Basic Information | |
---|---|
Family ID | F036574 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 169 |
Average Sequence Length | 42 residues |
Representative Sequence | NLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFFSII |
Number of Associated Samples | 76 |
Number of Associated Scaffolds | 169 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 17.26 % |
% of genes near scaffold ends (potentially truncated) | 89.35 % |
% of genes from short scaffolds (< 2000 bps) | 81.07 % |
Associated GOLD sequencing projects | 75 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.27 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (78.698 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (34.319 % of family members) |
Environment Ontology (ENVO) | Unclassified (55.030 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.030 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.37% β-sheet: 0.00% Coil/Unstructured: 74.63% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 169 Family Scaffolds |
---|---|---|
PF00296 | Bac_luciferase | 4.14 |
PF14559 | TPR_19 | 2.37 |
PF03070 | TENA_THI-4 | 2.37 |
PF07992 | Pyr_redox_2 | 2.37 |
PF00582 | Usp | 1.78 |
PF02771 | Acyl-CoA_dh_N | 1.78 |
PF01494 | FAD_binding_3 | 1.78 |
PF04909 | Amidohydro_2 | 1.78 |
PF01370 | Epimerase | 1.78 |
PF03992 | ABM | 1.78 |
PF13676 | TIR_2 | 1.18 |
PF10771 | DUF2582 | 1.18 |
PF08240 | ADH_N | 1.18 |
PF09335 | SNARE_assoc | 1.18 |
PF00903 | Glyoxalase | 1.18 |
PF04536 | TPM_phosphatase | 1.18 |
PF08281 | Sigma70_r4_2 | 1.18 |
PF14833 | NAD_binding_11 | 1.18 |
PF01425 | Amidase | 1.18 |
PF04453 | LptD | 1.18 |
PF00196 | GerE | 1.18 |
PF11453 | DUF2950 | 0.59 |
PF00528 | BPD_transp_1 | 0.59 |
PF00355 | Rieske | 0.59 |
PF13280 | WYL | 0.59 |
PF13501 | SoxY | 0.59 |
PF16363 | GDP_Man_Dehyd | 0.59 |
PF16576 | HlyD_D23 | 0.59 |
PF01041 | DegT_DnrJ_EryC1 | 0.59 |
PF00583 | Acetyltransf_1 | 0.59 |
PF13519 | VWA_2 | 0.59 |
PF14366 | DUF4410 | 0.59 |
PF00300 | His_Phos_1 | 0.59 |
PF00565 | SNase | 0.59 |
PF12697 | Abhydrolase_6 | 0.59 |
PF07885 | Ion_trans_2 | 0.59 |
PF02746 | MR_MLE_N | 0.59 |
PF02811 | PHP | 0.59 |
PF12172 | DUF35_N | 0.59 |
PF08269 | dCache_2 | 0.59 |
PF15902 | Sortilin-Vps10 | 0.59 |
PF01434 | Peptidase_M41 | 0.59 |
PF04392 | ABC_sub_bind | 0.59 |
PF00795 | CN_hydrolase | 0.59 |
PF13379 | NMT1_2 | 0.59 |
PF05598 | DUF772 | 0.59 |
PF13483 | Lactamase_B_3 | 0.59 |
PF03781 | FGE-sulfatase | 0.59 |
PF13500 | AAA_26 | 0.59 |
PF09084 | NMT1 | 0.59 |
PF00589 | Phage_integrase | 0.59 |
PF05973 | Gp49 | 0.59 |
PF02894 | GFO_IDH_MocA_C | 0.59 |
PF03401 | TctC | 0.59 |
PF07331 | TctB | 0.59 |
PF13410 | GST_C_2 | 0.59 |
PF07044 | DUF1329 | 0.59 |
PF03942 | DTW | 0.59 |
PF01522 | Polysacc_deac_1 | 0.59 |
PF02371 | Transposase_20 | 0.59 |
PF01909 | NTP_transf_2 | 0.59 |
PF00005 | ABC_tran | 0.59 |
PF13650 | Asp_protease_2 | 0.59 |
PF13673 | Acetyltransf_10 | 0.59 |
PF00691 | OmpA | 0.59 |
PF02518 | HATPase_c | 0.59 |
PF03972 | MmgE_PrpD | 0.59 |
PF00857 | Isochorismatase | 0.59 |
PF03745 | DUF309 | 0.59 |
PF13378 | MR_MLE_C | 0.59 |
PF01844 | HNH | 0.59 |
PF01557 | FAA_hydrolase | 0.59 |
PF00497 | SBP_bac_3 | 0.59 |
PF07452 | CHRD | 0.59 |
PF00571 | CBS | 0.59 |
PF13387 | DUF4105 | 0.59 |
PF04966 | OprB | 0.59 |
PF00535 | Glycos_transf_2 | 0.59 |
PF03886 | ABC_trans_aux | 0.59 |
PF07592 | DDE_Tnp_ISAZ013 | 0.59 |
PF03446 | NAD_binding_2 | 0.59 |
PF07969 | Amidohydro_3 | 0.59 |
PF04945 | YHS | 0.59 |
PF13533 | Biotin_lipoyl_2 | 0.59 |
COG ID | Name | Functional Category | % Frequency in 169 Family Scaffolds |
---|---|---|---|
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 4.14 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 3.55 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 1.78 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.78 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 1.78 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.78 |
COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 1.18 |
COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 1.18 |
COG1452 | LPS assembly outer membrane protein LptD (organic solvent tolerance protein OstA) | Cell wall/membrane/envelope biogenesis [M] | 1.18 |
COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 1.18 |
COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 1.18 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.18 |
COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.59 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.59 |
COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.59 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.59 |
COG3659 | Carbohydrate-selective porin OprB | Cell wall/membrane/envelope biogenesis [M] | 0.59 |
COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.59 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.59 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.59 |
COG3148 | tRNA U47 aminocarboxypropyltransferaseTapT/TuaA/ YfiP, DTW domain | Translation, ribosomal structure and biogenesis [J] | 0.59 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.59 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.59 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.59 |
COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.59 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.59 |
