| Basic Information | |
|---|---|
| Family ID | F036495 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 170 |
| Average Sequence Length | 45 residues |
| Representative Sequence | CYYHHRLVHEGGWQVIKAGREFRFLPPDRLVMRRARGPGMRWAA |
| Number of Associated Samples | 130 |
| Number of Associated Scaffolds | 170 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.59 % |
| % of genes near scaffold ends (potentially truncated) | 99.41 % |
| % of genes from short scaffolds (< 2000 bps) | 82.94 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.824 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (27.647 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.412 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.412 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.33% β-sheet: 22.22% Coil/Unstructured: 69.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 170 Family Scaffolds |
|---|---|---|
| PF01144 | CoA_trans | 13.53 |
| PF01047 | MarR | 5.88 |
| PF12833 | HTH_18 | 4.71 |
| PF00884 | Sulfatase | 1.76 |
| PF02597 | ThiS | 1.76 |
| PF11896 | GlgE_dom_N_S | 1.76 |
| PF10012 | DUF2255 | 1.76 |
| PF12681 | Glyoxalase_2 | 1.76 |
| PF00268 | Ribonuc_red_sm | 1.76 |
| PF00583 | Acetyltransf_1 | 1.76 |
| PF00072 | Response_reg | 1.76 |
| PF01039 | Carboxyl_trans | 1.18 |
| PF02653 | BPD_transp_2 | 1.18 |
| PF09285 | Elong-fact-P_C | 1.18 |
| PF07690 | MFS_1 | 1.18 |
| PF12697 | Abhydrolase_6 | 1.18 |
| PF00384 | Molybdopterin | 1.18 |
| PF01551 | Peptidase_M23 | 1.18 |
| PF00266 | Aminotran_5 | 1.18 |
| PF02566 | OsmC | 1.18 |
| PF09180 | ProRS-C_1 | 1.18 |
| PF02410 | RsfS | 1.18 |
| PF02866 | Ldh_1_C | 1.18 |
| PF12679 | ABC2_membrane_2 | 1.18 |
| PF13088 | BNR_2 | 1.18 |
| PF08241 | Methyltransf_11 | 0.59 |
| PF14535 | AMP-binding_C_2 | 0.59 |
| PF00753 | Lactamase_B | 0.59 |
| PF02518 | HATPase_c | 0.59 |
| PF00069 | Pkinase | 0.59 |
| PF13649 | Methyltransf_25 | 0.59 |
| PF13520 | AA_permease_2 | 0.59 |
| PF03575 | Peptidase_S51 | 0.59 |
| PF13738 | Pyr_redox_3 | 0.59 |
| PF03352 | Adenine_glyco | 0.59 |
| PF13463 | HTH_27 | 0.59 |
| PF00291 | PALP | 0.59 |
| PF01411 | tRNA-synt_2c | 0.59 |
| PF13188 | PAS_8 | 0.59 |
| PF00171 | Aldedh | 0.59 |
| PF13193 | AMP-binding_C | 0.59 |
| PF12867 | DinB_2 | 0.59 |
| PF03009 | GDPD | 0.59 |
| PF01841 | Transglut_core | 0.59 |
| PF01810 | LysE | 0.59 |
| PF13411 | MerR_1 | 0.59 |
| PF00056 | Ldh_1_N | 0.59 |
| PF13732 | DUF4162 | 0.59 |
| PF00486 | Trans_reg_C | 0.59 |
| PF01882 | DUF58 | 0.59 |
| PF00860 | Xan_ur_permease | 0.59 |
| PF13458 | Peripla_BP_6 | 0.59 |
| PF00496 | SBP_bac_5 | 0.59 |
| PF01343 | Peptidase_S49 | 0.59 |
| PF13828 | DUF4190 | 0.59 |
| PF08281 | Sigma70_r4_2 | 0.59 |
| PF01475 | FUR | 0.59 |
| PF04138 | GtrA | 0.59 |
| PF02922 | CBM_48 | 0.59 |
| PF00535 | Glycos_transf_2 | 0.59 |
| PF02811 | PHP | 0.59 |
| PF16363 | GDP_Man_Dehyd | 0.59 |
| PF08922 | DUF1905 | 0.59 |
| PF07992 | Pyr_redox_2 | 0.59 |
| PF08669 | GCV_T_C | 0.59 |
| PF11373 | DUF3175 | 0.59 |
| PF00005 | ABC_tran | 0.59 |
| PF13419 | HAD_2 | 0.59 |
| PF07969 | Amidohydro_3 | 0.59 |
| PF01467 | CTP_transf_like | 0.59 |
| PF03477 | ATP-cone | 0.59 |
| COG ID | Name | Functional Category | % Frequency in 170 Family Scaffolds |
|---|---|---|---|
| COG1788 | Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit | Lipid transport and metabolism [I] | 13.53 |
| COG4670 | Acyl CoA:acetate/3-ketoacid CoA transferase | Lipid transport and metabolism [I] | 13.53 |
| COG2057 | Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit | Lipid transport and metabolism [I] | 13.53 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.35 |
| COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 1.76 |
| COG0039 | Malate/lactate dehydrogenase | Energy production and conversion [C] | 1.76 |
| COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 1.76 |
| COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 1.76 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 1.18 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 1.18 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 1.18 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 1.18 |
| COG0799 | Ribosomal silencing factor RsfS, regulates association of 30S and 50S subunits | Translation, ribosomal structure and biogenesis [J] | 1.18 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.18 |
| COG0442 | Prolyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.18 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 1.18 |
| COG2818 | 3-methyladenine DNA glycosylase Tag | Replication, recombination and repair [L] | 0.59 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.59 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.59 |
| COG1721 | Uncharacterized conserved protein, DUF58 family, contains vWF domain | Function unknown [S] | 0.59 |
| COG1486 | Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase | Carbohydrate transport and metabolism [G] | 0.59 |
| COG0013 | Alanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.59 |
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 0.59 |
| COG0584 | Glycerophosphoryl diester phosphodiesterase | Lipid transport and metabolism [I] | 0.59 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.59 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.82 % |
