300005332|Ga0066388_106022766 | Not Available | 612 | Open in IMG/M |
| 3300005332|Ga0066388_106244110 | Not Available | 601 | Open in IMG/M |
| 3300005332|Ga0066388_106606062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300005332|Ga0066388_106920083 | Not Available | 571 | Open in IMG/M |
| 3300005332|Ga0066388_107094715 | Not Available | 563 | Open in IMG/M |
| 3300005332|Ga0066388_107950867 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005332|Ga0066388_108060709 | Not Available | 526 | Open in IMG/M |
| 3300005343|Ga0070687_100591557 | Not Available | 761 | Open in IMG/M |
| 3300005457|Ga0070662_100426819 | Not Available | 1097 | Open in IMG/M |
| 3300005466|Ga0070685_11609327 | Not Available | 503 | Open in IMG/M |
| 3300005467|Ga0070706_100921909 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300005518|Ga0070699_102187282 | Not Available | 505 | Open in IMG/M |
| 3300005549|Ga0070704_101906013 | Not Available | 551 | Open in IMG/M |
| 3300005552|Ga0066701_10392645 | Not Available | 859 | Open in IMG/M |
| 3300005558|Ga0066698_11081438 | Not Available | 507 | Open in IMG/M |
| 3300005566|Ga0066693_10377239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 574 | Open in IMG/M |
| 3300005598|Ga0066706_11057667 | Not Available | 622 | Open in IMG/M |
| 3300005713|Ga0066905_101651414 | Not Available | 587 | Open in IMG/M |
| 3300005713|Ga0066905_101695649 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 580 | Open in IMG/M |
| 3300005719|Ga0068861_100926579 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300005764|Ga0066903_101542796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfocapsaceae → Desulfocapsa → unclassified Desulfocapsa → Desulfocapsa sp. | 1256 | Open in IMG/M |
| 3300005842|Ga0068858_101703488 | Not Available | 622 | Open in IMG/M |
| 3300005843|Ga0068860_101958013 | Not Available | 608 | Open in IMG/M |
| 3300005937|Ga0081455_10125535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2015 | Open in IMG/M |
| 3300006058|Ga0075432_10528434 | Not Available | 530 | Open in IMG/M |
| 3300006800|Ga0066660_10707764 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300006800|Ga0066660_11178679 | Not Available | 602 | Open in IMG/M |
| 3300006844|Ga0075428_101646178 | Not Available | 670 | Open in IMG/M |
| 3300006845|Ga0075421_100555185 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
| 3300006845|Ga0075421_102173635 | Not Available | 586 | Open in IMG/M |
| 3300006847|Ga0075431_100299985 | All Organisms → cellular organisms → Bacteria | 1623 | Open in IMG/M |
| 3300006847|Ga0075431_100517017 | Not Available | 1183 | Open in IMG/M |
| 3300006871|Ga0075434_100904393 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300007255|Ga0099791_10263596 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300007258|Ga0099793_10283886 | Not Available | 802 | Open in IMG/M |
| 3300007258|Ga0099793_10548709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 577 | Open in IMG/M |
| 3300007790|Ga0105679_10719343 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 2118 | Open in IMG/M |
| 3300009012|Ga0066710_100963816 | Not Available | 1315 | Open in IMG/M |
| 3300009012|Ga0066710_101167897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1192 | Open in IMG/M |
| 3300009012|Ga0066710_104565490 | Not Available | 517 | Open in IMG/M |
| 3300009038|Ga0099829_10737725 | Not Available | 818 | Open in IMG/M |
| 3300009038|Ga0099829_11509926 | Not Available | 555 | Open in IMG/M |
| 3300009088|Ga0099830_11755640 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 518 | Open in IMG/M |
| 3300009090|Ga0099827_10268499 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
| 3300009090|Ga0099827_10774882 | Not Available | 830 | Open in IMG/M |
| 3300009090|Ga0099827_11586373 | Not Available | 570 | Open in IMG/M |
| 3300009090|Ga0099827_11941011 | Not Available | 512 | Open in IMG/M |
| 3300009098|Ga0105245_13246483 | Not Available | 504 | Open in IMG/M |
| 3300009100|Ga0075418_11051755 | Not Available | 881 | Open in IMG/M |
| 3300009100|Ga0075418_11384426 | Not Available | 763 | Open in IMG/M |
| 3300009143|Ga0099792_10377310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 862 | Open in IMG/M |