COG1547 | Predicted metal-dependent hydrolase | Function unknown [S] | 0.59 |
COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.59 |
COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 0.59 |
COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.59 |
COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.59 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.59 |
COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.59 |
COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.59 |
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.59 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 78.70 % |
Unclassified | root | N/A | 21.30 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000580|AF_2010_repII_A01DRAFT_1014285 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
3300000580|AF_2010_repII_A01DRAFT_1022662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 992 | Open in IMG/M |
3300000580|AF_2010_repII_A01DRAFT_1077792 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10007750 | All Organisms → cellular organisms → Bacteria | 2959 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10035510 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10097351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium Casp-Chloro-G4 | 727 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1012155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 1642 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10031223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1247 | Open in IMG/M |
3300000837|AP72_2010_repI_A100DRAFT_1007298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1565 | Open in IMG/M |
3300002124|C687J26631_10023444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2192 | Open in IMG/M |
3300002124|C687J26631_10035623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1761 | Open in IMG/M |
3300002124|C687J26631_10151917 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300002124|C687J26631_10191907 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 680 | Open in IMG/M |
3300002124|C687J26631_10245251 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300002503|C687J35164_10153386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 665 | Open in IMG/M |
3300004633|Ga0066395_10004679 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4758 | Open in IMG/M |
3300004633|Ga0066395_10040481 | All Organisms → cellular organisms → Bacteria | 2006 | Open in IMG/M |
3300004633|Ga0066395_10126043 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
3300004633|Ga0066395_10200831 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1043 | Open in IMG/M |
3300004633|Ga0066395_10364052 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300004633|Ga0066395_10392133 | Not Available | 780 | Open in IMG/M |
3300004633|Ga0066395_10442776 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300004633|Ga0066395_10646559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 623 | Open in IMG/M |
3300004633|Ga0066395_10736752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 587 | Open in IMG/M |
3300005332|Ga0066388_101205904 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
3300005332|Ga0066388_101697458 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
3300005332|Ga0066388_101805522 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
3300005332|Ga0066388_103138390 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 844 | Open in IMG/M |
3300005363|Ga0008090_10162207 | All Organisms → cellular organisms → Bacteria | 1600 | Open in IMG/M |
3300005764|Ga0066903_101491001 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
3300005764|Ga0066903_103828689 | Not Available | 808 | Open in IMG/M |
3300005764|Ga0066903_107556417 | Not Available | 560 | Open in IMG/M |
3300005764|Ga0066903_108608011 | Not Available | 519 | Open in IMG/M |
3300006049|Ga0075417_10163238 | Not Available | 1042 | Open in IMG/M |
3300006880|Ga0075429_101224293 | Not Available | 655 | Open in IMG/M |
3300009157|Ga0105092_10051559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2209 | Open in IMG/M |
3300009792|Ga0126374_10036829 | All Organisms → cellular organisms → Bacteria | 2357 | Open in IMG/M |
3300009792|Ga0126374_10183723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1305 | Open in IMG/M |
3300009792|Ga0126374_10567172 | Not Available | 832 | Open in IMG/M |
3300009792|Ga0126374_11141552 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 620 | Open in IMG/M |
3300009792|Ga0126374_11325600 | Not Available | 583 | Open in IMG/M |
3300010043|Ga0126380_10134092 | All Organisms → cellular organisms → Bacteria | 1555 | Open in IMG/M |
3300010046|Ga0126384_10089507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2241 | Open in IMG/M |
3300010046|Ga0126384_10226087 | All Organisms → cellular organisms → Bacteria | 1498 | Open in IMG/M |
3300010046|Ga0126384_10227289 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1494 | Open in IMG/M |
3300010047|Ga0126382_10027388 | All Organisms → cellular organisms → Bacteria | 3075 | Open in IMG/M |
3300010047|Ga0126382_10128773 | All Organisms → cellular organisms → Bacteria | 1694 | Open in IMG/M |
3300010047|Ga0126382_10735624 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
