| Basic Information | |
|---|---|
| Family ID | F036606 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 169 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MPANDPAQYEMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQG |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 169 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 69.23 % |
| % of genes near scaffold ends (potentially truncated) | 37.28 % |
| % of genes from short scaffolds (< 2000 bps) | 77.51 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (44.970 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (30.178 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.704 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (65.680 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.16% β-sheet: 0.00% Coil/Unstructured: 87.84% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 169 Family Scaffolds |
|---|---|---|
| PF13252 | DUF4043 | 14.79 |
| PF01391 | Collagen | 5.33 |
| PF09723 | Zn-ribbon_8 | 1.78 |
| PF07659 | DUF1599 | 0.59 |
| PF01755 | Glyco_transf_25 | 0.59 |
| COG ID | Name | Functional Category | % Frequency in 169 Family Scaffolds |
|---|---|---|---|
| COG3306 | Glycosyltransferase involved in LPS biosynthesis, GR25 family | Cell wall/membrane/envelope biogenesis [M] | 0.59 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.03 % |
| Unclassified | root | N/A | 44.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002145|S2t7BSb_10534528 | All Organisms → Viruses → Predicted Viral | 2493 | Open in IMG/M |
| 3300003277|JGI25908J49247_10003775 | All Organisms → Viruses → Predicted Viral | 4840 | Open in IMG/M |
| 3300003499|JGI25930J51415_1003427 | All Organisms → Viruses → Predicted Viral | 3489 | Open in IMG/M |
| 3300004240|Ga0007787_10177587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1031 | Open in IMG/M |
| 3300004796|Ga0007763_11364582 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300005417|Ga0068884_1459631 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300005417|Ga0068884_1577648 | Not Available | 772 | Open in IMG/M |
| 3300005525|Ga0068877_10043669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 2986 | Open in IMG/M |
| 3300005525|Ga0068877_10110173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1718 | Open in IMG/M |
| 3300005525|Ga0068877_10482697 | Not Available | 687 | Open in IMG/M |
| 3300005527|Ga0068876_10118167 | Not Available | 1574 | Open in IMG/M |
| 3300005527|Ga0068876_10222143 | Not Available | 1090 | Open in IMG/M |
| 3300005527|Ga0068876_10586843 | Not Available | 605 | Open in IMG/M |
| 3300005527|Ga0068876_10722508 | Not Available | 531 | Open in IMG/M |
| 3300005527|Ga0068876_10774054 | Not Available | 508 | Open in IMG/M |
| 3300005528|Ga0068872_10125482 | All Organisms → Viruses → Predicted Viral | 1513 | Open in IMG/M |
| 3300005565|Ga0068885_1828948 | Not Available | 546 | Open in IMG/M |
| 3300005565|Ga0068885_1898202 | Not Available | 1143 | Open in IMG/M |
| 3300005805|Ga0079957_1182259 | All Organisms → Viruses → Predicted Viral | 1031 | Open in IMG/M |
| 3300005943|Ga0073926_10064160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 723 | Open in IMG/M |
| 3300006030|Ga0075470_10226683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 530 | Open in IMG/M |
| 3300006802|Ga0070749_10011808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 5628 | Open in IMG/M |
| 3300006802|Ga0070749_10408374 | Not Available | 748 | Open in IMG/M |
| 3300006802|Ga0070749_10485483 | Not Available | 674 | Open in IMG/M |
| 3300007216|Ga0103961_1032197 | All Organisms → Viruses → Predicted Viral | 1203 | Open in IMG/M |
| 3300007304|Ga0102689_1041212 | All Organisms → Viruses → Predicted Viral | 3111 | Open in IMG/M |
| 3300007321|Ga0102692_1627746 | Not Available | 690 | Open in IMG/M |
| 3300007534|Ga0102690_1770206 | Not Available | 509 | Open in IMG/M |
| 3300007538|Ga0099851_1264635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 612 | Open in IMG/M |
| 3300007541|Ga0099848_1078202 | All Organisms → Viruses → Predicted Viral | 1293 | Open in IMG/M |
| 3300007992|Ga0105748_10129416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1025 | Open in IMG/M |
| 3300008107|Ga0114340_1069790 | Not Available | 2250 | Open in IMG/M |
| 3300008107|Ga0114340_1210732 | Not Available | 639 | Open in IMG/M |
| 3300008110|Ga0114343_1031935 | All Organisms → Viruses → Predicted Viral | 2188 | Open in IMG/M |
| 3300008110|Ga0114343_1032009 | All Organisms → Viruses → Predicted Viral | 2185 | Open in IMG/M |
| 3300008110|Ga0114343_1041492 | All Organisms → Viruses → Predicted Viral | 1837 | Open in IMG/M |
| 3300008113|Ga0114346_1251315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 657 | Open in IMG/M |