| 3300009143|Ga0099792_10561956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
| 3300009147|Ga0114129_10157989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3099 | Open in IMG/M |
| 3300009147|Ga0114129_10800806 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 1202 | Open in IMG/M |
| 3300009147|Ga0114129_11471537 | Not Available | 838 | Open in IMG/M |
| 3300009176|Ga0105242_12596347 | Not Available | 555 | Open in IMG/M |
| 3300009553|Ga0105249_10338543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Coleofasciculaceae → Coleofasciculus | 1520 | Open in IMG/M |
| 3300009792|Ga0126374_10447270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 917 | Open in IMG/M |
| 3300010045|Ga0126311_10874846 | Not Available | 728 | Open in IMG/M |
| 3300010047|Ga0126382_10110041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1802 | Open in IMG/M |
| 3300010304|Ga0134088_10351139 | All Organisms → cellular organisms → Archaea | 716 | Open in IMG/M |
| 3300010333|Ga0134080_10569172 | Not Available | 547 | Open in IMG/M |
| 3300010362|Ga0126377_10810663 | Not Available | 995 | Open in IMG/M |
| 3300010362|Ga0126377_10845635 | Not Available | 976 | Open in IMG/M |
| 3300010362|Ga0126377_12821645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 560 | Open in IMG/M |
| 3300010366|Ga0126379_11351994 | Not Available | 818 | Open in IMG/M |
| 3300010366|Ga0126379_12856928 | Not Available | 578 | Open in IMG/M |
| 3300010398|Ga0126383_11034928 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300011270|Ga0137391_11491019 | Not Available | 521 | Open in IMG/M |
| 3300012096|Ga0137389_11088893 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300012096|Ga0137389_11367170 | All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Candidatus Omnitrophica bacterium | 603 | Open in IMG/M |
| 3300012189|Ga0137388_10154422 | All Organisms → cellular organisms → Bacteria | 2036 | Open in IMG/M |
| 3300012199|Ga0137383_10133697 | All Organisms → cellular organisms → Bacteria | 1812 | Open in IMG/M |
| 3300012199|Ga0137383_10202852 | Not Available | 1453 | Open in IMG/M |
| 3300012201|Ga0137365_10552076 | Not Available | 845 | Open in IMG/M |
| 3300012201|Ga0137365_11139739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 560 | Open in IMG/M |
| 3300012202|Ga0137363_10635034 | Not Available | 902 | Open in IMG/M |
| 3300012202|Ga0137363_11504458 | Not Available | 564 | Open in IMG/M |
| 3300012203|Ga0137399_10638914 | Not Available | 895 | Open in IMG/M |
| 3300012206|Ga0137380_10251299 | All Organisms → cellular organisms → Bacteria | 1593 | Open in IMG/M |
| 3300012206|Ga0137380_10781253 | Not Available | 825 | Open in IMG/M |
| 3300012206|Ga0137380_10887570 | Not Available | 766 | Open in IMG/M |
| 3300012207|Ga0137381_10190224 | Not Available | 1777 | Open in IMG/M |
| 3300012207|Ga0137381_10911224 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300012208|Ga0137376_10172906 | Not Available | 1864 | Open in IMG/M |
| 3300012209|Ga0137379_10123069 | Not Available | 2494 | Open in IMG/M |
| 3300012209|Ga0137379_10497084 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1127 | Open in IMG/M |
| 3300012209|Ga0137379_10509536 | Not Available | 1111 | Open in IMG/M |
| 3300012210|Ga0137378_10217994 | All Organisms → cellular organisms → Bacteria | 1777 | Open in IMG/M |
| 3300012210|Ga0137378_10938784 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 778 | Open in IMG/M |
| 3300012349|Ga0137387_10349951 | Not Available | 1070 | Open in IMG/M |
| 3300012350|Ga0137372_10789868 | Not Available | 682 | Open in IMG/M |
| 3300012351|Ga0137386_10081274 | All Organisms → cellular organisms → Bacteria | 2271 | Open in IMG/M |
| 3300012354|Ga0137366_10330384 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1118 | Open in IMG/M |
| 3300012354|Ga0137366_10366899 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1052 | Open in IMG/M |
| 3300012355|Ga0137369_10570307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 791 | Open in IMG/M |
| 3300012356|Ga0137371_10585373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 858 | Open in IMG/M |