3300010047|Ga0126382_11521948 | Not Available | 616 | Open in IMG/M |
3300010047|Ga0126382_12042353 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300010048|Ga0126373_10055632 | All Organisms → cellular organisms → Bacteria | 3530 | Open in IMG/M |
3300010048|Ga0126373_10324596 | Not Available | 1543 | Open in IMG/M |
3300010048|Ga0126373_10478984 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1284 | Open in IMG/M |
3300010048|Ga0126373_10679275 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
3300010048|Ga0126373_10803635 | Not Available | 1002 | Open in IMG/M |
3300010048|Ga0126373_11431425 | Not Available | 757 | Open in IMG/M |
3300010048|Ga0126373_11680067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 699 | Open in IMG/M |
3300010048|Ga0126373_12443941 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300010048|Ga0126373_13030116 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300010359|Ga0126376_10196628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1666 | Open in IMG/M |
3300010359|Ga0126376_10687312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 982 | Open in IMG/M |
3300010359|Ga0126376_11112907 | Not Available | 799 | Open in IMG/M |
3300010359|Ga0126376_12331306 | Not Available | 581 | Open in IMG/M |
3300010359|Ga0126376_13085774 | Not Available | 515 | Open in IMG/M |
3300010361|Ga0126378_10301454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1706 | Open in IMG/M |
3300010361|Ga0126378_11602141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 739 | Open in IMG/M |
3300010362|Ga0126377_10014230 | All Organisms → cellular organisms → Bacteria | 6339 | Open in IMG/M |
3300010362|Ga0126377_10090252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2772 | Open in IMG/M |
3300010362|Ga0126377_10149699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2191 | Open in IMG/M |
3300010362|Ga0126377_10186231 | All Organisms → cellular organisms → Bacteria | 1979 | Open in IMG/M |
3300010362|Ga0126377_11023886 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
3300010362|Ga0126377_13417500 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300010366|Ga0126379_10560202 | Not Available | 1223 | Open in IMG/M |
3300010366|Ga0126379_11835022 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 710 | Open in IMG/M |
3300010376|Ga0126381_100940367 | Not Available | 1245 | Open in IMG/M |
3300010376|Ga0126381_104305161 | Not Available | 551 | Open in IMG/M |
3300010398|Ga0126383_11278232 | Not Available | 824 | Open in IMG/M |
3300010398|Ga0126383_12952331 | Not Available | 555 | Open in IMG/M |
3300011434|Ga0137464_1089774 | Not Available | 897 | Open in IMG/M |
3300012171|Ga0137342_1013986 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1393 | Open in IMG/M |
3300012948|Ga0126375_10123604 | All Organisms → cellular organisms → Bacteria | 1583 | Open in IMG/M |
3300012948|Ga0126375_10750681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
3300012948|Ga0126375_10755867 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300012948|Ga0126375_10995585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 682 | Open in IMG/M |
3300012948|Ga0126375_11205721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 630 | Open in IMG/M |
3300012971|Ga0126369_10092660 | All Organisms → cellular organisms → Bacteria | 2713 | Open in IMG/M |
3300012971|Ga0126369_10119739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 2423 | Open in IMG/M |
3300012971|Ga0126369_10484181 | Not Available | 1292 | Open in IMG/M |
3300012971|Ga0126369_11598036 | Not Available | 742 | Open in IMG/M |
3300012971|Ga0126369_12041058 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 661 | Open in IMG/M |
3300014255|Ga0075320_1099435 | Not Available | 574 | Open in IMG/M |
3300014255|Ga0075320_1138373 | Not Available | 508 | Open in IMG/M |
3300014315|Ga0075350_1043934 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
3300014873|Ga0180066_1017895 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
3300014873|Ga0180066_1093601 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300014881|Ga0180094_1009317 | Not Available | 1794 | Open in IMG/M |
3300014883|Ga0180086_1043585 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
3300015254|Ga0180089_1118415 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300018056|Ga0184623_10028684 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2500 | Open in IMG/M |
3300018063|Ga0184637_10710258 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300018072|Ga0184635_10298543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 631 | Open in IMG/M |
3300018077|Ga0184633_10011703 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4196 | Open in IMG/M |
3300018077|Ga0184633_10012758 | All Organisms → cellular organisms → Bacteria | 4039 | Open in IMG/M |
3300018077|Ga0184633_10015994 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3654 | Open in IMG/M |
3300018078|Ga0184612_10522371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 576 | Open in IMG/M |
3300018079|Ga0184627_10024332 | All Organisms → cellular organisms → Bacteria | 3005 | Open in IMG/M |
3300018082|Ga0184639_10005240 | All Organisms → cellular organisms → Bacteria | 5984 | Open in IMG/M |