| Unclassified | root | N/A | 1.18 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001086|JGI12709J13192_1000071 | All Organisms → cellular organisms → Bacteria | 16737 | Open in IMG/M |
| 3300001089|JGI12683J13190_1002539 | All Organisms → cellular organisms → Bacteria | 2453 | Open in IMG/M |
| 3300001089|JGI12683J13190_1009920 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300001359|A3035W6_1229894 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300001593|JGI12635J15846_10020111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5493 | Open in IMG/M |
| 3300001593|JGI12635J15846_10300797 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300001593|JGI12635J15846_10847965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 523 | Open in IMG/M |
| 3300001661|JGI12053J15887_10259995 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300002025|smpD1_1041228 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300002025|smpD1_1099870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1656 | Open in IMG/M |
| 3300002560|JGI25383J37093_10112292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 779 | Open in IMG/M |
| 3300002561|JGI25384J37096_10039807 | All Organisms → cellular organisms → Bacteria | 1822 | Open in IMG/M |
| 3300002914|JGI25617J43924_10045463 | All Organisms → cellular organisms → Bacteria | 1591 | Open in IMG/M |
| 3300002914|JGI25617J43924_10053297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 1474 | Open in IMG/M |
| 3300002914|JGI25617J43924_10112088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 967 | Open in IMG/M |
| 3300002914|JGI25617J43924_10113375 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300005166|Ga0066674_10071473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1589 | Open in IMG/M |
| 3300005167|Ga0066672_10038117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2684 | Open in IMG/M |
| 3300005172|Ga0066683_10125756 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
| 3300005174|Ga0066680_10054517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2355 | Open in IMG/M |
| 3300005176|Ga0066679_10687724 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300005178|Ga0066688_10270261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1091 | Open in IMG/M |
| 3300005181|Ga0066678_10662581 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300005186|Ga0066676_10914411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 588 | Open in IMG/M |
| 3300005187|Ga0066675_10975348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 638 | Open in IMG/M |
| 3300005406|Ga0070703_10084209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1090 | Open in IMG/M |
| 3300005437|Ga0070710_10321305 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1016 | Open in IMG/M |
| 3300005440|Ga0070705_100774361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 761 | Open in IMG/M |
| 3300005440|Ga0070705_101176286 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300005447|Ga0066689_10048787 | All Organisms → cellular organisms → Bacteria | 2261 | Open in IMG/M |
| 3300005447|Ga0066689_10578629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 709 | Open in IMG/M |
| 3300005447|Ga0066689_10654532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 660 | Open in IMG/M |
| 3300005450|Ga0066682_10924056 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005454|Ga0066687_10148138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1239 | Open in IMG/M |
| 3300005468|Ga0070707_101329362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 685 | Open in IMG/M |
| 3300005468|Ga0070707_101703409 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300005518|Ga0070699_101215082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 691 | Open in IMG/M |
| 3300005536|Ga0070697_101639902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 575 | Open in IMG/M |
| 3300005549|Ga0070704_100245787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1467 | Open in IMG/M |
| 3300005552|Ga0066701_10111403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1610 | Open in IMG/M |
| 3300005552|Ga0066701_10120908 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
| 3300005552|Ga0066701_10334490 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300005552|Ga0066701_10499727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 753 | Open in IMG/M |
| 3300005553|Ga0066695_10487375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 758 | Open in IMG/M |
| 3300005555|Ga0066692_10946759 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300005557|Ga0066704_10876972 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005559|Ga0066700_10511302 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300005560|Ga0066670_10771243 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300005568|Ga0066703_10154971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1377 | Open in IMG/M |
| 3300005575|Ga0066702_10547695 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300005576|Ga0066708_10221020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1195 | Open in IMG/M |