| 3300012360|Ga0137375_11319308 | Not Available | 543 | Open in IMG/M |
| 3300012361|Ga0137360_10555433 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300012361|Ga0137360_11041995 | Not Available | 706 | Open in IMG/M |
| 3300012361|Ga0137360_11432773 | Not Available | 594 | Open in IMG/M |
| 3300012362|Ga0137361_11777029 | Not Available | 535 | Open in IMG/M |
| 3300012582|Ga0137358_11107774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 504 | Open in IMG/M |
| 3300012685|Ga0137397_10413840 | Not Available | 1004 | Open in IMG/M |
| 3300012923|Ga0137359_11245730 | Not Available | 632 | Open in IMG/M |
| 3300012925|Ga0137419_11165516 | Not Available | 644 | Open in IMG/M |
| 3300012927|Ga0137416_10637529 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 931 | Open in IMG/M |
| 3300012929|Ga0137404_10016222 | All Organisms → cellular organisms → Bacteria | 5279 | Open in IMG/M |
| 3300012929|Ga0137404_10666709 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 939 | Open in IMG/M |
| 3300012929|Ga0137404_12313403 | Not Available | 503 | Open in IMG/M |
| 3300012930|Ga0137407_12244961 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300012944|Ga0137410_10871620 | Not Available | 760 | Open in IMG/M |
| 3300012944|Ga0137410_11883337 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300012951|Ga0164300_10024796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2128 | Open in IMG/M |
| 3300012988|Ga0164306_11207415 | Not Available | 634 | Open in IMG/M |
| 3300013102|Ga0157371_11664813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina alkanivorans | 500 | Open in IMG/M |
| 3300013306|Ga0163162_10302784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1731 | Open in IMG/M |
| 3300013306|Ga0163162_11360640 | Not Available | 807 | Open in IMG/M |
| 3300013306|Ga0163162_11990848 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300013306|Ga0163162_12070266 | Not Available | 653 | Open in IMG/M |
| 3300014154|Ga0134075_10497876 | Not Available | 546 | Open in IMG/M |
| 3300016404|Ga0182037_10309912 | Not Available | 1272 | Open in IMG/M |
| 3300017656|Ga0134112_10238059 | Not Available | 720 | Open in IMG/M |
| 3300017792|Ga0163161_10279286 | Not Available | 1309 | Open in IMG/M |
| 3300017792|Ga0163161_11599419 | Not Available | 575 | Open in IMG/M |
| 3300017965|Ga0190266_10164520 | Not Available | 1016 | Open in IMG/M |
| 3300021081|Ga0210379_10034353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 1976 | Open in IMG/M |
| 3300021086|Ga0179596_10679363 | Not Available | 521 | Open in IMG/M |
| 3300021344|Ga0193719_10470549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 509 | Open in IMG/M |
| 3300022195|Ga0222625_1462530 | Not Available | 610 | Open in IMG/M |
| 3300025933|Ga0207706_10390261 | Not Available | 1207 | Open in IMG/M |
| 3300025933|Ga0207706_11326351 | Not Available | 594 | Open in IMG/M |
| 3300026041|Ga0207639_11992618 | Not Available | 542 | Open in IMG/M |
| 3300026118|Ga0207675_102358310 | Not Available | 545 | Open in IMG/M |
| 3300026358|Ga0257166_1000773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiotrichaceae → Thiomargarita → Candidatus Thiomargarita nelsonii | 2648 | Open in IMG/M |
| 3300026480|Ga0257177_1087429 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300026498|Ga0257156_1134544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya → unclassified Leptolyngbya → Leptolyngbya sp. FACHB-321 | 515 | Open in IMG/M |
| 3300026507|Ga0257165_1016218 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1223 | Open in IMG/M |
| 3300026550|Ga0209474_10339073 | Not Available | 852 | Open in IMG/M |
| 3300027576|Ga0209003_1032021 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 895 | Open in IMG/M |
| 3300027655|Ga0209388_1127165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales | 726 | Open in IMG/M |
| 3300027725|Ga0209178_1430621 | Not Available | 505 | Open in IMG/M |
| 3300027738|Ga0208989_10303894 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 509 | Open in IMG/M |
| 3300027750|Ga0209461_10174060 | Not Available | 536 | Open in IMG/M |
| 3300027846|Ga0209180_10507605 | Not Available | 675 | Open in IMG/M |