| 3300008114|Ga0114347_1030350 | All Organisms → Viruses → Predicted Viral | 2451 | Open in IMG/M |
| 3300008116|Ga0114350_1002014 | Not Available | 11071 | Open in IMG/M |
| 3300008116|Ga0114350_1146026 | Not Available | 668 | Open in IMG/M |
| 3300008116|Ga0114350_1168030 | Not Available | 583 | Open in IMG/M |
| 3300008117|Ga0114351_1274860 | Not Available | 816 | Open in IMG/M |
| 3300008120|Ga0114355_1122937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 973 | Open in IMG/M |
| 3300008266|Ga0114363_1013098 | All Organisms → Viruses → Predicted Viral | 3844 | Open in IMG/M |
| 3300008266|Ga0114363_1026569 | All Organisms → Viruses → Predicted Viral | 3568 | Open in IMG/M |
| 3300008266|Ga0114363_1061652 | All Organisms → Viruses → Predicted Viral | 1455 | Open in IMG/M |
| 3300008266|Ga0114363_1130015 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 862 | Open in IMG/M |
| 3300008448|Ga0114876_1086586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1285 | Open in IMG/M |
| 3300008448|Ga0114876_1183271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 726 | Open in IMG/M |
| 3300008450|Ga0114880_1203287 | Not Available | 662 | Open in IMG/M |
| 3300008450|Ga0114880_1262165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 530 | Open in IMG/M |
| 3300009081|Ga0105098_10021422 | All Organisms → Viruses → Predicted Viral | 2475 | Open in IMG/M |
| 3300010156|Ga0068873_1003303 | All Organisms → Viruses → Predicted Viral | 1689 | Open in IMG/M |
| 3300010318|Ga0136656_1019211 | All Organisms → Viruses → Predicted Viral | 2481 | Open in IMG/M |
| 3300010354|Ga0129333_10005623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 11802 | Open in IMG/M |
| 3300010354|Ga0129333_10065336 | All Organisms → Viruses → Predicted Viral | 3385 | Open in IMG/M |
| 3300010354|Ga0129333_10102132 | All Organisms → Viruses → Predicted Viral | 2649 | Open in IMG/M |
| 3300010354|Ga0129333_10203846 | All Organisms → Viruses → Predicted Viral | 1798 | Open in IMG/M |
| 3300010354|Ga0129333_10680645 | Not Available | 886 | Open in IMG/M |
| 3300010354|Ga0129333_11123201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 655 | Open in IMG/M |
| 3300010354|Ga0129333_11338933 | Not Available | 591 | Open in IMG/M |
| 3300010370|Ga0129336_10561502 | Not Available | 611 | Open in IMG/M |
| 3300012968|Ga0129337_1392090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 514 | Open in IMG/M |
| (restricted) 3300013122|Ga0172374_1157348 | Not Available | 837 | Open in IMG/M |
| (restricted) 3300013122|Ga0172374_1244075 | Not Available | 643 | Open in IMG/M |
| (restricted) 3300013125|Ga0172369_10115029 | All Organisms → Viruses → Predicted Viral | 1715 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10064565 | All Organisms → cellular organisms → Bacteria | 2780 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10529576 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 643 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10536622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 673 | Open in IMG/M |
| (restricted) 3300013130|Ga0172363_10439244 | Not Available | 842 | Open in IMG/M |
| (restricted) 3300013130|Ga0172363_10487296 | Not Available | 790 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10419038 | Not Available | 830 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10931043 | Not Available | 529 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10781998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 591 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10604069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 601 | Open in IMG/M |
| 3300014801|Ga0119946_1020543 | Not Available | 679 | Open in IMG/M |
| 3300017722|Ga0181347_1013404 | All Organisms → Viruses → Predicted Viral | 2643 | Open in IMG/M |
| 3300017722|Ga0181347_1158298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 615 | Open in IMG/M |
| 3300017736|Ga0181365_1124008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 618 | Open in IMG/M |
| 3300017761|Ga0181356_1132882 | Not Available | 784 | Open in IMG/M |
| 3300017774|Ga0181358_1194161 | Not Available | 668 | Open in IMG/M |
| 3300017777|Ga0181357_1200841 | Not Available | 712 | Open in IMG/M |
| 3300017777|Ga0181357_1286012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 564 | Open in IMG/M |
| 3300017778|Ga0181349_1213702 | Not Available | 660 | Open in IMG/M |
| 3300017780|Ga0181346_1290963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 557 | Open in IMG/M |
| 3300017785|Ga0181355_1311011 | Not Available | 589 | Open in IMG/M |
| 3300017785|Ga0181355_1340512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 553 | Open in IMG/M |
| 3300017788|Ga0169931_10689233 | Not Available | 675 | Open in IMG/M |
| 3300017788|Ga0169931_10861809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 575 | Open in IMG/M |