| 3300005586|Ga0066691_10712342 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300005586|Ga0066691_10801903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 555 | Open in IMG/M |
| 3300005938|Ga0066795_10005100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3392 | Open in IMG/M |
| 3300006028|Ga0070717_10463051 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300006032|Ga0066696_10032873 | All Organisms → cellular organisms → Bacteria | 2792 | Open in IMG/M |
| 3300006032|Ga0066696_10052812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2289 | Open in IMG/M |
| 3300006034|Ga0066656_10090628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1840 | Open in IMG/M |
| 3300006041|Ga0075023_100144549 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300006175|Ga0070712_101536274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 582 | Open in IMG/M |
| 3300006638|Ga0075522_10524668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 546 | Open in IMG/M |
| 3300006797|Ga0066659_10565514 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300006797|Ga0066659_11049356 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300006800|Ga0066660_10060591 | All Organisms → cellular organisms → Bacteria | 2521 | Open in IMG/M |
| 3300007255|Ga0099791_10568899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 553 | Open in IMG/M |
| 3300007258|Ga0099793_10223348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 906 | Open in IMG/M |
| 3300007265|Ga0099794_10004890 | All Organisms → cellular organisms → Bacteria | 5324 | Open in IMG/M |
| 3300009038|Ga0099829_10709311 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300009038|Ga0099829_11088125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 663 | Open in IMG/M |
| 3300009038|Ga0099829_11105727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 657 | Open in IMG/M |
| 3300009088|Ga0099830_10050504 | All Organisms → cellular organisms → Bacteria | 2933 | Open in IMG/M |
| 3300009089|Ga0099828_10852179 | Not Available | 815 | Open in IMG/M |
| 3300009089|Ga0099828_11377979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 623 | Open in IMG/M |
| 3300009090|Ga0099827_10651543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 909 | Open in IMG/M |
| 3300009090|Ga0099827_11417215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 605 | Open in IMG/M |
| 3300009143|Ga0099792_10536287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 738 | Open in IMG/M |
| 3300009143|Ga0099792_11108135 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300009661|Ga0105858_1072791 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300009662|Ga0105856_1296544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 539 | Open in IMG/M |
| 3300010159|Ga0099796_10445716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 575 | Open in IMG/M |
| 3300010321|Ga0134067_10050072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1344 | Open in IMG/M |
| 3300010323|Ga0134086_10050757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1406 | Open in IMG/M |
| 3300011269|Ga0137392_10566756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 943 | Open in IMG/M |
| 3300011271|Ga0137393_10931709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 741 | Open in IMG/M |
| 3300012014|Ga0120159_1044707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1433 | Open in IMG/M |
| 3300012014|Ga0120159_1130815 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300012096|Ga0137389_10381254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1202 | Open in IMG/M |
| 3300012096|Ga0137389_10472171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1075 | Open in IMG/M |
| 3300012096|Ga0137389_10640190 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300012096|Ga0137389_10959314 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300012096|Ga0137389_11073834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 690 | Open in IMG/M |
| 3300012189|Ga0137388_10351478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1359 | Open in IMG/M |
| 3300012189|Ga0137388_10426419 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300012203|Ga0137399_11134614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 658 | Open in IMG/M |
| 3300012205|Ga0137362_10206746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1690 | Open in IMG/M |
| 3300012206|Ga0137380_10102232 | All Organisms → cellular organisms → Bacteria | 2619 | Open in IMG/M |
| 3300012209|Ga0137379_10031092 | All Organisms → cellular organisms → Bacteria | 5139 | Open in IMG/M |
| 3300012209|Ga0137379_11243588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 651 | Open in IMG/M |
| 3300012211|Ga0137377_10002250 | All Organisms → cellular organisms → Bacteria | 14254 | Open in IMG/M |
| 3300012211|Ga0137377_10693328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 953 | Open in IMG/M |
| 3300012357|Ga0137384_10318973 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
| 3300012361|Ga0137360_10413859 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300012361|Ga0137360_10445294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1097 | Open in IMG/M |