| 3300027846|Ga0209180_10743688 | Not Available | 530 | Open in IMG/M |
| 3300027875|Ga0209283_10058599 | All Organisms → cellular organisms → Bacteria | 2465 | Open in IMG/M |
| 3300027875|Ga0209283_10541344 | Not Available | 745 | Open in IMG/M |
| 3300027875|Ga0209283_10821540 | Not Available | 569 | Open in IMG/M |
| 3300027882|Ga0209590_10060050 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 2153 | Open in IMG/M |
| 3300027882|Ga0209590_10750376 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300027903|Ga0209488_10248401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Crenobacter → Crenobacter cavernae | 1334 | Open in IMG/M |
| 3300028047|Ga0209526_10113254 | All Organisms → cellular organisms → Bacteria | 1907 | Open in IMG/M |
| 3300028381|Ga0268264_11080420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 810 | Open in IMG/M |
| 3300028589|Ga0247818_10727352 | Not Available | 689 | Open in IMG/M |
| 3300028828|Ga0307312_10614203 | Not Available | 719 | Open in IMG/M |
| 3300031226|Ga0307497_10011557 | All Organisms → cellular organisms → Bacteria | 2524 | Open in IMG/M |
| 3300032174|Ga0307470_10038306 | All Organisms → cellular organisms → Bacteria | 2351 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 40.24% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.10% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.10% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.37% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.78% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.18% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.18% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.18% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.59% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.59% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.59% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.59% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.59% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25385J37094_102226012 | 3300002558 | Grasslands Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEAAFRTWVHDSHGTLV |
| JGI25382J37095_102656421 | 3300002562 | Grasslands Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLLGDAEWPKVADAVIEAEYLTSPSVLRRHMG |
| Ga0062595_1024743072 | 3300004479 | Soil | MGCSEKKLSKNLTQTFMASCNVMICQQAALSGEAERPKVADAVIEA |
| Ga0066685_104176253 | 3300005180 | Soil | MGCSDEKLSKYLTQTFMVHCNAMLCQQVTLSGDAEWPKVADAVIE |
| Ga0065705_101305543 | 3300005294 | Switchgrass Rhizosphere | QKLSKYLTQTFMSHGNEMICQPVTLSGYAEWPKVADAVIEAVDWAAIFVGSI* |
| Ga0065705_105527311 | 3300005294 | Switchgrass Rhizosphere | MGCGEEKLSKYLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEA |
| Ga0065705_111769592 | 3300005294 | Switchgrass Rhizosphere | MGCSEEKLSKNLTQTFMAYCNIMICQQATLSGEAERPKVADAVIEA |
| Ga0066388_1007041791 | 3300005332 | Tropical Forest Soil | LSKNLTQTFMAYCNVMIYQQATLSGDAERLKVADAVIEAA* |
| Ga0066388_1057649891 | 3300005332 | Tropical Forest Soil | LSKNLTQTFMAYCNVMIYQQATLSGDAERLKVADAVIEAGGCIS* |
| Ga0066388_1060227661 | 3300005332 | Tropical Forest Soil | MGCSEKKLSKNLTQIFMVYCNVMICQQATLSGEAERPKVADAVIEA |
| Ga0066388_1062441101 | 3300005332 | Tropical Forest Soil | KLSKYLTQTFTAYCNVMICQQATLSGEAERPKVADAVIEA* |
| Ga0066388_1066060622 | 3300005332 | Tropical Forest Soil | LSKNLTQTFMAYCNVMLYQQATLSGDAERLKVADAVIEAD* |
| Ga0066388_1069200831 | 3300005332 | Tropical Forest Soil | MGCGDDLSKYLTQTLTPHGHEMICPPVTWSGYTEWPKVADAVIEAV |
| Ga0066388_1070947151 | 3300005332 | Tropical Forest Soil | LSKNLTQTFMAYCNVMIYQQATLSGDAERLKVADAVIEALF* |
| Ga0066388_1079508671 | 3300005332 | Tropical Forest Soil | LSKNLTQTFMAYCNVMLYQQATLSGDAERLKVADAVIEAQLAI* |
| Ga0066388_1080607091 | 3300005332 | Tropical Forest Soil | LSKNLTQTFMAYCNVMLYQQATLSGDAERLKVADAVIEAPFQGFG* |
| Ga0070687_1005915573 | 3300005343 | Switchgrass Rhizosphere | MGCGDEKLSKSLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEARN |
| Ga0070662_1004268192 | 3300005457 | Corn Rhizosphere | MGCSEKKLSKNLTQIFMVYCNVMICQQATLSGEAERPKVADAVIEADKGEPLWMV* |
| Ga0070685_116093272 | 3300005466 | Switchgrass Rhizosphere | MGCGDEKLSKYLTQTFIAYCNAMICQPVTLSGDAEWPKVADAVIEA* |
| Ga0070706_1009219092 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MGCGDEKLSKYLTQTFTAHCKAMICQQVTLLGDAEWPKVADAVIEA |