| 3300017788|Ga0169931_11030043 | Not Available | 506 | Open in IMG/M |
| 3300019122|Ga0188839_1029819 | Not Available | 540 | Open in IMG/M |
| 3300019784|Ga0181359_1004844 | All Organisms → Viruses → Predicted Viral | 4315 | Open in IMG/M |
| 3300019784|Ga0181359_1018025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 2643 | Open in IMG/M |
| 3300019784|Ga0181359_1038147 | All Organisms → Viruses → Predicted Viral | 1860 | Open in IMG/M |
| 3300019784|Ga0181359_1115944 | Not Available | 964 | Open in IMG/M |
| 3300019784|Ga0181359_1189528 | Not Available | 672 | Open in IMG/M |
| 3300020074|Ga0194113_10249687 | Not Available | 1379 | Open in IMG/M |
| 3300020159|Ga0211734_10688468 | Not Available | 552 | Open in IMG/M |
| 3300020172|Ga0211729_10593429 | Not Available | 515 | Open in IMG/M |
| 3300020183|Ga0194115_10026567 | All Organisms → Viruses → Predicted Viral | 4253 | Open in IMG/M |
| 3300020221|Ga0194127_10031112 | All Organisms → Viruses → Predicted Viral | 4542 | Open in IMG/M |
| 3300020570|Ga0208465_1014337 | All Organisms → Viruses → Predicted Viral | 1071 | Open in IMG/M |
| 3300021091|Ga0194133_10116773 | All Organisms → Viruses → Predicted Viral | 1994 | Open in IMG/M |
| 3300021376|Ga0194130_10069334 | All Organisms → cellular organisms → Bacteria | 2410 | Open in IMG/M |
| 3300021959|Ga0222716_10180034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 1355 | Open in IMG/M |
| 3300021961|Ga0222714_10274802 | Not Available | 934 | Open in IMG/M |
| 3300021963|Ga0222712_10170224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1452 | Open in IMG/M |
| 3300022179|Ga0181353_1144711 | Not Available | 551 | Open in IMG/M |
| 3300024352|Ga0255142_1038019 | Not Available | 752 | Open in IMG/M |
| 3300024355|Ga0255157_1035911 | Not Available | 831 | Open in IMG/M |
| 3300024506|Ga0255168_1014331 | All Organisms → Viruses → Predicted Viral | 1470 | Open in IMG/M |
| 3300024857|Ga0256339_1015817 | All Organisms → Viruses → Predicted Viral | 1616 | Open in IMG/M |
| 3300024866|Ga0255272_1074389 | Not Available | 856 | Open in IMG/M |
| 3300025585|Ga0208546_1000092 | Not Available | 40411 | Open in IMG/M |
| 3300025646|Ga0208161_1000641 | Not Available | 19782 | Open in IMG/M |
| 3300025646|Ga0208161_1060371 | All Organisms → Viruses → Predicted Viral | 1169 | Open in IMG/M |
| 3300025647|Ga0208160_1017064 | All Organisms → Viruses → Predicted Viral | 2349 | Open in IMG/M |
| 3300025655|Ga0208795_1128647 | All Organisms → Viruses | 652 | Open in IMG/M |
| 3300025655|Ga0208795_1183713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 500 | Open in IMG/M |
| 3300025872|Ga0208783_10187861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 860 | Open in IMG/M |
| 3300025889|Ga0208644_1327151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 596 | Open in IMG/M |
| 3300026566|Ga0256334_1045024 | Not Available | 1012 | Open in IMG/M |
| 3300026569|Ga0255277_1060054 | Not Available | 980 | Open in IMG/M |
| 3300027337|Ga0255087_1014681 | All Organisms → Viruses → Predicted Viral | 1796 | Open in IMG/M |
| 3300027508|Ga0255072_1009278 | All Organisms → Viruses → Predicted Viral | 2129 | Open in IMG/M |
| 3300027608|Ga0208974_1060502 | Not Available | 1068 | Open in IMG/M |
| 3300027659|Ga0208975_1191597 | Not Available | 551 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1149274 | All Organisms → Viruses → Predicted Viral | 1013 | Open in IMG/M |
| 3300027793|Ga0209972_10001643 | Not Available | 19212 | Open in IMG/M |
| 3300027793|Ga0209972_10002698 | Not Available | 14356 | Open in IMG/M |
| 3300027793|Ga0209972_10025387 | All Organisms → Viruses → Predicted Viral | 3530 | Open in IMG/M |
| 3300027793|Ga0209972_10032982 | All Organisms → Viruses → Predicted Viral | 2976 | Open in IMG/M |
| 3300027793|Ga0209972_10050618 | All Organisms → cellular organisms → Bacteria | 2266 | Open in IMG/M |
| 3300027793|Ga0209972_10126145 | All Organisms → Viruses → Predicted Viral | 1253 | Open in IMG/M |
| 3300027793|Ga0209972_10243797 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 814 | Open in IMG/M |
| 3300027793|Ga0209972_10297225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 713 | Open in IMG/M |
| 3300027793|Ga0209972_10349135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 640 | Open in IMG/M |
| 3300027804|Ga0209358_10018356 | All Organisms → Viruses → Predicted Viral | 4480 | Open in IMG/M |
| 3300027805|Ga0209229_10002766 | Not Available | 7261 | Open in IMG/M |
| 3300027805|Ga0209229_10221289 | Not Available | 845 | Open in IMG/M |
| 3300027806|Ga0209985_10283880 | Not Available | 753 | Open in IMG/M |
| 3300027816|Ga0209990_10415668 | Not Available | 582 | Open in IMG/M |