3300021051|Ga0206224_1034012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 647 | Open in IMG/M |
3300021081|Ga0210379_10551086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 514 | Open in IMG/M |
3300021560|Ga0126371_10167631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 2271 | Open in IMG/M |
3300021560|Ga0126371_10228044 | All Organisms → cellular organisms → Bacteria | 1970 | Open in IMG/M |
3300021560|Ga0126371_11144096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 916 | Open in IMG/M |
3300021560|Ga0126371_11181449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 902 | Open in IMG/M |
3300021560|Ga0126371_12184148 | Not Available | 668 | Open in IMG/M |
3300021560|Ga0126371_13243088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 550 | Open in IMG/M |
3300024241|Ga0233392_1011513 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 842 | Open in IMG/M |
3300025119|Ga0209126_1049048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1247 | Open in IMG/M |
3300025119|Ga0209126_1187316 | Not Available | 543 | Open in IMG/M |
3300025146|Ga0209322_10364696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 567 | Open in IMG/M |
3300025155|Ga0209320_10193469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 886 | Open in IMG/M |
3300025160|Ga0209109_10061443 | All Organisms → cellular organisms → Bacteria | 1977 | Open in IMG/M |
3300025160|Ga0209109_10069629 | Not Available | 1843 | Open in IMG/M |
3300025160|Ga0209109_10077030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1740 | Open in IMG/M |
3300025160|Ga0209109_10100805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1490 | Open in IMG/M |
3300025164|Ga0209521_10286902 | Not Available | 942 | Open in IMG/M |
3300025165|Ga0209108_10035705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2791 | Open in IMG/M |
3300025165|Ga0209108_10192645 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
3300025289|Ga0209002_10351808 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300025289|Ga0209002_10458750 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. CG24B | 712 | Open in IMG/M |
3300025311|Ga0209343_10145015 | All Organisms → cellular organisms → Bacteria | 1879 | Open in IMG/M |
3300025311|Ga0209343_10352825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 989 | Open in IMG/M |
3300025311|Ga0209343_10630685 | Not Available | 636 | Open in IMG/M |
3300025311|Ga0209343_10839021 | Not Available | 501 | Open in IMG/M |
3300025312|Ga0209321_10113311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1486 | Open in IMG/M |
3300025322|Ga0209641_11122007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 500 | Open in IMG/M |
3300025324|Ga0209640_10051600 | All Organisms → cellular organisms → Bacteria | 3574 | Open in IMG/M |
3300025324|Ga0209640_10307304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1324 | Open in IMG/M |
3300025324|Ga0209640_10443600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1066 | Open in IMG/M |
3300025324|Ga0209640_10491177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1002 | Open in IMG/M |
3300025324|Ga0209640_10521449 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 967 | Open in IMG/M |
3300025324|Ga0209640_10844207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 718 | Open in IMG/M |
3300025324|Ga0209640_11125016 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300025325|Ga0209341_10242305 | Not Available | 1498 | Open in IMG/M |
3300025326|Ga0209342_10772010 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300026053|Ga0208422_1023494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 732 | Open in IMG/M |
3300027527|Ga0209684_1002215 | All Organisms → cellular organisms → Bacteria | 3373 | Open in IMG/M |
3300027527|Ga0209684_1006630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1905 | Open in IMG/M |
3300027527|Ga0209684_1006756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1883 | Open in IMG/M |
3300027527|Ga0209684_1016850 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
3300027654|Ga0209799_1016191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1621 | Open in IMG/M |
3300027654|Ga0209799_1029434 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
3300027722|Ga0209819_10015489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2495 | Open in IMG/M |
3300027815|Ga0209726_10031890 | All Organisms → cellular organisms → Bacteria | 4071 | Open in IMG/M |
3300027840|Ga0209683_10105201 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
3300030606|Ga0299906_10897366 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 654 | Open in IMG/M |
3300031720|Ga0307469_10059184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2464 | Open in IMG/M |
3300031949|Ga0214473_10024621 | All Organisms → cellular organisms → Bacteria | 7044 | Open in IMG/M |
3300031949|Ga0214473_10040149 | All Organisms → cellular organisms → Bacteria | 5490 | Open in IMG/M |
3300031949|Ga0214473_10824761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 997 | Open in IMG/M |
3300031965|Ga0326597_11016981 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
3300031965|Ga0326597_11209881 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300033407|Ga0214472_10585280 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1026 | Open in IMG/M |