| Ga0070699_1021872822 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MGCGDGKLSKYLTQTFTAHCKAMICQQVTLLGDAEWPKVADAVIEA |
| Ga0070704_1019060132 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MGCSEKKLSKNLTQIFMVYCNVMICQQATLSGEAERPKVADAVIEAALSIDEVGS* |
| Ga0066701_103926452 | 3300005552 | Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEAEYQTR* |
| Ga0066698_110814381 | 3300005558 | Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLLGDAEWPKVADAVIEARFCLLG* |
| Ga0066693_103772391 | 3300005566 | Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLLGDAEWPKVADAVIEA |
| Ga0066706_110576671 | 3300005598 | Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLLGDAEWPKV |
| Ga0066905_1016514142 | 3300005713 | Tropical Forest Soil | MGCSEKKLSKNLTQTFMAYCNVMIYQQATLSGDAERLKVADAVIEADISMIAISDYAT* |
| Ga0066905_1016956491 | 3300005713 | Tropical Forest Soil | MGCSEKKLSKNLTQIFMVYCNVMICQQATLSGEAERPKVADAVI |
| Ga0068861_1009265791 | 3300005719 | Switchgrass Rhizosphere | MGCDDEKLSKYLTHTFMAHCHTMICQQVTLSGAAEWPKVADAVIEAEYAISKPLIVFTE* |
| Ga0066903_1015427962 | 3300005764 | Tropical Forest Soil | MRQKLSKSLTQTFMSPYNEMLCQPVTVSGDAEWPKVADAVIEA* |
| Ga0068858_1017034881 | 3300005842 | Switchgrass Rhizosphere | MGCGDEKLSKYLTQTFIAYCNAMICQPVTLSGDAEWPKVADAVIEAPCGMRYNRC* |
| Ga0068860_1019580131 | 3300005843 | Switchgrass Rhizosphere | MGCGDEKLSKSLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEA |
| Ga0081455_101255351 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MGCSKKKVSKNLTQIFMAYCNVMICQQATLSGEAERPKVADAVIEAIFPI* |
| Ga0075432_105284342 | 3300006058 | Populus Rhizosphere | MGCGDEKLSKSLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEAG |
| Ga0066660_107077642 | 3300006800 | Soil | LQRQKLLKYLTQTFMSHGNEMICQPVTLSGDAEWPKVADAVIEA |
| Ga0066660_111786792 | 3300006800 | Soil | MGCDDEKLSKSLTQTFTAHCNAMICQPVTLSGDAEWPKVADAVIETSQGSGIIARF* |
| Ga0075428_1016461781 | 3300006844 | Populus Rhizosphere | LLKHLTKTFLSHYNAMTCQPVTLSGDAEWPKVADAVIEAEYHTR* |
| Ga0075421_1005551851 | 3300006845 | Populus Rhizosphere | YLTQTFMSHGNDMIGQPGTLSGDAEWPQVADAVIEAG* |
| Ga0075421_1021736351 | 3300006845 | Populus Rhizosphere | MGCGDEKLSKSLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEAGA* |
| Ga0075431_1002999851 | 3300006847 | Populus Rhizosphere | LLKYLTQTFMSHGNDMIGQPGTLSGYAEWPQVADAVIEAG* |
| Ga0075431_1005170172 | 3300006847 | Populus Rhizosphere | MGCSEKKLSKNLTQTFMAYCNVMVCQQTTLSGEAERPKVADAVIEA |
| Ga0075434_1009043932 | 3300006871 | Populus Rhizosphere | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLSGDAEWPKVADAV |
| Ga0099791_102635961 | 3300007255 | Vadose Zone Soil | MGCGDEKLSKYLTQIFTAHCNAMICQQVTLSGDAEWPKVAGAVIKADTS* |
| Ga0099793_102838862 | 3300007258 | Vadose Zone Soil | MGCGDEKLSKYLTQAFITHCNAMICQQVTLSGDAEWPKVADAVIEA |
| Ga0099793_105487092 | 3300007258 | Vadose Zone Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEAAWSMSGRAIR* |
| Ga0105679_107193433 | 3300007790 | Soil | SKNLTQTFMAYGNVMICQHATLSGEAERPKVADAVIEAEF* |
| Ga0066710_1009638163 | 3300009012 | Grasslands Soil | MDCGDEKLSKYLTQTFTAHCNAMICQQVTLLGDAEWPKVADA |
| Ga0066710_1011678971 | 3300009012 | Grasslands Soil | KLSKYLTQTFMSHGNEMVCQPVTLSGYAEWPKVADAVIEAEKAGA |
| Ga0066710_1045654902 | 3300009012 | Grasslands Soil | LSKYLTQTFMAHCNEMIGQQRTLSGYAEWPKVADAVIEA |
| Ga0099829_107377251 | 3300009038 | Vadose Zone Soil | MGCGDEKLSKDLTQTFTAHCNAMICQQVTLLGDAEWPKVADAVIEAQNW |
| Ga0099829_115099262 | 3300009038 | Vadose Zone Soil | MGCGDEKLSKYLTQTFIAHCNAMICQQVTLSGDAEWPKVADAVIEA |
| Ga0099830_117556402 | 3300009088 | Vadose Zone Soil | MGCGDKKLSKYLTQTFTAHCNAMICQQVTLSGDAEWPKV |
| Ga0099827_102684991 | 3300009090 | Vadose Zone Soil | KLSKYLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEAKKPTAKRRRLAGLLRLGTM* |
| Ga0099827_107748821 | 3300009090 | Vadose Zone Soil | MGCGDEKLSKYFTQTFIAHCNAMICQQVTLSGDAEWPKVADAVIEA |
| Ga0099827_115863731 | 3300009090 | Vadose Zone Soil | MGCGDEKLSKHLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEA |
| Ga0099827_119410111 | 3300009090 | Vadose Zone Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLLGDAEW |
| Ga0105245_132464831 | 3300009098 | Miscanthus Rhizosphere | MGCGDKKLSKYLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEARNEMRKHSQL |
| Ga0075418_110517551 | 3300009100 | Populus Rhizosphere | KLLKYLTQTFMSHGNDMIGQPGTLSGYAEWPQVADAVIEAG* |
| Ga0075418_113844261 | 3300009100 | Populus Rhizosphere | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEAQNSTFYF* |
| Ga0099792_103773102 | 3300009143 | Vadose Zone Soil | MGYGDEKLSKYLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEAVRLPHHTHR |
| Ga0099792_105619562 | 3300009143 | Vadose Zone Soil | MGCADEKLSKYLTHAFMAHCNTMICQQGTLAGEAEWPKVADAVIEAEK* |
| Ga0114129_101579891 | 3300009147 | Populus Rhizosphere | LSKYLTQTFMSHGNAMICQPVTLSGYAEWPKVADAVIEATSGLAES* |
| Ga0114129_108008061 | 3300009147 | Populus Rhizosphere | LSKSLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEAGA* |
| Ga0114129_114715371 | 3300009147 | Populus Rhizosphere | KYLTQTFMSHGNEMICQPVTLSGYAEWPKVADAVIEAQQATQNR* |
| Ga0105242_125963471 | 3300009176 | Miscanthus Rhizosphere | MGCGDEKLSKYLTQTFIAYCNAMICQPVTLSGDAEWPKVADAVIEAGVSKTIP* |
| Ga0105249_103385431 | 3300009553 | Switchgrass Rhizosphere | MGCDDEKLSKYLTHTFMAHCHTMICQQVTLSGAAEWPKVADAVIEAE |
| Ga0126374_104472701 | 3300009792 | Tropical Forest Soil | KKLSKNLTQTFMAYCNVMIYQQATLSGDAERLKVADAVIEAFFLC* |
| Ga0126311_108748461 | 3300010045 | Serpentine Soil | MGCGDKKLSKYLTQTFIAYCNAMICQSVTLSGEAEWPKVADAVIEALVLTSLMRLISF |
| Ga0126382_101100413 | 3300010047 | Tropical Forest Soil | MGCSEEKLSKNLTQTFMAYCNIMICQQATLSGEAERPKVADAVIEAVVLSLAVPPK |
| Ga0134088_103511392 | 3300010304 | Grasslands Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLLGDAEWPKVADAVIEADFR* |
| Ga0134080_105691722 | 3300010333 | Grasslands Soil | MGCSDEKLSKYLTQTFMVHCNAMLCQQVTLSGDAEWPKVAV |
| Ga0126377_108106632 | 3300010362 | Tropical Forest Soil | MSCSEEKLSKNLTQTFMAYCNIMICQQATLSGEAERPKVADAVIEA |
| Ga0126377_108456351 | 3300010362 | Tropical Forest Soil | KYLARTFMSHGNEMICQPVTLSGYAEWPKVADAMIEA* |
| Ga0126377_128216452 | 3300010362 | Tropical Forest Soil | MSCGEAKLSKYLTQTFMAHYNAMICRQVTLSGDAEWP |
| Ga0126379_113519941 | 3300010366 | Tropical Forest Soil | LSKFLTQTFMAHCSAMICQQVKLSDDAEWPKVADAVIEATERT* |
| Ga0126379_128569282 | 3300010366 | Tropical Forest Soil | MDCSGKKLLKYLTQAFMSYGNEMICQQGTLSGYAEWPKVADAVIEAVKLMKNRSQTPSP* |
| Ga0126383_110349281 | 3300010398 | Tropical Forest Soil | YLTQTFMSPGNDMIGQPGTLSGYAEWPQVADAVIEAP* |
| Ga0137391_114910191 | 3300011270 | Vadose Zone Soil | LQRKKLLKYLTQTFISHGNEMICQPVTLSGYAEWPKVADA |
| Ga0137389_110888931 | 3300012096 | Vadose Zone Soil | DEKLSKYLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVSEASHAQV* |
| Ga0137389_113671701 | 3300012096 | Vadose Zone Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLSGDAEW |
| Ga0137388_101544221 | 3300012189 | Vadose Zone Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLSGDAEWPKVAD |
| Ga0137383_101336971 | 3300012199 | Vadose Zone Soil | KLSKYLTQTFTAHCNAMICQQVTLLGDAEWPKVADAVIEADTQAAAYAK* |
| Ga0137383_102028522 | 3300012199 | Vadose Zone Soil | MGCGDEKLSKYLTQIFTAHCNAMICQQVTLSGDAEWPKVADAVIEA |
| Ga0137365_105520761 | 3300012201 | Vadose Zone Soil | MGCDDEKLSKYLTHTFMAHCHTMICQQVTLSGAAEWPKVADAVIEADEAI* |
| Ga0137365_111397392 | 3300012201 | Vadose Zone Soil | MGCGDEKLSKSLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIE |
| Ga0137363_106350342 | 3300012202 | Vadose Zone Soil | MGCDDEKLSKYLTHTFMAHCHTMICQQVTLLGDAEWPKVADAVIEAGE* |
| Ga0137363_115044581 | 3300012202 | Vadose Zone Soil | MGCGDEKLSKSLTQTFTAHRNALICQQVTLSGDAEWPKVADAVIEARNALFLCAAI* |
| Ga0137399_106389142 | 3300012203 | Vadose Zone Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLLGDAEWLKVADAVIEA |
| Ga0137380_102512992 | 3300012206 | Vadose Zone Soil | CGDEKLSKYLTQTFTAHCNAMICQQVTLLGDAKWPKVADAVIEAENLTHKFAILHF* |
| Ga0137380_107812532 | 3300012206 | Vadose Zone Soil | MGCDDEKLSKYLTHTFMAHCHTMICQQVTLSGEAEWPKVADAVIEAPPPPIATNG* |
| Ga0137380_108875702 | 3300012206 | Vadose Zone Soil | MGCGDEKLSKYLTQPFTAHCNAMICQQVTLLGDAEWPKVADAVIEAVLSPAKM* |
| Ga0137381_101902244 | 3300012207 | Vadose Zone Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEARESVRLWPLS |
| Ga0137381_109112242 | 3300012207 | Vadose Zone Soil | QKLSKYLTQTFMSHGNEMVCQPVTLSGYAEWPKVADAVIEAVIPSKIKG* |