| 3300012363|Ga0137390_10048653 | All Organisms → cellular organisms → Bacteria | 4106 | Open in IMG/M |
| 3300012409|Ga0134045_1035502 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300012685|Ga0137397_10872443 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300012918|Ga0137396_10901219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 648 | Open in IMG/M |
| 3300012922|Ga0137394_10336601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1288 | Open in IMG/M |
| 3300012922|Ga0137394_10903084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 737 | Open in IMG/M |
| 3300012922|Ga0137394_11077602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 666 | Open in IMG/M |
| 3300013294|Ga0120150_1042883 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300013770|Ga0120123_1044141 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300014827|Ga0120171_1141279 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300014829|Ga0120104_1003553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2790 | Open in IMG/M |
| 3300015245|Ga0137409_10005612 | All Organisms → cellular organisms → Bacteria | 13060 | Open in IMG/M |
| 3300015245|Ga0137409_10169874 | All Organisms → cellular organisms → Bacteria | 1982 | Open in IMG/M |
| 3300015359|Ga0134085_10582757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 518 | Open in IMG/M |
| 3300018071|Ga0184618_10273651 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300018071|Ga0184618_10417299 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300018431|Ga0066655_11007978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 576 | Open in IMG/M |
| 3300018433|Ga0066667_12211358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 512 | Open in IMG/M |
| 3300018482|Ga0066669_10249507 | All Organisms → cellular organisms → Bacteria | 1402 | Open in IMG/M |
| 3300020010|Ga0193749_1024375 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300020579|Ga0210407_10819609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 717 | Open in IMG/M |
| 3300021418|Ga0193695_1088954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 666 | Open in IMG/M |
| 3300024290|Ga0247667_1038874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 898 | Open in IMG/M |
| 3300024290|Ga0247667_1108924 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300024323|Ga0247666_1024131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1292 | Open in IMG/M |
| 3300025505|Ga0207929_1096434 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300025906|Ga0207699_10362521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1025 | Open in IMG/M |
| 3300025910|Ga0207684_11659527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 516 | Open in IMG/M |
| 3300025922|Ga0207646_10575543 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300025929|Ga0207664_10298287 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
| 3300025939|Ga0207665_11030646 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300026277|Ga0209350_1077406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 906 | Open in IMG/M |
| 3300026277|Ga0209350_1078987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 891 | Open in IMG/M |
| 3300026298|Ga0209236_1003948 | All Organisms → cellular organisms → Bacteria | 9058 | Open in IMG/M |
| 3300026309|Ga0209055_1267235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 532 | Open in IMG/M |
| 3300026310|Ga0209239_1086476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1347 | Open in IMG/M |
| 3300026313|Ga0209761_1291144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 575 | Open in IMG/M |
| 3300026331|Ga0209267_1202108 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300026332|Ga0209803_1000829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 20798 | Open in IMG/M |
| 3300026333|Ga0209158_1009108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5003 | Open in IMG/M |
| 3300026334|Ga0209377_1068492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1534 | Open in IMG/M |
| 3300026335|Ga0209804_1162299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 988 | Open in IMG/M |
| 3300026343|Ga0209159_1037037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2530 | Open in IMG/M |
| 3300026528|Ga0209378_1045665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2168 | Open in IMG/M |
| 3300026536|Ga0209058_1033882 | All Organisms → cellular organisms → Bacteria | 3110 | Open in IMG/M |
| 3300026538|Ga0209056_10203380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1447 | Open in IMG/M |
| 3300026540|Ga0209376_1218202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 849 | Open in IMG/M |
| 3300026550|Ga0209474_10027931 | All Organisms → cellular organisms → Bacteria | 4269 | Open in IMG/M |
| 3300026551|Ga0209648_10173257 | Not Available | 1678 | Open in IMG/M |
| 3300026551|Ga0209648_10510196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 691 | Open in IMG/M |
| 3300027565|Ga0209219_1159954 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 539 | Open in IMG/M |
| 3300027587|Ga0209220_1001040 | All Organisms → cellular organisms → Bacteria | 8062 | Open in IMG/M |