| 3300027917|Ga0209536_100263172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 2160 | Open in IMG/M |
| 3300028286|Ga0256331_1093079 | Not Available | 682 | Open in IMG/M |
| 3300028530|Ga0255279_1057521 | Not Available | 666 | Open in IMG/M |
| 3300029301|Ga0135222_1022129 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 533 | Open in IMG/M |
| 3300029930|Ga0119944_1037816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 604 | Open in IMG/M |
| 3300029933|Ga0119945_1008845 | All Organisms → Viruses → Predicted Viral | 1331 | Open in IMG/M |
| 3300031758|Ga0315907_10165287 | Not Available | 1869 | Open in IMG/M |
| 3300031758|Ga0315907_10641089 | Not Available | 817 | Open in IMG/M |
| 3300031758|Ga0315907_10939079 | Not Available | 631 | Open in IMG/M |
| 3300031787|Ga0315900_10345382 | All Organisms → Viruses → Predicted Viral | 1204 | Open in IMG/M |
| 3300031787|Ga0315900_10385472 | Not Available | 1113 | Open in IMG/M |
| 3300031787|Ga0315900_10468157 | Not Available | 968 | Open in IMG/M |
| 3300031857|Ga0315909_10071074 | All Organisms → Viruses → Predicted Viral | 3111 | Open in IMG/M |
| 3300031857|Ga0315909_10247967 | All Organisms → Viruses → Predicted Viral | 1369 | Open in IMG/M |
| 3300031857|Ga0315909_10649308 | Not Available | 694 | Open in IMG/M |
| 3300031857|Ga0315909_10694240 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
| 3300031857|Ga0315909_10751490 | Not Available | 624 | Open in IMG/M |
| 3300031857|Ga0315909_10933870 | Not Available | 531 | Open in IMG/M |
| 3300031951|Ga0315904_10990589 | Not Available | 667 | Open in IMG/M |
| 3300031951|Ga0315904_11221205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 575 | Open in IMG/M |
| 3300031951|Ga0315904_11484751 | Not Available | 500 | Open in IMG/M |
| 3300032050|Ga0315906_10849576 | Not Available | 708 | Open in IMG/M |
| 3300032092|Ga0315905_11003390 | Not Available | 702 | Open in IMG/M |
| 3300032093|Ga0315902_10900030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 681 | Open in IMG/M |
| 3300032116|Ga0315903_10675208 | Not Available | 777 | Open in IMG/M |
| 3300032116|Ga0315903_10745853 | Not Available | 724 | Open in IMG/M |
| 3300032116|Ga0315903_11152399 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 30.18% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 12.43% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 9.47% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.69% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 6.51% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.92% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 5.33% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.78% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 1.78% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.78% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.18% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.18% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.18% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.59% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.59% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.59% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.59% |
| Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 0.59% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.59% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.59% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002145 | S2t7BSb (114f) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004796 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005417 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005565 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300007216 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007304 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007321 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007534 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300010156 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel2S_0400h metaG | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
| 3300013125 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.25m | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
| 3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300014801 | Aquatic microbial communities from drinking water treatment system in Nanjing, China - Filtered water - FW | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300019122 | Metatranscriptome of marine microbial communities from Baltic Sea - GS677_0p1 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300024352 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300024355 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h | Environmental | Open in IMG/M |
| 3300024506 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8d | Environmental | Open in IMG/M |