3300033417|Ga0214471_11067308 | Not Available | 619 | Open in IMG/M |
3300033419|Ga0316601_102484620 | Not Available | 521 | Open in IMG/M |
3300033814|Ga0364930_0124010 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300034115|Ga0364945_0002012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5605 | Open in IMG/M |
3300034147|Ga0364925_0018047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2218 | Open in IMG/M |
3300034148|Ga0364927_0249677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 532 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 34.32% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 14.20% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 10.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.10% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.33% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 5.33% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.14% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.96% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 2.37% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.37% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.37% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.78% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.18% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.18% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.18% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.59% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.59% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.59% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.59% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.59% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.59% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
3300002503 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011434 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2 | Environmental | Open in IMG/M |
3300012171 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014255 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2 | Environmental | Open in IMG/M |
3300014315 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1 | Environmental | Open in IMG/M |
3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
3300015254 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300021051 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1 | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024241 | Subsurface microbial communities from Mancos shale, Colorado, United States - Mancos A_50_July_PB | Environmental | Open in IMG/M |
3300025119 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_1 (SPAdes) | Environmental | Open in IMG/M |
3300025146 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 1 | Environmental | Open in IMG/M |
3300025155 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4 | Environmental | Open in IMG/M |
3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
3300025164 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4 | Environmental | Open in IMG/M |
3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
3300025289 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2 | Environmental | Open in IMG/M |
3300025311 | Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 (SPAdes) | Environmental | Open in IMG/M |
3300025312 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4 | Environmental | Open in IMG/M |
3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
3300026053 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AF_2010_repII_A01DRAFT_10142852 | 3300000580 | Forest Soil | MLKNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFFIIIGIQNLSLR* |
AF_2010_repII_A01DRAFT_10226622 | 3300000580 | Forest Soil | LFLILLKNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFFSIINR* |
AF_2010_repII_A01DRAFT_10777921 | 3300000580 | Forest Soil | MIKAILLKNLRSSFESLRTNGEAVEIMGDFSVHAERVEA |
AF_2010_repII_A1DRAFT_100077502 | 3300000597 | Forest Soil | MLKNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFFSIINR* |
AF_2010_repII_A1DRAFT_100355103 | 3300000597 | Forest Soil | SSFESLRTNGEAVEIMGDFSVHAERVEAFLGFFIIIGIQNLSLR* |
AF_2010_repII_A1DRAFT_100973512 | 3300000597 | Forest Soil | ESLRTNGEAVEIMGDFSVHAERVEAFLGFFSIIYGYHYHA* |
AF_2010_repII_A100DRAFT_10121552 | 3300000655 | Forest Soil | LILLKNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFFSIIYGYHYHAGV* |
AF_2010_repII_A001DRAFT_100312231 | 3300000793 | Forest Soil | LLKNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFFSIINR* |
AP72_2010_repI_A100DRAFT_10072982 | 3300000837 | Forest Soil | VTPVTICHSILLKNLRSSFESLRTNGEAVEVMGDFSVHAERVEAFLGFFSRIYF* |
C687J26631_100234441 | 3300002124 | Soil | NGGASEIIGDFPFMLSLVEAFIGFFSRIDYVDRR* |
C687J26631_100356231 | 3300002124 | Soil | NLRTNGGAGEINGDFPFMLSLVEAFIGFFSRIDCCV* |
C687J26631_101519171 | 3300002124 | Soil | ESLRTNGGASEIIGDFPFMLSLVEAFIGFFSRIAMYEHF* |
C687J26631_101919071 | 3300002124 | Soil | SFESLRTNGGACEIIGDFPFVLSLVEAFIGFFSGIDI* |
C687J26631_102452511 | 3300002124 | Soil | LRTNGGASEIIGDFPFMLSLVEAFIGFFSRIINQIERS* |
C687J35164_101533862 | 3300002503 | Soil | LKNLRSSFENLRTNGRAVEIIGDFSVHAEPVEAFLGFFSRIKVESRPCAN* |
Ga0066395_100046791 | 3300004633 | Tropical Forest Soil | KNLRSSFESLRTNGEPVEIMGDFSVHAERVEAFLGFFSRIGYGVRKNF* |