| 3300027587|Ga0209220_1168400 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300027643|Ga0209076_1080666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 925 | Open in IMG/M |
| 3300027645|Ga0209117_1026965 | All Organisms → cellular organisms → Bacteria | 1817 | Open in IMG/M |
| 3300027655|Ga0209388_1024941 | All Organisms → cellular organisms → Bacteria | 1692 | Open in IMG/M |
| 3300027678|Ga0209011_1000023 | All Organisms → cellular organisms → Bacteria | 121780 | Open in IMG/M |
| 3300027678|Ga0209011_1204356 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300027748|Ga0209689_1275318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 666 | Open in IMG/M |
| 3300027857|Ga0209166_10185412 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300027882|Ga0209590_10906845 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300028536|Ga0137415_10169970 | All Organisms → cellular organisms → Bacteria | 2010 | Open in IMG/M |
| 3300028711|Ga0307293_10115589 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300028784|Ga0307282_10016904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3014 | Open in IMG/M |
| 3300030991|Ga0073994_11923815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 788 | Open in IMG/M |
| 3300031740|Ga0307468_101757283 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300032180|Ga0307471_100608470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1252 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 27.65% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.47% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 9.41% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.82% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.65% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 4.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.35% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.35% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.18% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.18% |
| Permafrost And Active Layer Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost And Active Layer Soil | 1.18% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.18% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.18% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.59% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.59% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.59% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001086 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 | Environmental | Open in IMG/M |
| 3300001089 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 | Environmental | Open in IMG/M |
| 3300001359 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-35cm)- 6 month illumina | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002025 | Permafrost and active layer soil microbial communities from McGill Arctic Research Station (MARS), Canada, for enrichment studies - Sample_D1 | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009661 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 | Environmental | Open in IMG/M |
| 3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012409 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300013294 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0M | Environmental | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014827 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_18M | Environmental | Open in IMG/M |
| 3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300025505 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12709J13192_10000711 | 3300001086 | Forest Soil | RLVHEGGWQVVKAGEGFQFIPPDRVIARRARGPGMRWAA* |
| JGI12683J13190_10025391 | 3300001089 | Forest Soil | NIANEILLCHFHHRLVHEGGWQVIKAGKEFRFLPPEQFVLRKARGPGVRWAA* |
| JGI12683J13190_10099202 | 3300001089 | Forest Soil | NNVPNEVLLCHYHHRLVHEGGWQVIKAGREFRFLPPEQFVIRRARAPGMRWAA* |
| A3035W6_12298943 | 3300001359 | Permafrost | CYYHHRLVHEGGWQVIKSGREFRFLPPDRVVMRRARGPGLRWAA* |
| JGI12635J15846_100201119 | 3300001593 | Forest Soil | YHHRLVHEGGWQVVKAGEGFQFIPPDRVIARRARGPGMRWAA* |
| JGI12635J15846_103007971 | 3300001593 | Forest Soil | NVPNEVLLCHYHHRLVHEGGWQVIKAGREFRFLPPEQFVIRRARAPGMRWAA* |
| JGI12635J15846_108479652 | 3300001593 | Forest Soil | CHFHHRLVHEGGWQVIKAGNEFRFLPPEQFVIRRARGPGMRWAA* |
| JGI12053J15887_102599952 | 3300001661 | Forest Soil | HHRLVHEGGWQVIKSGPEFRFLPPDRVFMRRARGPGVRWAA* |
| smpD1_10412282 | 3300002025 | Permafrost And Active Layer Soil | VCHYHHRLLHEGGWQVVKAGREFRFIPPEQVVIRRARGPGRRWAA* |
| smpD1_10998703 | 3300002025 | Permafrost And Active Layer Soil | VCHYHHRLLHEGGWQVIKAGREFRFLPPEQVVVRRARAPGMRWAA* |
| JGI25383J37093_101122921 | 3300002560 | Grasslands Soil | CYYHHRLVHEGGWQVIKAGREFRFLPPDRLVMRRARGPGMRWAA* |
| JGI25384J37096_100398071 | 3300002561 | Grasslands Soil | NELLLCYYHHRLVHEGGWQVIKAGREFRFLPPERLVMTRARGPGIRWAA* |
| JGI25617J43924_100454634 | 3300002914 | Grasslands Soil | LLCYYHHRQVHEGGWQVIKVGREFQFLPPERVVMRRARGPGYRWAA* |
| JGI25617J43924_100532973 | 3300002914 | Grasslands Soil | PNLLPLCYYHHRLVHXGGWQVVKAGEGVKFIRPDRVIARRIRAPGMRWAA* |
| JGI25617J43924_101120882 | 3300002914 | Grasslands Soil | HRQVHEGGWQVVKVGREFQFLPPERVVMRRARGPGYRWAA* |