| 3300024857 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024866 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026566 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026569 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027337 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8d | Environmental | Open in IMG/M |
| 3300027508 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027806 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028286 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028530 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029301 | Marine harbor viral communities from the Indian Ocean - SRH1 | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| S2t7BSb_105345285 | 3300002145 | Marine | MPANDPKQYEKSEEFMPYPSDTNDKPFMTYEQLQSGAPGKSAK* |
| JGI25908J49247_1000377510 | 3300003277 | Freshwater Lake | MPANDPAQYEETEDFLPYPSDTNEKPFMTYEKLMTGAPGKNC* |
| JGI25930J51415_10034277 | 3300003499 | Freshwater Lake | MPANDPKQYEESEDFMPYPSDTNDKPFMTYEKLQSGAPGKSAK* |
| Ga0007787_101775871 | 3300004240 | Freshwater Lake | MPANDPAQYEMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGN* |
| Ga0007763_113645822 | 3300004796 | Freshwater Lake | MPANDPKQYDSKYVAEENEYLPWPSDTNDKPFMTYDKLMTGAPGKPAK* |
| Ga0068884_14596312 | 3300005417 | Freshwater Lake | MPANDPKQYEMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK* |
| Ga0068884_15776482 | 3300005417 | Freshwater Lake | MPANDPKQYDSKYVAEENEYLPWPSDTNDKPFMTYEKLMTGAPGKSAK* |
| Ga0068877_100436696 | 3300005525 | Freshwater Lake | MPANDPAQYDGKFVPEEDEFMPWPSDTNDKPFMTYDKLMT |
| Ga0068877_101101734 | 3300005525 | Freshwater Lake | MPINDPEQYEMEDEFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK* |
| Ga0068877_104826973 | 3300005525 | Freshwater Lake | MPANDPKQYEGKYVAEENEYLPWPSDTNDKPFMTYDKLMTGAMGKPAKQGK* |
| Ga0068876_101181673 | 3300005527 | Freshwater Lake | MPINDPEQYEMEDEFLPWPSDTNDKPFMTYDKLMTGAPGKPVK* |
| Ga0068876_102221433 | 3300005527 | Freshwater Lake | MPANDPKQYEGKFVAEENEYMPWPSDTNDKPFMTYDKLMTGAPGKAAK* |
| Ga0068876_105868432 | 3300005527 | Freshwater Lake | MPANDPKQYDSKYEAEENEYLPWPSDTNDKPFMTYDKLMTGAPGKSAK* |
| Ga0068876_107225082 | 3300005527 | Freshwater Lake | MPANDPKQYEGKFVPEEDDFFPYPSDSNDGPFMTYEKLQAGAPGKPAPRQGR* |
| Ga0068876_107740543 | 3300005527 | Freshwater Lake | MPANDPGQYEMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK* |
| Ga0068872_101254824 | 3300005528 | Freshwater Lake | MPANDPAQYDGKFVPEKDEFMPWPSDTNDKPFMTYDKLMTGAPGKPAPKQ* |
| Ga0068885_18289482 | 3300005565 | Freshwater Lake | MPANDPAQYEMEDELMPWPSDTNDKPFMTYDKLMTGAPGKPAPKQ* |
| Ga0068885_18982022 | 3300005565 | Freshwater Lake | MPINDPEQYEMEDEFLPWPSDTNDKPFMTYDKLMTGAPGKAAK* |
| Ga0079957_11822594 | 3300005805 | Lake | MPANDPAQYDGKFVPEEDEFMPWPSDTNDKPFMTYDKLMTGAPGKPAPKQ* |
| Ga0073926_100641603 | 3300005943 | Sand | MPANDPAQYEETEDFLPYPSDTNEKPFMTYDKLMTGAPGKNC* |
| Ga0075470_102266831 | 3300006030 | Aqueous | ANDPAQYEMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK* |
| Ga0070749_100118088 | 3300006802 | Aqueous | MPANDPAQYEMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK* |
| Ga0070749_104083742 | 3300006802 | Aqueous | MPANDPKQYEMEDDFLPYPSDSNDKPFMTYEKLMKGAMGKPAPKQGK* |
| Ga0070749_104854832 | 3300006802 | Aqueous | MPANDPKQYEMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGN* |
| Ga0103961_10321973 | 3300007216 | Freshwater Lake | MPANDPAQYEAENEEYFLPWPSDTNDKPFMTYDKLMSGAPGKAAK* |
| Ga0102689_10412122 | 3300007304 | Freshwater Lake | MPANDPKQYEESEDFMPWPSDTNDKPFMTYDKLMTGAPGKAAK* |
| Ga0102692_16277462 | 3300007321 | Freshwater Lake | MPANDPKQYEESEDFIPYPSDTNDKPFMTYEKLQSGAPGKSAK* |
| Ga0102690_17702062 | 3300007534 | Freshwater Lake | MPINDPEQYEMEDEFLPWPSDTNDKPFMTYDKLMTGAMGKPAKQGK* |
| Ga0099851_12646351 | 3300007538 | Aqueous | MPANDPKQYEMEDDFLPYPSDSNDKPFMTYEKLQSGAPGKAAK* |
| Ga0099848_10782021 | 3300007541 | Aqueous | MPANDPKQYDGKFVPEKDEFMPWPSDTNDKPFMTYDKLMTGAPGKPAPKQ* |
| Ga0105748_101294161 | 3300007992 | Estuary Water | MPANDPAQYEETEDFLPYPSDTNEKPFMTYDKLMTGAPGK |
| Ga0114340_10697903 | 3300008107 | Freshwater, Plankton | MTQHVKEMPANDPAQYEMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK* |
| Ga0114340_12107323 | 3300008107 | Freshwater, Plankton | MPANDPAQYKMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQ |
| Ga0114343_10319355 | 3300008110 | Freshwater, Plankton | MPANDPKQYEESEDFIPYPSDTNDKPFMTYEKLQSG |
| Ga0114343_10320094 | 3300008110 | Freshwater, Plankton | MPANDPAQYKMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGN* |
| Ga0114343_10414924 | 3300008110 | Freshwater, Plankton | MPANDPKQYDSKYVAEENEYLPWPSDTNDKPFMTYDKLMTGAPGKSAK* |
| Ga0114346_12513151 | 3300008113 | Freshwater, Plankton | NQTYLQGVTMPANDPAQYEMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGN* |