Ga0066395_100404811 | 3300004633 | Tropical Forest Soil | NLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFFSIIKIDK* |
Ga0066395_101260431 | 3300004633 | Tropical Forest Soil | LIHLLILLKNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGF |
Ga0066395_102008311 | 3300004633 | Tropical Forest Soil | MIKAILLKNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGF |
Ga0066395_103640522 | 3300004633 | Tropical Forest Soil | VPRDEGFPLILLKNLRSSFESLRTNGEPVEIMGDFSVHAERV |
Ga0066395_103921331 | 3300004633 | Tropical Forest Soil | LKNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFFSISL* |
Ga0066395_104427762 | 3300004633 | Tropical Forest Soil | VSDVRIKILLKNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLG |
Ga0066395_106465591 | 3300004633 | Tropical Forest Soil | NLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFFSIITI* |
Ga0066395_107367522 | 3300004633 | Tropical Forest Soil | LIPILLKNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFL |
Ga0066388_1012059041 | 3300005332 | Tropical Forest Soil | NLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFFSIIIYIY* |
Ga0066388_1016974583 | 3300005332 | Tropical Forest Soil | MIKAILLKNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLG |
Ga0066388_1018055221 | 3300005332 | Tropical Forest Soil | MTILLKNLRSSFESLRTNGEAVEIMGDFSVDAERAEAFLGFFSINHS* |
Ga0066388_1031383901 | 3300005332 | Tropical Forest Soil | VIKAILLKNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFFSI |
Ga0008090_101622071 | 3300005363 | Tropical Rainforest Soil | LILLKNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFFSRI |
Ga0066903_1014910011 | 3300005764 | Tropical Forest Soil | NLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFFSII* |
Ga0066903_1038286891 | 3300005764 | Tropical Forest Soil | MILLKNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGF |
Ga0066903_1075564171 | 3300005764 | Tropical Forest Soil | KNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFFSRIIF* |
Ga0066903_1086080111 | 3300005764 | Tropical Forest Soil | NLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFFSIIIYSSLTL* |
Ga0075417_101632382 | 3300006049 | Populus Rhizosphere | LRSSFESLRTNGGAVKIIGDLPFMLSPVEAFSQFFSRIAYYTR* |
Ga0075429_1012242932 | 3300006880 | Populus Rhizosphere | RSSFESLRTNGGAVKIIGDLPFMLSPAEAFSQFFSRIAYYTR* |
Ga0105092_100515591 | 3300009157 | Freshwater Sediment | FESLRTNGGVVEIIGVFPFMLSPVEAFLGFFSRIGDRH* |
Ga0126374_100368294 | 3300009792 | Tropical Forest Soil | LKNLRSSFESLRTNGEPVEIMGDFSVHAERVEAFLGFFSRIGYGVRKNF* |
Ga0126374_101837231 | 3300009792 | Tropical Forest Soil | VPRDEGFPLILLKNLRSSFESLRTNGEPVEIMGDFSVHAERVEAFLGFF |
Ga0126374_105671721 | 3300009792 | Tropical Forest Soil | LLKNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFFSISL* |
Ga0126374_111415521 | 3300009792 | Tropical Forest Soil | MIKAILLKNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFF |
Ga0126374_113256001 | 3300009792 | Tropical Forest Soil | LESQAFNSILLKNLRSSFESLRTNGEAVKIMGDFSVHAERVEAFLGFFSII* |
Ga0126380_101340923 | 3300010043 | Tropical Forest Soil | KNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFFSIIKIDKWLPVSA* |
Ga0126384_100895074 | 3300010046 | Tropical Forest Soil | MILLKNLRSSFESLRPNGEAVEIMGDFSVHAERVEAFLGFFSIIY* |
Ga0126384_102260872 | 3300010046 | Tropical Forest Soil | LILLKNLRSSFESLRANGGAVEIIGDFPFMLSRVEAFIGFFSTIES* |
Ga0126384_102272893 | 3300010046 | Tropical Forest Soil | KNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFFSIIIYSSLTL* |
Ga0126382_100273881 | 3300010047 | Tropical Forest Soil | ILLKNLRSSFESLRTNGEPVEIMGDFSVHAERVEAFLGFFSRIGYGVRKNF* |
Ga0126382_101287731 | 3300010047 | Tropical Forest Soil | KNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFFSIIKIDK* |
Ga0126382_107356241 | 3300010047 | Tropical Forest Soil | EILRTNGGAVEMVGDFPFMLSLVEAFLGFFSSSIF* |
Ga0126382_115219481 | 3300010047 | Tropical Forest Soil | SFESLRTNGEAVEIMGDFSVHAERVEAFLGFFSISL* |
Ga0126382_120423532 | 3300010047 | Tropical Forest Soil | ESLRTNGTVVEITGDLSVHAEPVEAFLSFFGRFKI* |
Ga0126373_100556324 | 3300010048 | Tropical Forest Soil | MLRSILLKNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFF |
Ga0126373_103245961 | 3300010048 | Tropical Forest Soil | KNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFFSIITI* |
Ga0126373_104789843 | 3300010048 | Tropical Forest Soil | FESLRTNGEAVEIMGDFSVHAERVEAFLGFFSIIIYSSLTL* |
Ga0126373_106792751 | 3300010048 | Tropical Forest Soil | VPRDEGFPLILLKNLRSSFESLRTNGEPVEIMGDFSVHAERVEAFLGFFSRIGYGVRKNF |
Ga0126373_108036352 | 3300010048 | Tropical Forest Soil | MIIRPGVKILLKNLRSSFESLRTNGEAVEIMGDFSVHAERVEA |
Ga0126373_114314253 | 3300010048 | Tropical Forest Soil | SSFESLRTNGEAVEIMGDFSVHAERVEAFLGFFSISL* |
Ga0126373_116800672 | 3300010048 | Tropical Forest Soil | LKNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFFSIIKIDK* |
Ga0126373_124439412 | 3300010048 | Tropical Forest Soil | ESLRTNGEAVEIMGDFSVHAERVEAFLGFFSIIEGDE* |
Ga0126373_130301161 | 3300010048 | Tropical Forest Soil | SFESLRTNGEAVEIMGDFSVHAERVEAFLGFFSIIIYIY* |
Ga0126376_101966283 | 3300010359 | Tropical Forest Soil | FNSILLKNLRSSFESLRTNGEAVKIMGDFSVHAERVEAFLEFFSII* |
Ga0126376_106873122 | 3300010359 | Tropical Forest Soil | LLKNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFFSRI* |