| JGI25617J43924_101133751 | 3300002914 | Grasslands Soil | LVLLCYYHHRQVHEGGWQVIKVGREFQFLPPERVVMRRARGPGYRWAA* |
| Ga0066674_100714733 | 3300005166 | Soil | LPLCYFHHRQVHEGGWQVVRAGEGVKFIPPDRVIPKRVRGPGMRWAA* |
| Ga0066672_100381178 | 3300005167 | Soil | PLCYYHHRLVHEGGWQVVKAGEGVKFIPPDRVIARRNRGPGMRWAA* |
| Ga0066683_101257562 | 3300005172 | Soil | HHHRLVHEGGWQVIRAGDGVQFIPPERVIPRRVRGPGMRWAA* |
| Ga0066680_100545171 | 3300005174 | Soil | GLVQLIGRSQPGPELVPLCHHHHRLVHEGGWQVIRAGEGVKFIPPESVVLRRVRGPGVSWAA* |
| Ga0066679_106877241 | 3300005176 | Soil | RCVHEGEWQVVKAGGGFKFIPPERLIARRARFPGRRWAA* |
| Ga0066688_102702611 | 3300005178 | Soil | YYHHRLVHEGGWHVVQTDEGIKFIPPDHEVWRRARAPGMRWAA* |
| Ga0066678_106625811 | 3300005181 | Soil | LCYHHHRLVHEGGWQVIRAGDGVKFIPPERVIPRRVRGPGMRWAA* |
| Ga0066676_109144112 | 3300005186 | Soil | CYFHHRLVHEGGWQVVKVGKGVKFIPPERVIPARVRGPGVRWAA* |
| Ga0066675_109753481 | 3300005187 | Soil | NLLPLCYHHHRLVHEGGWQVIRAGEGVKFIPPERVVPHRVRGPGMRWAA* |
| Ga0070703_100842091 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | LPLCYYHHRLVHEGGWQVVKAGDEVRFIPPDRVGARRVRAPGVRWAA* |
| Ga0070710_103213051 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | HRLVHEGGWQVVKSGREFQFVPPERMAMRRARGPGVRWAA* |
| Ga0070705_1007743613 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | YFHHRLVHEGGWQVIKDGREFRFLPPDRVVFRRARGPGLRWAA* |
| Ga0070705_1011762861 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | NLVLLCYFHHRLVHEGAWQVIREGREFRFLPPDRVVFRRSRGPGLRWAA* |
| Ga0066689_100487874 | 3300005447 | Soil | CYFHHRLVHEGGMQVVRAGEGVKFIPPERVVPRRVRGPGMRWAA* |
| Ga0066689_105786292 | 3300005447 | Soil | ELLLCYYHHRLLHEGGWQLIKKGRELRFLPPERMPVRRARGPGVRWAA* |
| Ga0066689_106545321 | 3300005447 | Soil | LCYFHHRLVHEGGWQVVRVANGVKFIPPDRIVPRRVRGPGMRWAA* |
| Ga0066682_109240562 | 3300005450 | Soil | NLPNLVLLCFFHHRLVHEGGWQVVKSGREFHFHPPERVIMRRARGPGVRWAA* |
| Ga0066687_101481383 | 3300005454 | Soil | YFHHRLVHEGGWQVVRAGEGVKFIPPDRVIPKRVRGPGMRWAA* |
| Ga0070707_1013293622 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LCHYHHRLVHEGGWQVIKSGREFRFLPPERVVMRRVRGPGMRWAA* |
| Ga0070707_1017034091 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LCYYHHRLVHEGGWQVIKAGEGVKFIPPERVVMRRIRAPGMRWAA* |
| Ga0070699_1012150822 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | HRLVHEGGWQVIRAGREIRFQPPERQVFRRARGPGVRWAA* |
| Ga0070697_1016399022 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | HRLVHEGGWQVIRAGEGVKFIPPERMIPRRVRGPGMRWAA* |
| Ga0070704_1002457871 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | LCYYHHRLVHEGGWQVVKAGDEVRFIPPDRVSARRVRGPGVRWAA* |
| Ga0066701_101114031 | 3300005552 | Soil | RLVHEGGWQVIRAGDGVKFIPPERVIPRRVRGPGMRWAA* |
| Ga0066701_101209081 | 3300005552 | Soil | IGRSQPGPELVPLCHHHHRLVHEGGWQVIRAGEGVKFIPPERVVLRRVRGPGVSWAA* |
| Ga0066701_103344902 | 3300005552 | Soil | RRRPGDSSHLGANEVLLCYYHHRLVHEGGWQVIKKGREFRFLPPERVVMRRARGPGMRWAA* |
| Ga0066701_104997271 | 3300005552 | Soil | LCYFHHRQVHEGGWQVVRAGKGVKFIPPDRVIPKRVRGPGMRWAA* |
| Ga0066695_104873753 | 3300005553 | Soil | CYFHHRQVHEGGWQVVRAGEGVKFIPPDRVIPKRVRGPGMRWAA* |
| Ga0066692_109467591 | 3300005555 | Soil | LVHEGGWQVIKAGREFRFLPPDRLVMRRARGPGMRWAA* |
| Ga0066704_108769722 | 3300005557 | Soil | YYHHRLVHEGGWQVLRVGEEVRFIPPDRVMARRVRDPGMRWAA* |
| Ga0066700_105113022 | 3300005559 | Soil | LCYYHHRLVHEGGWHIIKAARQFRFLPPERMPVRRARGPGVRWAA* |
| Ga0066670_107712432 | 3300005560 | Soil | LIGRSQPGPELVPLCHHHHRLVHEGGWQVIRAGEGVKFIPPERVVLRRVRGPGVSWAA* |
| Ga0066703_101549711 | 3300005568 | Soil | GGWQVLRVGEEVRFIPPDRVIARRVRAPGMRWAA* |
| Ga0066702_105476951 | 3300005575 | Soil | NLLPLCYHHHRLVHEGEWQVVQAGEGVKFIPPDHVVPRRVRGPGVRWAA* |
| Ga0066708_102210201 | 3300005576 | Soil | LCYFHHRLVHEGGWQVVKVGKGVKFIPPERVIPARVRGPGVRWAA* |
| Ga0066691_107123421 | 3300005586 | Soil | EGEWQVVQAGEGVKFIPPDHVVPRRVRGPGVRWAA* |
| Ga0066691_108019032 | 3300005586 | Soil | ANELLLCYYHHRLVHEGGWQVIKKGRELRFLPPERMPVRRARGPGVRWAA* |
| Ga0066795_100051001 | 3300005938 | Soil | NLPNMVLLCYFHHRLVHEGGWQVIKSGREFRFLPPERIVMRRTRGPGMRWAA* |
| Ga0070717_104630512 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | CHFHHRQVHEGGWRVIKAGREFRFLPPDRQVFRLARGPGVSLAA* |
| Ga0066696_100328731 | 3300006032 | Soil | YFHHRQVHEGGWQVVRAGEGVKFIPPDRVIPKRVRGPGMRWAA* |
| Ga0066696_100528121 | 3300006032 | Soil | LPKLLPLCYYHHRLVHESGWQVVQTEEGIKFIPPDHEVWRRARAPGMRWAA* |
| Ga0066656_100906284 | 3300006034 | Soil | HEGGWQVVRAGEGVKFIPPDRVIQKRVRGPGMRWAA* |
| Ga0075023_1001445491 | 3300006041 | Watersheds | LLLCYFHHRLVHEGGWQVIKVGREFKFLPPERFVMRRARGPGMRWAA* |
| Ga0070712_1015362741 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LVHEGGWQVIKSGREFRFLPPDRVFTRRARGPGMRWAA* |
| Ga0075522_105246681 | 3300006638 | Arctic Peat Soil | HEGGWQVIKSGREFNFLPPERIVMRRTRGPGMRWAA* |
| Ga0066659_105655141 | 3300006797 | Soil | LPLCYFHHRLVHEGGWQVVRAGEGVKFIPPDRVIPKRVRGPGMRWAA* |
| Ga0066659_110493563 | 3300006797 | Soil | YHHHRLVHEGGWQVIRAGEGVKFIAPDRVIPRRARGPWMRWAA* |
| Ga0066660_100605911 | 3300006800 | Soil | FHHRLVHEGGWQVVRAGEGVKFIPPDRVFPKRVRGPGMRWAA* |
| Ga0099791_105688992 | 3300007255 | Vadose Zone Soil | NLPNLLPLCYYHHRLVHEGGWQVVKAGAGVKFIRPNRLIARRIRAPGMRWAA* |
| Ga0099793_102233481 | 3300007258 | Vadose Zone Soil | HHRLVHEGGWQVVKAGAGVKFIRPDRVIARRIRAPGMRWAA* |
| Ga0099794_100048906 | 3300007265 | Vadose Zone Soil | HEGGWQVVKAGAGVKFIRPNRLIARRIRAPGMRWAA* |