| Ga0114347_10303501 | 3300008114 | Freshwater, Plankton | SRRSKMPANDPKQYEMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK* |
| Ga0114350_100201418 | 3300008116 | Freshwater, Plankton | MPANDPAQYEGKFVPEEDDFLPYPSNSNDGPFMTYEKLQAGAPGKPAPRQGR* |
| Ga0114350_11460261 | 3300008116 | Freshwater, Plankton | INDPEQYEMEDEFLPWPSDTNDKPFMTYDKLMTGAPGKAAK* |
| Ga0114350_11680301 | 3300008116 | Freshwater, Plankton | INDPEQYEMEDEFLPWPSDTNDKPFMTYDKLMTGAPGKPVK* |
| Ga0114351_12748603 | 3300008117 | Freshwater, Plankton | MPANDPAQYDGKFVPEEDEFMPWPSDTNDKPFMTYDKLMTGAPGKPAPRQ* |
| Ga0114355_11229373 | 3300008120 | Freshwater, Plankton | MPANDPAQYEMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKSAPKQGK* |
| Ga0114363_10130986 | 3300008266 | Freshwater, Plankton | MPANDPKQYEGKFVPEEDEFMPYPSDTNDKPFMTYEKLQAGAPGKMVKR* |
| Ga0114363_10265697 | 3300008266 | Freshwater, Plankton | MPANDPKQYEGKFIPEEDDFFPYPSNSNDGPFMTYEKLQAGAPGKPAPRQGR* |
| Ga0114363_10616523 | 3300008266 | Freshwater, Plankton | MPANDPKQYEMEDDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK* |
| Ga0114363_11300151 | 3300008266 | Freshwater, Plankton | MPANDPAQYEMEDEFMPWPSDTNDKPFMTNDKLMTGAPGKPAPRQ* |
| Ga0114876_10865863 | 3300008448 | Freshwater Lake | MPANDPAQYEMEEDFLPWPSNTNDKPFMTYDKLMSGAMGKSAPKQGK* |
| Ga0114876_11832712 | 3300008448 | Freshwater Lake | MPANDPEQYEMEDEFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK* |
| Ga0114880_12032871 | 3300008450 | Freshwater Lake | DPEQYEMEDEFLPWPSDTNDKPFMTYDKLMTGAPGKAAK* |
| Ga0114880_12621651 | 3300008450 | Freshwater Lake | LQGVTMPANDPAQYEMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK* |
| Ga0105098_100214226 | 3300009081 | Freshwater Sediment | MPANDPKQYEGKFVPEKDEFMPYPSDTNDKPFMTYEKLQAGAPGKMVK* |
| Ga0068873_10033032 | 3300010156 | Freshwater Lake | MPANDPKQYEESEDFMPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK* |
| Ga0136656_10192115 | 3300010318 | Freshwater To Marine Saline Gradient | MPANDPKQYEMEDDFLPYPLDSNDKPFMTYEKLQSGAPGKYLDK* |
| Ga0129333_1000562310 | 3300010354 | Freshwater To Marine Saline Gradient | MPANDPAQYEMEDEFLPWPSDTNDKPFMTYDKLMSGAPGKAAK* |
| Ga0129333_100653366 | 3300010354 | Freshwater To Marine Saline Gradient | MPANDPGQYEMEDELLPWPSDTNDKPFMTYDKLMTGAPGKAAK* |
| Ga0129333_101021325 | 3300010354 | Freshwater To Marine Saline Gradient | MPANDPKQYEGKFVPEEDEFMPYPSDTNDKPFMTYEKLQAGAPGKMVK* |
| Ga0129333_102038464 | 3300010354 | Freshwater To Marine Saline Gradient | MPANDPKQYEGKYVAEENEYLPWPSDTNDKPFMTYDKLMTGAPGKAAK* |
| Ga0129333_106806453 | 3300010354 | Freshwater To Marine Saline Gradient | MPANDPKQYEMEDEFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK* |
| Ga0129333_111232014 | 3300010354 | Freshwater To Marine Saline Gradient | AEKEEYYTPWPPDTNEKPFMTYEGLMKGAAGKPAPKQGK* |
| Ga0129333_113389331 | 3300010354 | Freshwater To Marine Saline Gradient | ANDPGQYEMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK* |
| Ga0129336_105615021 | 3300010370 | Freshwater To Marine Saline Gradient | TMPANDPAQYEMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGN* |
| Ga0129337_13920902 | 3300012968 | Aqueous | MPANDPAQYEMEDEFLPWPSDTNDKPFMTYDKLMSGSPGKAAK* |
| (restricted) Ga0172374_11573484 | 3300013122 | Freshwater | DPKQYEESEDFMPYPSDTNDKPFMTYEKLQSGAPGKSAK* |
| (restricted) Ga0172374_12440751 | 3300013122 | Freshwater | MPANDPKQYEMEDDYLPYPSDTNDKPFMTYEKLQTGAYGKKP* |
| (restricted) Ga0172369_101150292 | 3300013125 | Freshwater | MPANDPKQYDSKYVAKENEFLPYPSDTNDKPFMTYEKLQSGAPGKAAK* |
| (restricted) Ga0172367_100645654 | 3300013126 | Freshwater | MPANDPKQYEGKFVPEKEDYMPYPSDTNDKPFMTYEKLQTGAYGKKP* |
| (restricted) Ga0172367_105295763 | 3300013126 | Freshwater | MPANDPKQYEESEDFMPYPSDTNDKPFMTYEKLQTGAYGKKP* |
| (restricted) Ga0172365_105366222 | 3300013127 | Sediment | MPANDPKQYDSKYVAKENEFLPYPSDTNDKPFMTYEKLQSGAPGKVAK* |
| (restricted) Ga0172363_104392441 | 3300013130 | Sediment | NDPKQYEKSEDFMPYPSDTNDKPFMTYEKLQSGAPGKPAK* |
| (restricted) Ga0172363_104872963 | 3300013130 | Sediment | MPANDPKQYDSKYVAKENEFLPYPSDTNDKPFMTYEKLQSGAPGKSAK* |
| (restricted) Ga0172373_104190383 | 3300013131 | Freshwater | MPANDPKQYEMEEDFLPWPSNTNDKPFMTYDKLMAGAPGKPAK* |
| (restricted) Ga0172372_109310431 | 3300013132 | Freshwater | MPANDPKQYEESEDFMSYPSDTNDKPFMTYEKLQSGAPGKSAK* |
| (restricted) Ga0172375_107819981 | 3300013137 | Freshwater | QYDSKYVAKENEFLPYPSDTNDKPFMTYEKLQSGAPGKAAK* |
| (restricted) Ga0172376_106040691 | 3300014720 | Freshwater | YEESEDFMPYPSDTNDKPFMTYEKLQTGAYGKKP* |
| Ga0119946_10205433 | 3300014801 | Aquatic | MPANDPKQYEGKYVAEENEYLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK* |
| Ga0181347_10134046 | 3300017722 | Freshwater Lake | MPANDPAQYEETEDFLPYPSDTNEKPFMTYEKLMTGA |
| Ga0181347_11582983 | 3300017722 | Freshwater Lake | GVDMPANDPAQYEETEDFLPYPSDTNEKPFMTYEKLMTGAPGKNC |
| Ga0181365_11240081 | 3300017736 | Freshwater Lake | GVDMPANDPAQYEETEDFLPYPSDTNEKPFMTYEKLMTGAPGMSKKGKK |