| Ga0137376_101729062 | 3300012208 | Vadose Zone Soil | MGCGDEKLSKSLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEAVTYNTFAT* |
| Ga0137379_101230691 | 3300012209 | Vadose Zone Soil | MGCGDEKLSKYLTQTFMAHCSAMICQQVTLSGDAEWPKVADAVIEA |
| Ga0137379_104970841 | 3300012209 | Vadose Zone Soil | LTQTFTAHCNAMICQQVTLLGDAEWPKVADAVIEADTQAAAYAK* |
| Ga0137379_105095361 | 3300012209 | Vadose Zone Soil | MGCGDEKLSKSLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEALC |
| Ga0137378_102179942 | 3300012210 | Vadose Zone Soil | EKLSKYLTQTFMAHCSAMICQQVTLSGDAEWPKVADAVIEAH* |
| Ga0137378_109387842 | 3300012210 | Vadose Zone Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLLGDAEWPKVADAVIEADTQAAAYAK* |
| Ga0137387_103499513 | 3300012349 | Vadose Zone Soil | SKYLTHTFMAHCHTMICQQVTLSGAAEWPKVADAVIEAHISISGPK* |
| Ga0137372_107898681 | 3300012350 | Vadose Zone Soil | MGCDDEKLSKYLTHTFMAHCHTMICQQVTLSGDAEWPKVADA |
| Ga0137386_100812741 | 3300012351 | Vadose Zone Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLLGDAEWPKVA |
| Ga0137366_103303843 | 3300012354 | Vadose Zone Soil | EKLSKYLTQTFTAHCNAMICQQVTLLGDAEWPKVADAVIEADTQAAAYAK* |
| Ga0137366_103668993 | 3300012354 | Vadose Zone Soil | MGCGDEKLSKSLTQTFTAHCNALICQQVTLSGDAEWPKVADAVIEADLQ* |
| Ga0137369_105703072 | 3300012355 | Vadose Zone Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEAARESGKILSFHH* |
| Ga0137371_105853733 | 3300012356 | Vadose Zone Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEAENRPFSNRRY* |
| Ga0137375_113193081 | 3300012360 | Vadose Zone Soil | MGCGDEKLSKYLTQTFIAHCNAMICQQVTLSGDAEWPKVA |
| Ga0137360_105554333 | 3300012361 | Vadose Zone Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLLGDAEWPKVADAVIEAE |
| Ga0137360_110419951 | 3300012361 | Vadose Zone Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLLGDAEWPKVADAVIEASMSM* |
| Ga0137360_114327731 | 3300012361 | Vadose Zone Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLSGDAE |
| Ga0137361_117770291 | 3300012362 | Vadose Zone Soil | MGCGDEKLSKSLTQTFTAHCNAMICQQVTLSGDAEWP |
| Ga0137358_111077742 | 3300012582 | Vadose Zone Soil | LSKYLTQTFMSHCNAMICQQVTLSGYAEWPKVADAVIE |
| Ga0137397_104138401 | 3300012685 | Vadose Zone Soil | MDCGDTKLSKYLTQTFTAHCNAMICQQVTLLGDAEWP |
| Ga0137395_103133481 | 3300012917 | Vadose Zone Soil | YLTQTFTAHCNAMICQQVTLLGDAEWPKVADAVIEA* |
| Ga0137359_112457301 | 3300012923 | Vadose Zone Soil | MGCGDEKLSKYLTQTFIAHCNAMICQQVTWSGDAEWPKAADARIEAQDIADSIGFRGW* |
| Ga0137419_111655162 | 3300012925 | Vadose Zone Soil | MGCDDEKLSKYLTHTFMAHCHTMICQQVTLSGAAEWPKVADAVIEAGHGTMHVQLI* |
| Ga0137416_106375291 | 3300012927 | Vadose Zone Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLLGDAEWLKVADAVIEANQ* |
| Ga0137404_100162221 | 3300012929 | Vadose Zone Soil | MGCDDEKLSKYLTHTFMAHCHTMICQQVTLSGAAEWPKVADAVIEA |
| Ga0137404_106667092 | 3300012929 | Vadose Zone Soil | MDCGDEKLSKSLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEA |
| Ga0137404_123134031 | 3300012929 | Vadose Zone Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLLGDAEWPKVADAVIEALNPMEC |
| Ga0137407_122449611 | 3300012930 | Vadose Zone Soil | MGCGDEKLSKYLTQIFTAHCNAMICQQVTLSGDAEWPKVAGAVIKAV* |
| Ga0137410_108716201 | 3300012944 | Vadose Zone Soil | MGCGDEKLSKHLTQTFIAHCNAMICQQVTLSGDAE |
| Ga0137410_118833372 | 3300012944 | Vadose Zone Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLSSDAEWPKVADAVIEAVLRT* |
| Ga0164300_100247962 | 3300012951 | Soil | MGCGDEKLSKSLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEAR* |
| Ga0164306_112074151 | 3300012988 | Soil | MGCGDEKLLKRLTQTFIAYCNAMICQQVTLSGDAEWPKVADAVIEA* |
| Ga0157371_116648131 | 3300013102 | Corn Rhizosphere | MDCGDEKLSKYLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEA |
| Ga0163162_103027841 | 3300013306 | Switchgrass Rhizosphere | QKLSKYLTQTFMSHGNEMICQPVTLSGYAEWPKVADAVIEAE* |
| Ga0163162_113606401 | 3300013306 | Switchgrass Rhizosphere | MGCGDEKLSKYLTQTFIAYCNAMICQPVTLSGDAEWPKVADAVIE |
| Ga0163162_119908481 | 3300013306 | Switchgrass Rhizosphere | KLSKSLTQTFMAHCSAMICQQLTLSGNAEWPKVADAVIEAEAWAVVAA* |
| Ga0163162_120702661 | 3300013306 | Switchgrass Rhizosphere | KLSKNLTQIFMVYCNVMICQQATLSGEAERPKVADAVIEAPELA* |
| Ga0134075_104978761 | 3300014154 | Grasslands Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEAVNPTEA* |