| Ga0099829_107093112 | 3300009038 | Vadose Zone Soil | NLLPLCYYHHRLVHEGGWQVVRAGEGVKFIRPDRVIARRIRAPGLRWAA* |
| Ga0099829_110881251 | 3300009038 | Vadose Zone Soil | RLVHEGGWQVVKAGEGVKFIRPDRVIARRIRAPGMRWAA* |
| Ga0099829_111057271 | 3300009038 | Vadose Zone Soil | NLPNMVLLCYFHHRLVHEGGWQVIKSGREFRFLPPERLMMRRARGPGYRWAA* |
| Ga0099830_100505043 | 3300009088 | Vadose Zone Soil | CFFHHRLVHEGGWQVVKAGAELRFIPPDRHVMQRARGPGVGLAA* |
| Ga0099828_108521791 | 3300009089 | Vadose Zone Soil | HRLVHEGGWQVVKAGEGVKFIRPDRVIARRIRAPGMRWAA* |
| Ga0099828_113779791 | 3300009089 | Vadose Zone Soil | NLPNLLPLCYYHHRLVHEGGWQVIKAGREFRFLPPDRVVMRRARWPGMRWAA* |
| Ga0099827_106515432 | 3300009090 | Vadose Zone Soil | YHHRLVHEGGWQVIKAGEAVRFIRPDRVIARRIRAPGMRWAA* |
| Ga0099827_114172152 | 3300009090 | Vadose Zone Soil | RLVHEGGWQVIKTGREFRFLPPERIVMRRVRGPGMRWAA* |
| Ga0099792_105362871 | 3300009143 | Vadose Zone Soil | RLVHEGGWQVIKVGGGFRFLPPERVVMRRARGPGVRWAA* |
| Ga0099792_111081351 | 3300009143 | Vadose Zone Soil | HYHHRLVHEGGWQIIKSGREFRFLPPDRVVMRRVRGPGMRWAA* |
| Ga0105858_10727911 | 3300009661 | Permafrost Soil | RLVHEGGWQVVQVGREFRFVPPDRVVFRRARAPGLRWAA* |
| Ga0105856_12965443 | 3300009662 | Permafrost Soil | EGGWQVIKAGREFRFLPPDRVVMRRARGPGLRWAA* |
| Ga0099796_104457161 | 3300010159 | Vadose Zone Soil | GGWQVIKLGREFRFLPPDRVVMRRVRGPGMRWAA* |
| Ga0134067_100500723 | 3300010321 | Grasslands Soil | EGGWQVVRAGEGVKFIPPDREIQKRVRGPGMRWAA* |
| Ga0134086_100507571 | 3300010323 | Grasslands Soil | LCYFHHRQVHEGGWQVVRAGEGVKFIPPDRVIPKRVRGPGMRWAA* |
| Ga0137392_105667562 | 3300011269 | Vadose Zone Soil | YFHHRLVHEGGWQVIKSGREFRFLPPERMVMRRARGPGYRWAA* |
| Ga0137393_109317091 | 3300011271 | Vadose Zone Soil | VHEGGWQVVKAGEAVKFIRPDRVIARRIRAPGMRWAA* |
| Ga0120159_10447073 | 3300012014 | Permafrost | PNLVLLCYFHHRLVHEGGWQVVQVGREFRFVPPDRLVFCRARAPGLRWAA* |
| Ga0120159_11308152 | 3300012014 | Permafrost | LVHDGGWQVVKAGREFKFLPPDRFVIRRAREPGYRWAA* |
| Ga0137389_103812542 | 3300012096 | Vadose Zone Soil | VHEGGWQLIKSGREFKFLPPERMVMRRARGPGMRWAA* |
| Ga0137389_104721713 | 3300012096 | Vadose Zone Soil | VHEGGWQIVKAGEGVKFIPPDRVIARRARGPGVGWAA* |
| Ga0137389_106401902 | 3300012096 | Vadose Zone Soil | HHRLVHEGGWQVVKAGEGVKFIRPDRVIARRIRAPGMRWAA* |
| Ga0137389_109593141 | 3300012096 | Vadose Zone Soil | VLLCHYHHRLVHEGGRQVIKLGRGFRFLPPERVVMRRARGPGMRWAA* |
| Ga0137389_110738341 | 3300012096 | Vadose Zone Soil | HEGGWQVVKAGEGVKFIRPDRVIARRIRAPGMRWAA* |
| Ga0137388_103514781 | 3300012189 | Vadose Zone Soil | NLVLLCFFHHRLVHEGGWQVMKVGREFRFLPPERVVMRKARGPGMRWAA* |
| Ga0137388_104264193 | 3300012189 | Vadose Zone Soil | NIANEVLLCHYHHRLVHEGGWQVIKVGRGLRFLPPERVVMRRARGPGMRWAA* |
| Ga0137399_111346142 | 3300012203 | Vadose Zone Soil | EVLLCYYHHRLVHEGGWQVIKVGRELRFLPPERMPVRRARGPGMRWAA* |
| Ga0137362_102067461 | 3300012205 | Vadose Zone Soil | YHHRLVHEGGWQVIKVGRGFRFLPPERVVMRRARGPGVRWAA* |
| Ga0137380_101022324 | 3300012206 | Vadose Zone Soil | LPNLLPLCYFHHRLVHEGGWQVVRAGEGVKFIPPDRVIPKRVRGPGMRWAA* |
| Ga0137379_100310921 | 3300012209 | Vadose Zone Soil | HRLVHEGGWQVVKVGREFRFLPPERVVMRKARGPGMRWAA* |
| Ga0137379_112435881 | 3300012209 | Vadose Zone Soil | NLLPLCYFHHRLVHEGGWQVVRAGEGVKFIPPDRVIPKRVRGPGMRWAA* |
| Ga0137377_100022501 | 3300012211 | Vadose Zone Soil | HEGGWQVIRAGEGVKFIAPERVIPRRARGPGMRWAA* |
| Ga0137377_106933281 | 3300012211 | Vadose Zone Soil | YHHRLVHEGGWQVLRVGEEVRFIPPDRVMARRVRAPGMRWAA* |
| Ga0137384_103189731 | 3300012357 | Vadose Zone Soil | LCYYHHRLVHEGGWQVIKAGREFRFLPPERMIRRARGPGVRWAA* |
| Ga0137360_104138591 | 3300012361 | Vadose Zone Soil | NEVLLCFYHHRLVHEGGWQVIKVGRGFRFLPPERVVMRRARGPAMRWAA* |
| Ga0137360_104452941 | 3300012361 | Vadose Zone Soil | LLPLCYYHHRLVHEGGWQVVKAGEGVKFIRPDRIIARRIRAPGMRWAA* |
| Ga0137390_100486531 | 3300012363 | Vadose Zone Soil | LLPLCFYHHRLVHEGGWQVVKAGEGVKFIPPDRVIARRAREPGMRWAA* |
| Ga0134045_10355023 | 3300012409 | Grasslands Soil | YFDHRQVHEGGWQVVRAGEGVKFIPPDRVIPKRVRGPGMRWAA* |
| Ga0137397_108724431 | 3300012685 | Vadose Zone Soil | YHHRLVHEGGWQVIKSGREFRFLPPERVVMRRVRAPGMRWAA* |
| Ga0137396_109012191 | 3300012918 | Vadose Zone Soil | TNLSDLLPLCYFHHRLVHEGGWQVVKVGKGVKFIPRERVIPARVRGPDVRWAA* |
| Ga0137394_103366011 | 3300012922 | Vadose Zone Soil | LMLLCHYHHRLVHEGGWQVIKSGREFRFLPPERVVMRRVRAPGMRWAA* |
| Ga0137394_109030841 | 3300012922 | Vadose Zone Soil | LMLLCHYHHRLVHEGGWQVIKSGREFRFLPPERVVMRRVRGPGMRWAA* |
| Ga0137394_110776021 | 3300012922 | Vadose Zone Soil | GGWQVVRAGKGVRFIPPERVVPRRVRGPGMRWAA* |
| Ga0120150_10428832 | 3300013294 | Permafrost | VHEGGWQVVQVGREFRFVPPDRVVFRRARAPGLRWAA* |
| Ga0120123_10441411 | 3300013770 | Permafrost | YFHHRLVHEGGWQVVRVGRDFRFVPPDRVVFRRARAPGMRWAA* |
| Ga0120171_11412792 | 3300014827 | Permafrost | LCFFRHRLVHEGGWQVVQVGREFRFVPPDRVVFRRARAPGLRWAA* |
| Ga0120104_10035531 | 3300014829 | Permafrost | LCYFHHRLVHEGEWQVVQVGREFRFVPPDRVVFRRARTRGLRWAA* |
| Ga0137409_1000561212 | 3300015245 | Vadose Zone Soil | MLLCHYHHRLVHEGGWQVIKSGREFRFLPPERIVMKRVRGPGMRWAA* |
| Ga0137409_101698741 | 3300015245 | Vadose Zone Soil | MLLCHYHHRLVHEGGWQVIKSGREFRFLPPERVVMRRVRAPGMRWAA* |
| Ga0134085_105827572 | 3300015359 | Grasslands Soil | FEKDNEEDYESNLLPLCYFHHRQVHEGGWQVVRAGEGVKFIPPDRVIPKRVRGPGMRWAA |