| Ga0181356_11328821 | 3300017761 | Freshwater Lake | QTYLQGVDMPANDPAQYEETEDFLPYPSDTNEKPFMTYDKLMTGAPGKNC |
| Ga0181358_11941611 | 3300017774 | Freshwater Lake | VDMPANDPAQYEETEDFLPYPSDTNEKPFMTYDKLMTGAPGKNC |
| Ga0181357_12008411 | 3300017777 | Freshwater Lake | WNQTYLQGVDMPANDPAQYEETEDFLPYPSDTNEKPFMTYDKLMTGAPGKNC |
| Ga0181357_12860121 | 3300017777 | Freshwater Lake | PAQYEETEDFLPYPSDTNEKPFMTYEKLMTGAPGMSKKGKK |
| Ga0181349_12137023 | 3300017778 | Freshwater Lake | YLQGVDMPANDPAQYEETEDFLPYPSDTNEKPFMTYDKLMTGAPGKNC |
| Ga0181346_12909631 | 3300017780 | Freshwater Lake | YEETEDFLPYPSDTNEKPFMTYEKLMTGAPGMSKKGKK |
| Ga0181355_13110113 | 3300017785 | Freshwater Lake | MPANDPKQYEGKYVAEENEYLPWPSDTNDKPFMTYDKLMTGAPGKPAK |
| Ga0181355_13405121 | 3300017785 | Freshwater Lake | LQGVTMPANDPAQYEMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK |
| Ga0169931_106892333 | 3300017788 | Freshwater | MPANDPKQYEGKFVPEKEDYMPYPSDTNDKPFMTYE |
| Ga0169931_108618091 | 3300017788 | Freshwater | MPANDPKQYDSKYVAKENEFLPYPSDTNDKPFMTYEKLQSGAPGKAAK |
| Ga0169931_110300432 | 3300017788 | Freshwater | MPANDPKQYEKSEDFMPYPSDTNDKPFMTYEKLQSGAPGKPAK |
| Ga0188839_10298191 | 3300019122 | Freshwater Lake | MPANDPKQYEKSEEFMPYPSDTNDKPFMSYEELQSGAPGKSAK |
| Ga0181359_10048447 | 3300019784 | Freshwater Lake | MPANDPAQYEMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK |
| Ga0181359_10180255 | 3300019784 | Freshwater Lake | MPANDPAQYEETEDFLPYPSDTNEKPFMTYDKLMTGAPGKNC |
| Ga0181359_10381477 | 3300019784 | Freshwater Lake | PAQYEETEDFLPYPSDTNEKPFMTYEKLMTGAPGKNC |
| Ga0181359_11159443 | 3300019784 | Freshwater Lake | MPANDPKQYEESEDFMPYPSDTNDKPFMTYEKLQSGAPGKSAK |
| Ga0181359_11895281 | 3300019784 | Freshwater Lake | MPANDPKQYEMEDEFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQG |
| Ga0194113_102496873 | 3300020074 | Freshwater Lake | MPANDPKQYEGKFVPKEDKFMPYPSDTNDKPFMTYEKLQSGAPGKPAR |
| Ga0211734_106884683 | 3300020159 | Freshwater | MPANDPKQYDSKYVAEENEYLPWPSDTNDKPFMTYDKLMTGAPGKSAK |
| Ga0211729_105934292 | 3300020172 | Freshwater | MPANDPKQYDSKYVAEENEYLPWPSDTNDKPFMTYEKLMTGAPGKSAK |
| Ga0194115_100265674 | 3300020183 | Freshwater Lake | MPANDPKQYEESEDFIPYPSDTNDKPFMTYEKLQSGAPGKSAK |
| Ga0194127_100311129 | 3300020221 | Freshwater Lake | MPVNDPKQYEESEDFIPYPSDTNDKPFMTYEKLQSGAPGKSAK |
| Ga0208465_10143371 | 3300020570 | Freshwater | MPANDPKQYEMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK |
| Ga0194133_101167733 | 3300021091 | Freshwater Lake | MPANDPKQYEMEDEFMPWPSDTNDKPFMTYDKLMTGAAGKPAPKQ |
| Ga0194130_100693345 | 3300021376 | Freshwater Lake | MPVNDPKQYEESEDFMPYPSDTNDKPFMTYEKLQSGAPGKSAK |
| Ga0222716_101800344 | 3300021959 | Estuarine Water | MPANDPKQYEESEDFMPYPSDTNDKPFMTYEKLQSGAPGKPAK |
| Ga0222714_102748021 | 3300021961 | Estuarine Water | ANDPKQYEESEDFMPYPSDTNDKPFMTYEKLQSGAPGKSAK |
| Ga0222712_101702245 | 3300021963 | Estuarine Water | MPANDPAQYEMENEEYFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK |
| Ga0181353_11447111 | 3300022179 | Freshwater Lake | MPANDPEQYEMEDEFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK |
| Ga0255142_10380193 | 3300024352 | Freshwater | MPANDPAQYEMEEDFLPWPSDTNDKPFMTYDKLMSCAMGKPAPKQGK |
| Ga0255157_10359114 | 3300024355 | Freshwater | YEMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK |
| Ga0255168_10143311 | 3300024506 | Freshwater | PAQYEAENEEYFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK |
| Ga0256339_10158176 | 3300024857 | Freshwater | MPANDTKPYEMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK |
| Ga0255272_10743892 | 3300024866 | Freshwater | MPANDAAQYEAENEEYFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKHGK |
| Ga0208546_100009236 | 3300025585 | Aqueous | MPANDPAQYEMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGN |
| Ga0208161_100064110 | 3300025646 | Aqueous | MPANDPKQYEMEDDFLPYPSDSNDKPFMTYEKLQSGAPGKAAK |
| Ga0208161_10603711 | 3300025646 | Aqueous | MPANDPKQYEMEDDFLPYPSDSNDKPFMTYEKLQSGAPGKSAK |
| Ga0208160_10170645 | 3300025647 | Aqueous | MPANDPKQYEMEDDFLPYPSDSNDKPFMTYEKLQSG |
| Ga0208795_11286471 | 3300025655 | Aqueous | ANDPKQYEMEDDFLPYPSDSNDKPFMTYEKLQSGAPGKSAK |
| Ga0208795_11837131 | 3300025655 | Aqueous | DPKQYEMEDDFLPYPSDSNDKPFMTYEKLQSGAPGKAAK |
| Ga0208783_101878615 | 3300025872 | Aqueous | GVTMPANDPAQYEMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGN |
| Ga0208644_13271513 | 3300025889 | Aqueous | MPANDPKQYEMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGN |
| Ga0256334_10450245 | 3300026566 | Freshwater | DPAQYEMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK |
| Ga0255277_10600541 | 3300026569 | Freshwater | MPANDPAQYEMEEDLLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK |
| Ga0255087_10146811 | 3300027337 | Freshwater | AQYEETEDFLPYPSDTNEKPFMTYDKLMTGAPGKNC |