| Ga0182037_103099122 | 3300016404 | Soil | MSCSEKKLSKYLTQIFIAYCNVVICQQATLSGEAERPKVADAVIEAGWHI |
| Ga0134112_102380592 | 3300017656 | Grasslands Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLSGDAERPKVADAVIEATF |
| Ga0163161_102792862 | 3300017792 | Switchgrass Rhizosphere | MGCSEKKLSKNLTQIFMVYCNVMICQQATLSGEAERPKVADAVIEAALSIDEVGS |
| Ga0163161_115994191 | 3300017792 | Switchgrass Rhizosphere | MGCSEKKLSKNLTQTFMAYCNAMLCQQTTLSGEAERPKVADAVIE |
| Ga0190266_101645201 | 3300017965 | Soil | MGCGDKKLSKYLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEAYF |
| Ga0210379_100343533 | 3300021081 | Groundwater Sediment | EKLLKYLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEAETERLDLREG |
| Ga0179596_106793632 | 3300021086 | Vadose Zone Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEA |
| Ga0193719_104705492 | 3300021344 | Soil | MGCADKKLSEYLTHAFMAHCDTMICSQVTLSGEAEWPKVADAVIEAGLCNEF |
| Ga0222625_14625302 | 3300022195 | Groundwater Sediment | MGCGDEKLSKYLTQTFIAHCNAMICQQVTLSGDAEWPKVADAVIEAP |
| Ga0207706_103902612 | 3300025933 | Corn Rhizosphere | MGCSEKKLSKNLTQIFMVYCNVMICQQATLSGEAERPKVADAVIEADKGEPLWMV |
| Ga0207706_113263511 | 3300025933 | Corn Rhizosphere | MGCGDEKLSKSLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEARQGNTNEEVSI |
| Ga0207639_119926182 | 3300026041 | Corn Rhizosphere | MGCGDEKLSKSLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEAGVCYRLSKASR |
| Ga0207675_1023583102 | 3300026118 | Switchgrass Rhizosphere | MGCDDEKLSKYLTHTFMAHCHTMICQQVTLSGAAEWPKVADAVIEARGLPSTTDA |
| Ga0257166_10007731 | 3300026358 | Soil | MGCGDEKLSKYLTQTFIAHCNAMICQQVTLSGDAEWPKVADAVIEAK |
| Ga0257177_10874291 | 3300026480 | Soil | MGCGDEKLSKYLTQTFIAHCNAMICQQVTLSGDAEWPKVADAVIEAYMRKRLKP |
| Ga0257156_11345442 | 3300026498 | Soil | MGCDDEKLSKYLTHTFMAHCHTMICQQVTLSGAAEWPKVADAVIEADFLIDP |
| Ga0257165_10162181 | 3300026507 | Soil | MGCDDEKLSKYLTHTFMAHCHTMICQQVTLSGEAEWPKVADAVIEAL |
| Ga0209474_103390733 | 3300026550 | Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEAVWMTCGRLIRDKITSTISMA |
| Ga0209003_10320212 | 3300027576 | Forest Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLSGAAEWPKVADAVIEA |
| Ga0209388_11271652 | 3300027655 | Vadose Zone Soil | RQKLLKYLTQTFMSHGNEMICQPVTLSGYAEWPKVADAVIEAK |
| Ga0209178_14306211 | 3300027725 | Agricultural Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLSGDAEWPKVA |
| Ga0208989_103038942 | 3300027738 | Forest Soil | MGCDDEKLSKYLTHTFMAHCHTMICQQVTLSGAAEWPKVADAVIE |
| Ga0209461_101740601 | 3300027750 | Agave | LSKYLTQTFTAYCNVMICQQATLSDEAERPKVADAVIEAPVLIYGRIGI |
| Ga0209180_105076052 | 3300027846 | Vadose Zone Soil | LLKYLTQTFMAHGNEMICQQVTLSGYAEWPKVADAVI |
| Ga0209180_107436881 | 3300027846 | Vadose Zone Soil | MGCGDEKLSKDLTQTFTAHCNAMICQQVTLLGDAEWPKVADAVIEAEEWY |
| Ga0209283_100585995 | 3300027875 | Vadose Zone Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEARNC |
| Ga0209283_105413441 | 3300027875 | Vadose Zone Soil | MGCGDEKLSKDLTQTFTAHCNAMICQQVTLLGDAEWPKVADAVIEAEEWYL |
| Ga0209283_108215402 | 3300027875 | Vadose Zone Soil | MGCDDEKLSKYLTHTFMAHCHTMICQQVTLSGEAEWPKVA |
| Ga0209590_100600501 | 3300027882 | Vadose Zone Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEAKKPTAKRR |
| Ga0209590_107503761 | 3300027882 | Vadose Zone Soil | MGCGDKKLSKYLTQTFTAHCNAMICQQVTLLGDAEWPKVADAV |
| Ga0209488_102484012 | 3300027903 | Vadose Zone Soil | DEKLSKYLTHAFMAHCNTMICQQGTLAGEAEWPKVADAVIEAEK |
| Ga0209526_101132543 | 3300028047 | Forest Soil | MGCGDEKLSKYLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEAEFSFCSLKHYAKRP |
| Ga0268264_110804202 | 3300028381 | Switchgrass Rhizosphere | MGCGDEKLSKYLTQTFIAYCNAMICQPVTLSGDAEWPKVADAVIEA |
| Ga0247818_107273521 | 3300028589 | Soil | QKLLKYLTQTFMSHCNEMICQPVTLSGYAEWPKVADAVIEADLSGRALARAA |
| Ga0307312_106142031 | 3300028828 | Soil | MGYADEKLSKYLTHAFMAHCNTMICQQVTLSGEAEWPKVADAVIEALYGPFAIR |
| Ga0307497_100115573 | 3300031226 | Soil | MGCGDKKLSKSLTQTFTAHCNAMRCQQVTLSGDAEWLKVADAVIEA |
| Ga0306924_103337021 | 3300032076 | Soil | MDCGGKKLPKYLTQTRMAHCSATICQQATLSGGAEWPKVADAVIKALQYTSNRSWRR |
| Ga0307470_100383061 | 3300032174 | Hardwood Forest Soil | MGCGDEKLSKSLTQTFTAHCNAMICQQVTLSGDAEWPKVADAVIEAVELFPNKE |
| ⦗Top⦘ |