Ga0126376_111129071 | 3300010359 | Tropical Forest Soil | QWGQTSMTILLKNLRSSFESLRTNGEAVEIMGDFSVDAERAEAFLGFFSINHS* |
Ga0126376_123313061 | 3300010359 | Tropical Forest Soil | FNSILLKNLRSSFESLRTNGEAVKIMGDFSVHAERVEAFLGFFSII* |
Ga0126376_130857742 | 3300010359 | Tropical Forest Soil | LLKNLRSSFESLRTNGEPVEIMGDFSVHAERVEAFLGFFSIIIYSSLTL* |
Ga0126378_103014544 | 3300010361 | Tropical Forest Soil | LLKNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFFSRIIYSSLTL* |
Ga0126378_116021412 | 3300010361 | Tropical Forest Soil | KNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFFTRI* |
Ga0126377_100142309 | 3300010362 | Tropical Forest Soil | LLKNLRSSFESLRTNGEAVEIMGDFSVDAERVEAFLGFFSINHS* |
Ga0126377_100902524 | 3300010362 | Tropical Forest Soil | KNLRSSFESLRTNGEPVEIMGDFSVHAERVEAFLGFFSRITSQA* |
Ga0126377_101496991 | 3300010362 | Tropical Forest Soil | MILLKNLRSSFESLRPNGEAVEIMGDFSVHAERVEAFLGFFSII |
Ga0126377_101862311 | 3300010362 | Tropical Forest Soil | LILLKNLRSSFESLRTNGEPVEIMGDFSVHAERVEAFLGFF |
Ga0126377_110238862 | 3300010362 | Tropical Forest Soil | VPRDEGFPLILLKNLCSSFESLRTNGEPVEIMGDFSVHAERVEAFLGFFS |
Ga0126377_134175002 | 3300010362 | Tropical Forest Soil | LILLKNLRSSFESLRTNGEAVDIMGDFSVHAERVEVFLGFFSRI |
Ga0126379_105602023 | 3300010366 | Tropical Forest Soil | KNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFFSIIEGDE* |
Ga0126379_118350223 | 3300010366 | Tropical Forest Soil | VILLKNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFF |
Ga0126381_1009403672 | 3300010376 | Tropical Forest Soil | LILLKNLRSSFESLRTNGEAVEIMGDFSVDAERVE |
Ga0126381_1043051612 | 3300010376 | Tropical Forest Soil | LPSILLKNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFF |
Ga0126383_112782321 | 3300010398 | Tropical Forest Soil | FESLRTNGEAVEIMGDFSVDAERVEAFLGFFSINHS* |
Ga0126383_129523311 | 3300010398 | Tropical Forest Soil | LKNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFFSIIEGDE* |
Ga0137464_10897741 | 3300011434 | Soil | RSSFENLRTNGGAVEIVVVFPFMLSLVEAFLGFFSRIISS* |
Ga0137342_10139861 | 3300012171 | Soil | KTLRSSFENGGVVKIVGDFPFMLSLVEAFLGFFSRISMGV* |
Ga0126375_101236042 | 3300012948 | Tropical Forest Soil | VIKAILLKNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFFSIIK |
Ga0126375_107506812 | 3300012948 | Tropical Forest Soil | LKNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFFSII* |
Ga0126375_107558672 | 3300012948 | Tropical Forest Soil | VPRDEGFPLILLKNLRSSFESLRTNGEPVEIMGDFSVHAERVE |
Ga0126375_109955851 | 3300012948 | Tropical Forest Soil | SFESLRTNGEAVEIMGDFSVHAERVEAFLGFFSIIS* |
Ga0126375_112057212 | 3300012948 | Tropical Forest Soil | LILLKNLRSSFESPRTNGEAVEIMGDFSVHAERVEAFLGFFSI |
Ga0126369_100926601 | 3300012971 | Tropical Forest Soil | KTLRSSFENLRTTGGAVEIIGDFPFMLSQVEAFLGFFSRITYIHYNL* |
Ga0126369_101197391 | 3300012971 | Tropical Forest Soil | VILLKNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLG |
Ga0126369_104841811 | 3300012971 | Tropical Forest Soil | ILLKNLRSSFESLRPNGEAVEIMGDFSVHAERVEAFLGFFSIIY* |
Ga0126369_115980362 | 3300012971 | Tropical Forest Soil | MILLKNLRSSFESLRPNGEAVEIMGDFSVHAERVEAFLGFF |
Ga0126369_120410582 | 3300012971 | Tropical Forest Soil | FESLRTNGEAVEIMGDFSVHAERVEAFLGFFSRIIF* |
Ga0075320_10994351 | 3300014255 | Natural And Restored Wetlands | SSFENLRTNGGVVKIFGDFPFMLSLVEAFLGFFSRIKF* |
Ga0075320_11383732 | 3300014255 | Natural And Restored Wetlands | MDSAQKTHRSSFENLRTNGGVVKIFGDFPFMLSLVEAFL |
Ga0075350_10439342 | 3300014315 | Natural And Restored Wetlands | SSFETLRTNGGAVEIFVEFAFMLSPVEAFLGFFSRISRDIH* |
Ga0180066_10178952 | 3300014873 | Soil | FESLRTNGGASEIIGDFPFMLSLVEAFIGFFSRIRF* |
Ga0180066_10936011 | 3300014873 | Soil | KTLRSSFESLRTNGGASEIIGDFPFMLSLVEAFIGFFSRIESRA* |
Ga0180094_10093171 | 3300014881 | Soil | SFESLRTNGGAVEIIGNYSVHAEPVETFLGIVNK* |
Ga0180086_10435851 | 3300014883 | Soil | LRSSFENLRTNGGAVEITGDFPFMLSLVEAFLRLFSTINTNG* |
Ga0180089_11184151 | 3300015254 | Soil | KTLRSSFESLRTNGGASEIIGDFPFMLSLVEAFIGFFSRIECYA* |
Ga0184623_100286843 | 3300018056 | Groundwater Sediment | MLLKNLRSSFENLRARPEFIEGTNGGAVEIVGDFPFY |
Ga0184637_107102581 | 3300018063 | Groundwater Sediment | SFESLRTNGRAVEIIEDFPFMLSLVEAFIGFFSGIDCWV |
Ga0184635_102985431 | 3300018072 | Groundwater Sediment | MILLKNLRSPFEGLRTNGGAIEMVGDFPFMLSLVEAFL |
Ga0184633_100117031 | 3300018077 | Groundwater Sediment | KTLRSSFESLRTNGGAIEIIGDFSVHAELVEAFLGFFSRIDI |
Ga0184633_100127581 | 3300018077 | Groundwater Sediment | KTLRSSFESLRTNGRAVEIIEDFPFMLSLVEAFIGFFSGIDCWV |
Ga0184633_100159946 | 3300018077 | Groundwater Sediment | LRSSFESLRTNGRAVEIIEDFPFMLSLVEAFIGFFSRIEKVACPLF |
Ga0184612_105223712 | 3300018078 | Groundwater Sediment | LIPLKIHRSSFESLRTNGGVVEIFGEFPFMLSFVEAFLGFFSRI |
Ga0184627_100243321 | 3300018079 | Groundwater Sediment | KTLRSSFESLRTNGGAIEIIGNFSVHAEPVEAFLGFFSRIDL |
Ga0184639_100052401 | 3300018082 | Groundwater Sediment | TLRSSFESLRTNGRAVEIIEDFPFMLSLVEAFIGFFSGIDCWV |
Ga0206224_10340122 | 3300021051 | Deep Subsurface Sediment | FESLRTNGGAVEIIGDFPVMLSLVEAFMRFFSRIYY |
Ga0210379_105510861 | 3300021081 | Groundwater Sediment | KTLRSSFESLRTNGGAVEIIGNFSVHAEPVEAFLGFFSRI |
Ga0126371_101676311 | 3300021560 | Tropical Forest Soil | VSDVRIKILLKNLRSSFESLRTNGEAVEIMGDFSVHAER |
Ga0126371_102280441 | 3300021560 | Tropical Forest Soil | FESLRPNGEAVEIMGDFSVHAERVEAFLGFFSIINK |
Ga0126371_111440961 | 3300021560 | Tropical Forest Soil | FESLRTNGEAVEIMEDFSVHAERVEAFLGFFSIIS |