| Ga0255072_10092786 | 3300027508 | Freshwater | LQGVDMPANDPAQYEETEDFLPYPSDTNEKPFMTYEKLMTGAPGKNC |
| Ga0208974_10605022 | 3300027608 | Freshwater Lentic | MPANDPKQYEESEDFMPYPSDTNDKPFMTYDKLMTGAPGKPAK |
| Ga0208975_11915971 | 3300027659 | Freshwater Lentic | MPANDPKQYDSKYVAEENEYLPWPSDTNDKPFMTYDK |
| (restricted) Ga0247836_11492743 | 3300027728 | Freshwater | MPTNDPKQYDSKYVAEENEYLPWPSDTNDKPFMTYDKLMTGAPGKPAK |
| Ga0209972_100016437 | 3300027793 | Freshwater Lake | MPANDPKQYEESEDFMPWPSDTNDKPFMTYDKLMTGAPGKAAK |
| Ga0209972_100026989 | 3300027793 | Freshwater Lake | MPANDPAQYDGKFVPEEDEFMPWPSDTNDKPFMTYDKLMTGAPGKPAPKQ |
| Ga0209972_100253875 | 3300027793 | Freshwater Lake | MPANDPKQYEGKYVAEENEYLPWPSDTNDKPFMTYDKLMTGAMGKPAKQGK |
| Ga0209972_100329821 | 3300027793 | Freshwater Lake | MPANDPAQYDGKFVPEKDEFMPWPSDTNDKPFMTYDKLMTGAPGKPAPKQ |
| Ga0209972_100506187 | 3300027793 | Freshwater Lake | MPINDPEQYEMEDEFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK |
| Ga0209972_101261455 | 3300027793 | Freshwater Lake | PKFQGVIMPANDPAQYDGKFVPEKDEFMPWPSDTNDKPFMTYDKLMTGAPGKPAPKQ |
| Ga0209972_102437971 | 3300027793 | Freshwater Lake | KFQGVIMPANDPAQYDGKFVPEEDEFMPWPSDTNDKPFMTYDKLMTGAPGKPAPKQ |
| Ga0209972_102972251 | 3300027793 | Freshwater Lake | GVTMPANDPAQYEMVEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK |
| Ga0209972_103491354 | 3300027793 | Freshwater Lake | TVTLWASRRTKMPINDPEQYEMEDEFLPWPSDTNDKPFMTYDKLMTGAPGKPVK |
| Ga0209358_1001835611 | 3300027804 | Freshwater Lake | NDPKQYEESEDFMPYPSDTNDKPFMTYEKLQSGAPGKSAK |
| Ga0209229_1000276612 | 3300027805 | Freshwater And Sediment | MPANDPKQYNSKYEAEENEYLPWPSDTNDKPFMTYDKLMTGAPGKPAK |
| Ga0209229_102212893 | 3300027805 | Freshwater And Sediment | MPANDPKQYEESEDFMPYPSDTNDKPFMTYEDLQRGANGAYPKKQGK |
| Ga0209985_102838803 | 3300027806 | Freshwater Lake | MPANDPAQYEMEDELMPWPSDTNDKPFMTYDKLMTGAPGKPAPKQ |
| Ga0209990_104156681 | 3300027816 | Freshwater Lake | MPINDPEQYEMEDEFLPWPSDTNDKPFMTYDKLMTGAPGKPVK |
| Ga0209536_1002631724 | 3300027917 | Marine Sediment | MPANDPKQYEMEDDFLPYPSDSNDKPFMTYDKLQSGAPGKSVK |
| Ga0256331_10930791 | 3300028286 | Freshwater | AQYEAENEEYFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK |
| Ga0255279_10575211 | 3300028530 | Freshwater | KQYEMEEDFLPWPSDTNDKPFMTYDKLMSGAMAKPAPKQGK |
| Ga0135222_10221293 | 3300029301 | Marine Harbor | ASCLCFPVTIIQYEMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK |
| Ga0119944_10378163 | 3300029930 | Aquatic | MPANDPKQYEMEDEFLPWPSDTNDKPFMTYDKLMSGAPGKAAK |
| Ga0119945_10088454 | 3300029933 | Aquatic | MPANDPKQYEMEDEFLPWPSDTNDKPFMTYDKLMTGAPGKAAK |
| Ga0315907_101652878 | 3300031758 | Freshwater | MPANDPKQYEMEDDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK |
| Ga0315907_106410892 | 3300031758 | Freshwater | MPINDPEQYEMEDEFLPWPSDTNDKPFMTYDKLMTGAPGKAAK |
| Ga0315907_109390793 | 3300031758 | Freshwater | MPANDPAQYDGKFVPEKDEFMPWPSDTNDKPFMTYDKLMTGAPG |
| Ga0315900_103453826 | 3300031787 | Freshwater | MSANDPKQYEESEDFMPYPSDTNDKPFMTYEKLQSGAPGKSAK |
| Ga0315900_103854721 | 3300031787 | Freshwater | TKMPINDPEQYEMEDEFLPWPSDTNDKPFMTYDKLMTGAPGKPVK |
| Ga0315900_104681572 | 3300031787 | Freshwater | MPANDPKQYEGKFVPEEDEFMPYPSDTNDKPFMTYEKLQAGAPGKMVKR |
| Ga0315909_100710743 | 3300031857 | Freshwater | MPANDPAQYEGKFVPEEDDFLPYPSNSNDGPFMTYEKLQAGAPGKPAPRQGR |
| Ga0315909_102479673 | 3300031857 | Freshwater | MPANDPKQYEGKFIPEEDDFFPYPSNSNDGPFMTYEKLQAGAPGKPAPRQGR |
| Ga0315909_106493081 | 3300031857 | Freshwater | TKMPINDPEQYEMEDEFLPWPSDTNDKPFMTYDKLMTGAPGKAAK |
| Ga0315909_106942402 | 3300031857 | Freshwater | MPANDPKQYEGKFVPEEDEFMPYPSDTNDKPFMTYEKLQAGAPGKMVK |
| Ga0315909_107514903 | 3300031857 | Freshwater | RTKMPANDPKQYEMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK |
| Ga0315909_109338703 | 3300031857 | Freshwater | MPANDPKQYEEFEDFMPYPSDTNDKPFMTYEKLQSGAPGKSAK |
| Ga0315904_109905893 | 3300031951 | Freshwater | MPANDPAQYEMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQG |
| Ga0315904_112212053 | 3300031951 | Freshwater | PAQYEMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK |
| Ga0315904_114847511 | 3300031951 | Freshwater | EMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGN |
| Ga0315906_108495761 | 3300032050 | Freshwater | MPANDPEQYEMEDEFLPWPSDTNDKPFMTYDKLMS |
| Ga0315905_110033903 | 3300032092 | Freshwater | MPANDPKQYEGKYVAEENEYLPWPSDTNDKPFMTYDKLMTGAPGKAAK |
| Ga0315902_109000304 | 3300032093 | Freshwater | LSRRNKMPANDPAQYKMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGK |
| Ga0315903_106752081 | 3300032116 | Freshwater | VRWNQPYLQGVTMPANDPAQYEMEDELMPWPSDTNDKPFMTYDKLMTGAPGKPAPKQ |
| Ga0315903_107458533 | 3300032116 | Freshwater | MPANDPKQYEESEDFMSYPSDTNDKPFMTYEKLQSGAPGKSAK |
| Ga0315903_111523991 | 3300032116 | Freshwater | LQGVTMPANDPAQYEMEDEFMPWPSDTNDKPFMTYDKLMTGAPGKPAPRQ |
| ⦗Top⦘ |