| Ga0184618_102736513 | 3300018071 | Groundwater Sediment | CHYHHRLVHEGGWQVIKSGREFRFLPPERILMRRVRGPGMRWAA |
| Ga0184618_104172992 | 3300018071 | Groundwater Sediment | LLCYFHHRLVHEGGWQVVKTGREFRFVPPDRVIFRRARGPGVRWAA |
| Ga0066655_110079781 | 3300018431 | Grasslands Soil | GKSNLPNLLPLCYFHHRLVHEGGMQVVRAGEGVKFIPPERVVPRRVRGPGMRWAA |
| Ga0066667_122113582 | 3300018433 | Grasslands Soil | HFHHRLVHEGGWQVVKVGDHLRFVAPERPVFAPARGPGVRWAA |
| Ga0066669_102495073 | 3300018482 | Grasslands Soil | RLVQEGRMQVVRAGERVKFIPPERVVPRSVRGPGMRWAA |
| Ga0193749_10243751 | 3300020010 | Soil | LVHEGGWQVVKIAREFRFVPPDRVVFRRARAPGLRWAA |
| Ga0210407_108196091 | 3300020579 | Soil | LVLLCYFHHRLVHEGGWQVIKTGREFKFLPPDRFVMRRVRGPGMRWAA |
| Ga0193695_10889541 | 3300021418 | Soil | YLHRLVHEGGWQVIKSGREFRFLPPERVVMRRVRGPGMRWAA |
| Ga0247667_10388742 | 3300024290 | Soil | VHEGGWQVVKSGREFRFLPPERTVMRRPRGPGMRWAA |
| Ga0247667_11089241 | 3300024290 | Soil | YFHHRLVHEGGWQVVKSGREFQFVPPERMVMRRARGPGMRWAA |
| Ga0247666_10241311 | 3300024323 | Soil | LLCYFHHRLVHEGGWQVVKAGREFQFLPPERMVMRRARGPGMRWAA |
| Ga0207929_10964342 | 3300025505 | Arctic Peat Soil | LCYYHHRLVHEGGWQVVKAGQEFTFLPPDRVVMRRARGPGYRWAA |
| Ga0207699_103625211 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LLCYFHHRLVHEGGWQVVKSGREFQFLPPERMVMRRARGPGMRWAA |
| Ga0207684_116595272 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | KSNLANLLPLCFFHHRLVHEGGWQVIKAGYKVKFIPPERTIPRRVRGPGMHWAA |
| Ga0207646_105755431 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LANEVLLCYYHHRLVHEGGWSVLKVGRELRFMPPERLVMRRARGPGVRWAA |
| Ga0207664_102982871 | 3300025929 | Agricultural Soil | LVSVCYFHHRLVHEGGWQVVKAGREFRFLPPDRLMFRLARGPGDSLAA |
| Ga0207665_110306463 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | HHRLVHEGAWQVVKSGREFQFVPPERMVMRRARGPGYRWAA |
| Ga0209350_10774062 | 3300026277 | Grasslands Soil | NLLPLCYFHHRLVHEGGMQVVRAGEGVKFIPPERVVPRRVRGPGMRWAA |
| Ga0209350_10789873 | 3300026277 | Grasslands Soil | PLCHHHHRLVHEGGWQVIRAGEGVKFIPPERVVLRRVRGPGVSWAA |
| Ga0209236_10039489 | 3300026298 | Grasslands Soil | HHRLVHEGGWQVIRAGDGVKFIPPERVIPRRVRGPGMRWAA |
| Ga0209055_12672352 | 3300026309 | Soil | VHEGGWQVVQTDQGIKFIPPDHEVWRRARAPGMRWAA |
| Ga0209239_10864761 | 3300026310 | Grasslands Soil | RLVHEGGWQVVRVANGVKFIPPDRIVPRRVRGPGMRWAA |
| Ga0209761_12911442 | 3300026313 | Grasslands Soil | NELLLCYYHHRLVHEGGWQVIKAGREFRFLPPDRLVMRRARGPGMRWAA |
| Ga0209267_12021081 | 3300026331 | Soil | CHHHHRLVHEGEWQVVEAGEGVKFIPPDHDVPRRVRGPGVRWAA |
| Ga0209803_10008291 | 3300026332 | Soil | LCYHHHRLVHEGGWQVIRAGEGVKFIPPERVIPRRVRGPGMRWAA |
| Ga0209158_10091081 | 3300026333 | Soil | NLRNLLPLCYYHHRLVHEGGWQVLRVGEEVRFIPPDRVIARRVRDPGMRWAA |
| Ga0209377_10684923 | 3300026334 | Soil | LPNLLPLCYFHHRLVHEGGMQVVRAGEGVKFIPPERVVPRRVRGPGMRWAA |
| Ga0209804_11622992 | 3300026335 | Soil | HRLVHEGGWQVVRAGEKVKFIPPDRMIPKRVRGPGMRWAA |
| Ga0209159_10370371 | 3300026343 | Soil | HRQVHEGGWQVVRAGEGVKFIPPDRVIPKRVRGPGMRWAA |
| Ga0209378_10456654 | 3300026528 | Soil | CYFHHRQVHEGGWQVVRAGEGVKFIPPDREIQKRVRGPGMRWAA |
| Ga0209058_10338821 | 3300026536 | Soil | FANMQVVSAGEGVKFIPPDRVIPKRVRGPGMRWAA |
| Ga0209056_102033804 | 3300026538 | Soil | LLPLCYFHHRLVHEGGWQVVKVGKGVKFIPPERVIPARVRGPGVRWAA |
| Ga0209376_12182021 | 3300026540 | Soil | LVHEGGWQVIRAGEGVKFIPPERVVLRRVRGPGVSWAA |
| Ga0209474_100279316 | 3300026550 | Soil | SNLLPLCYFHHRQVHEGGWQVVRAGEGVKFIPPDRVIPKRVRGPGMRWAA |
| Ga0209648_101732571 | 3300026551 | Grasslands Soil | HRLVHEGGWQVVKAGEGVKFIRPDRVIARRIRAPGMRWAA |
| Ga0209648_105101961 | 3300026551 | Grasslands Soil | VHEGGWQVIKTGREFRFLPPEQFVIRRARGPGMRWAA |
| Ga0209219_11599542 | 3300027565 | Forest Soil | LCFFHHRLVHEGGWQVIKVGREFQFLPPERVVMRRARGPGYRWAA |
| Ga0209220_10010401 | 3300027587 | Forest Soil | LVHEGGWQVVKAGEGFQFIPPDRVIARRARGPGMRWAA |
| Ga0209220_11684003 | 3300027587 | Forest Soil | LPLCYYHHRLVHEGGWQVVKAGDSVKFIPPDHVIAKRTRAPGVRWAA |
| Ga0209076_10806661 | 3300027643 | Vadose Zone Soil | HEGGWQVVKAGDEVRFIPPDRVMARRVRGPGVSWAA |
| Ga0209117_10269653 | 3300027645 | Forest Soil | RLVHEGGWQVIKAGREFRFLPPERVLLRRARAPGYRWAA |
| Ga0209388_10249411 | 3300027655 | Vadose Zone Soil | NLPNLLPLCYYHHRLVHEGGWQVVKAGAGVKFIRPNRLIARRIRAPGMRWAA |
| Ga0209011_10000231 | 3300027678 | Forest Soil | HFHHRLVHEGGWQVIKAGNEFRFLPPEQFVIRRARGPGMRWAA |
| Ga0209011_12043561 | 3300027678 | Forest Soil | VCYFHHRLVHEGGWQVVKAGREFKFIPPDRVVMRRARGPGYRWAA |
| Ga0209689_12753182 | 3300027748 | Soil | PLCYYHHRLVHEGGWQVLRIGEEVRFIPPDRVIARRVRDPGMRWAA |
| Ga0209166_101854122 | 3300027857 | Surface Soil | HREVHEGGWQVVKSGRGFRFIPPETVVMRRMRGSPARWAA |
| Ga0209590_109068452 | 3300027882 | Vadose Zone Soil | LPLCYYHHRLVHEGGWQVVRAGQGVRFIRPDSVIARRIRAPGLRWAA |
| Ga0137415_101699702 | 3300028536 | Vadose Zone Soil | CYYHHRLVHEGGWQVIKVDEEVRFIPPDRVRARRVRGPGMRRAA |
| Ga0307293_101155893 | 3300028711 | Soil | VHEGGWQVVKAGREFRFMAPDRVVFRRARAPGVRWAA |
| Ga0307282_100169041 | 3300028784 | Soil | YYHHRLVHEGGWQVIKSGREFRFLPPERVVMKRARGPGMRWAA |
| Ga0073994_119238153 | 3300030991 | Soil | LCFYHHRLVHEGGWQVIKSGREFRFLPPDRIVMRRARGPGMRWAA |
| Ga0307468_1017572832 | 3300031740 | Hardwood Forest Soil | HRLVHEGGWQVLKVGREFRFVPPDRVVFRRARAPGMRWAA |
| Ga0307471_1006084703 | 3300032180 | Hardwood Forest Soil | NLLPLCYYHHRLVHEGGWQVVKTGREFRFVPPERVVMKRARGPGMRWAA |
| ⦗Top⦘ |