Ga0126371_111814492 | 3300021560 | Tropical Forest Soil | LILLKNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFF |
Ga0126371_121841481 | 3300021560 | Tropical Forest Soil | ILLKNLRSSFESLRTNGEAVEIMGDFSVDAERVEAFLGFFSINHS |
Ga0126371_132430882 | 3300021560 | Tropical Forest Soil | LIPILLKNLRSSFESLRTNGEAVEIMGDFSVHAERVEAFLGFF |
Ga0233392_10115132 | 3300024241 | Deep Subsurface Sediment | LILLKNLRSSFENLRTNGGGVEIIGDFSVHAEPVEAFLGFFSRITRGEQTL |
Ga0209126_10490483 | 3300025119 | Soil | LRSSFENLRTNGGAGEIIGDFPLMLSLVEAFIGFFSRIEP |
Ga0209126_11873161 | 3300025119 | Soil | MILLKNLRSSFESLRTNGGASEIIGDFPFMLSLVEAFIGFFSRIT |
Ga0209322_103646962 | 3300025146 | Soil | MILLKNLRSSFESLRTNGGASEIIGDFPFMLSLVEAFIGFFSRITYHA |
Ga0209320_101934692 | 3300025155 | Soil | LRTNGGAGEINGDFPFMLSLVEAFIGFFSRIDCCV |
Ga0209109_100614431 | 3300025160 | Soil | TLRSSFESLRTNGGAVEMIGDFPFMLSLSKHSWGFFSRI |
Ga0209109_100696291 | 3300025160 | Soil | LRTNGAACEIIGDFPFMLSLVEAFIGFFSRIDSNA |
Ga0209109_100770301 | 3300025160 | Soil | ESLRTNGSSVEITEDFSVHAEPVEAFLGFFSRIYYYVRL |
Ga0209109_101008051 | 3300025160 | Soil | ESLRTNGSSVEITEDFSVHAEPVEAFLGFFSRIRSQNGVNVGR |
Ga0209521_102869021 | 3300025164 | Soil | MDEIQAHSLILLKNLRSSFESLRTNGGASEIIGDFPFMLSLVEAFIGFFSRITYHA |
Ga0209108_100357051 | 3300025165 | Soil | SLRTNGGASEIIGDFPFMLSLVEAFIGFFSRIDYVDRR |
Ga0209108_101926452 | 3300025165 | Soil | LRTNGGAGEIIGDFPFTLSLVEAFIGFFSRIAIRA |
Ga0209002_103518082 | 3300025289 | Soil | SLRTNGGACEIIGDFPFVLSLVEAFIGFFSRIIMSGRTDWD |
Ga0209002_104587502 | 3300025289 | Soil | TLRSSFESLRTNGGAVEIIEDFSVHAEPVEAFLGFFSGICIQA |
Ga0209343_101450153 | 3300025311 | Groundwater | ENLRTNGGAGEINGDFPFMLSLVEAFIGFFSRIDCCV |
Ga0209343_103528252 | 3300025311 | Groundwater | RSSFESLRTNGGAGEIIGDFPFMLSLVEAFIGLFSRIPI |
Ga0209343_106306851 | 3300025311 | Groundwater | RSSFESLRTNGGASEIIGDFPFMLSLVEAFIGFFSRIKL |
Ga0209343_108390211 | 3300025311 | Groundwater | RSSFESLRTNGGSVEIIGDFPFMLSLVEAFIGFFSRIECYV |
Ga0209321_101133111 | 3300025312 | Soil | SFESLRTNGGACEIIGDFPFVLSLVEAFIGFFSRIMLGGKQ |
Ga0209641_111220072 | 3300025322 | Soil | KTLRSSFESLRTNGGACEIIGDFPFVLSLVEVFIGFFSRIT |
Ga0209640_100516001 | 3300025324 | Soil | ESLRTNGGAGEIIGDFPFMLSLVEAFIGFFSRINRC |
Ga0209640_103073041 | 3300025324 | Soil | ESLRTNGGASEIIGDFPFMLSLVEAFIGFFSRILI |
Ga0209640_104436001 | 3300025324 | Soil | KTLRSSFESLRTNGGACEIIGDFPFMLSLVEAFIGFFSRIALQ |
Ga0209640_104911771 | 3300025324 | Soil | TNGSSVEITEDFSVHAEPVEAFLGFFSRIYYYVRL |
Ga0209640_105214491 | 3300025324 | Soil | LRSSFESLRTNGGAVEIIGDFPFMLSLVEAFIGFFSRIFIAA |
Ga0209640_108442071 | 3300025324 | Soil | LRSSFESLRTNGGAVEIIGDFPFMLSLVEAFIGFFSRI |
Ga0209640_111250161 | 3300025324 | Soil | ESLRTNGGASEIIGDFPFMLSLVEAFIGFFSRIAMYEHF |
Ga0209341_102423051 | 3300025325 | Soil | TLRSSFESLRTNGGASEIIGDFPFMLSLVEAFIGFFSRIKL |
Ga0209342_107720102 | 3300025326 | Soil | LRSSFESLRTNGGASEIIGDFPFMLSLVEAFIGFFSRIAMYEHF |
Ga0208422_10234942 | 3300026053 | Natural And Restored Wetlands | SSFETLRTNGGAVEIVVEFAFMLGPVEAFLGFFSRIDICV |
Ga0209684_10022154 | 3300027527 | Tropical Forest Soil | LRTNGEAVEIMGDFSVHAERVEAFLGFFSIIKIDK |
Ga0209684_10066301 | 3300027527 | Tropical Forest Soil | LIPILLKNLRSSFESLRTNGEAVEIMGDFSVHAER |
Ga0209684_10067561 | 3300027527 | Tropical Forest Soil | MILLKNLRSSFESLRPNGEAVEIMGDFSVHAERVEAFLGFFSIIY |
Ga0209684_10168503 | 3300027527 | Tropical Forest Soil | MIKAILLKNLRSSFESLRTNGEAVEIMGDFSVHAE |
Ga0209799_10161911 | 3300027654 | Tropical Forest Soil | SQAFNSILLKNLRSSFESLRTNGEAVKIMGDFSVHAERVEAFLGFFSII |
Ga0209799_10189461 | 3300027654 | Tropical Forest Soil | SLRTNGEAVEIMGDFSVHAERVEAFLGFFSIIIYSSLTL |
Ga0209799_10294344 | 3300027654 | Tropical Forest Soil | LKIDKIVILLKNLRSSFESLRTNGEAVEIMGDFSVHAER |
Ga0209819_100154893 | 3300027722 | Freshwater Sediment | SFENLRTNGGAVEIIGDFSVHAEPVEAFLGFFSTIITSPH |
Ga0209726_100318901 | 3300027815 | Groundwater | SSFESLRTSGGEVEIIGDSPFMLSLVEAFMGFFSRIRY |
Ga0209683_101052011 | 3300027840 | Wetland Sediment | RSSFEGLRTNGRVFEFVGDFSVHAEPVEAFLGFFSRIVSGF |
Ga0299906_108973662 | 3300030606 | Soil | ENLRTNGGAVEIVGDFPFMLSLVEAFLGFFSRIKINT |
Ga0307469_100591841 | 3300031720 | Hardwood Forest Soil | SFESLKTNGGAVEIIGDFPFMLSQVEAFLGFFSGNRLLCQPP |
Ga0214473_100246211 | 3300031949 | Soil | VILLKNLRSSFENLRTNGGAVEIIGDFSVHAEPVEAFL |
Ga0214473_100401496 | 3300031949 | Soil | KTLRSSFESLRTNGGAGEIIGDFPFMLSIVEAFIGFFSRIIC |
Ga0214473_108247612 | 3300031949 | Soil | RSSFESLRTNGEALEIIGDFSVHAEPVEAFLGFFSRIKTQT |
Ga0326597_110169811 | 3300031965 | Soil | RSSFESLRTNGRAVEIIGDFSVHAEPVEAFLGFFSRIKL |
Ga0326597_112098812 | 3300031965 | Soil | VEIEKVEIKILLKNSRSSFENLRTNGGAVEITGDFSVHAEPVEAFLGFFSRIR |
Ga0214472_105852803 | 3300033407 | Soil | LRTNGGAVEIVGNFPFMLSLVEAFLGFFSRIECYA |
Ga0214471_110673081 | 3300033417 | Soil | RSSFESLRTNGVVVEIIGDFPFMLSLVEAFLGFFSRIVF |
Ga0316601_1024846201 | 3300033419 | Soil | FCSSFENLRTNEGTVEIVAEVPFMLSLVEAFLGFFRRIRSDT |
Ga0364930_0124010_770_883 | 3300033814 | Sediment | SFENLRTNGGAIEIIGDFPFMLSLVEAFIGFFSGIFS |
Ga0364945_0002012_3461_3598 | 3300034115 | Sediment | MTRFAEKTGRSSFENLRTNGRAVAIIGDFPFMLSLVEAFRGFSEE |
Ga0364925_0018047_791_958 | 3300034147 | Sediment | MILLNNLRSSFETLRTNGGPVEIMGDFPFMLSLVEAFLRFFSRINSAAGRVALGR |
Ga0364927_0249677_421_531 | 3300034148 | Sediment | NLRTNGGAVEIIGDFPFMLSPVEAFIGFFSIIESEN |
⦗Top⦘ |