| Basic Information | |
|---|---|
| Family ID | F036414 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 170 |
| Average Sequence Length | 54 residues |
| Representative Sequence | MLGRIGILGFLGFIIFVAWFIGWIFFGFHEGLYHLLFPIAVVLMVAQGVRRVAR |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 170 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 82.35 % |
| % of genes near scaffold ends (potentially truncated) | 29.41 % |
| % of genes from short scaffolds (< 2000 bps) | 85.29 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.75 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (61.176 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (18.235 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.294 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (61.765 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.32% β-sheet: 0.00% Coil/Unstructured: 42.68% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.75 |
| Powered by PDBe Molstar | |
| SCOP family | SCOP domain | Representative PDB | TM-score |
|---|---|---|---|
| a.24.9.1: alpha-catenin/vinculin | d3rf3a1 | 3rf3 | 0.81688 |
| f.63.1.1: Claudin | d3jbre_ | 3jbr | 0.77123 |
| a.25.1.1: Ferritin | d1z6oa1 | 1z6o | 0.76135 |
| a.138.1.3: Di-heme elbow motif | d1oaha_ | 1oah | 0.76125 |
| a.25.1.2: Ribonucleotide reductase-like | d2uw1a_ | 2uw1 | 0.75185 |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 170 Family Scaffolds |
|---|---|---|
| PF00326 | Peptidase_S9 | 19.41 |
| PF12893 | Lumazine_bd_2 | 4.12 |
| PF00501 | AMP-binding | 1.76 |
| PF02687 | FtsX | 1.18 |
| PF12704 | MacB_PCD | 0.59 |
| PF09850 | DotU | 0.59 |
| PF01554 | MatE | 0.59 |
| PF16169 | DUF4872 | 0.59 |
| PF01370 | Epimerase | 0.59 |
| PF04397 | LytTR | 0.59 |
| PF13659 | Obsolete Pfam Family | 0.59 |
| PF12695 | Abhydrolase_5 | 0.59 |
| PF01944 | SpoIIM | 0.59 |
| PF08281 | Sigma70_r4_2 | 0.59 |
| PF13860 | FlgD_ig | 0.59 |
| PF13231 | PMT_2 | 0.59 |
| PF06580 | His_kinase | 0.59 |
| PF06744 | IcmF_C | 0.59 |
| COG ID | Name | Functional Category | % Frequency in 170 Family Scaffolds |
|---|---|---|---|
| COG1300 | Stage II sporulation protein SpoIIM, component of the engulfment complex | Cell cycle control, cell division, chromosome partitioning [D] | 0.59 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.59 |
| COG3275 | Sensor histidine kinase, LytS/YehU family | Signal transduction mechanisms [T] | 0.59 |
| COG3523 | Type VI protein secretion system component VasK | Intracellular trafficking, secretion, and vesicular transport [U] | 0.59 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.76 % |
| Unclassified | root | N/A | 38.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000443|F12B_11144018 | Not Available | 607 | Open in IMG/M |
| 3300000956|JGI10216J12902_101639011 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1440 | Open in IMG/M |
| 3300003267|soilL1_10116314 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1880 | Open in IMG/M |
| 3300003319|soilL2_10151508 | All Organisms → cellular organisms → Bacteria | 2681 | Open in IMG/M |
| 3300003324|soilH2_10168124 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
| 3300004114|Ga0062593_100633047 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300004114|Ga0062593_100715917 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300004153|Ga0063455_101199635 | Not Available | 569 | Open in IMG/M |
| 3300004156|Ga0062589_100266163 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300004156|Ga0062589_101097632 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 752 | Open in IMG/M |
| 3300004463|Ga0063356_104090190 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300004479|Ga0062595_100037231 | All Organisms → cellular organisms → Bacteria | 2081 | Open in IMG/M |
| 3300005290|Ga0065712_10689613 | Not Available | 542 | Open in IMG/M |
| 3300005329|Ga0070683_100649649 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300005332|Ga0066388_101960300 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300005333|Ga0070677_10057934 | All Organisms → cellular organisms → Bacteria | 1589 | Open in IMG/M |
| 3300005333|Ga0070677_10703621 | Not Available | 569 | Open in IMG/M |
| 3300005338|Ga0068868_101536876 | Not Available | 624 | Open in IMG/M |
| 3300005345|Ga0070692_11376111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Fimbriimonadia → Fimbriimonadales → Fimbriimonadaceae → Fimbriimonas → Fimbriimonas ginsengisoli | 509 | Open in IMG/M |
| 3300005355|Ga0070671_101898320 | Not Available | 530 | Open in IMG/M |
| 3300005356|Ga0070674_100243796 | All Organisms → cellular organisms → Bacteria | 1408 | Open in IMG/M |
| 3300005356|Ga0070674_100309253 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300005356|Ga0070674_101518174 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300005367|Ga0070667_100993510 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300005439|Ga0070711_100070828 | All Organisms → cellular organisms → Bacteria | 2456 | Open in IMG/M |
| 3300005456|Ga0070678_100532392 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300005457|Ga0070662_100058236 | All Organisms → cellular organisms → Bacteria | 2811 | Open in IMG/M |
| 3300005457|Ga0070662_100178163 | All Organisms → cellular organisms → Bacteria | 1674 | Open in IMG/M |
| 3300005471|Ga0070698_100041408 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4728 | Open in IMG/M |
| 3300005471|Ga0070698_101458752 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300005564|Ga0070664_100659063 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300005564|Ga0070664_101115500 | Not Available | 743 | Open in IMG/M |
| 3300005614|Ga0068856_100447161 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
| 3300005616|Ga0068852_100324458 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
| 3300005841|Ga0068863_101117282 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300005844|Ga0068862_100777641 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 933 | Open in IMG/M |
| 3300005890|Ga0075285_1061044 | Not Available | 519 | Open in IMG/M |
| 3300006058|Ga0075432_10481346 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300006169|Ga0082029_1305218 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1264 | Open in IMG/M |
| 3300006237|Ga0097621_100964261 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300006755|Ga0079222_10248641 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300006755|Ga0079222_12049154 | Not Available | 564 | Open in IMG/M |
| 3300006844|Ga0075428_100145129 | All Organisms → cellular organisms → Bacteria | 2580 | Open in IMG/M |
| 3300006844|Ga0075428_100386364 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
| 3300006844|Ga0075428_100613416 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300006844|Ga0075428_100977356 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 897 | Open in IMG/M |
| 3300006844|Ga0075428_101044866 | Not Available | 864 | Open in IMG/M |
| 3300006844|Ga0075428_101792384 | Not Available | 639 | Open in IMG/M |
| 3300006845|Ga0075421_100133809 | All Organisms → cellular organisms → Bacteria | 3107 | Open in IMG/M |
| 3300006845|Ga0075421_100137689 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3056 | Open in IMG/M |
| 3300006845|Ga0075421_100195255 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2509 | Open in IMG/M |
| 3300006845|Ga0075421_100334230 | All Organisms → cellular organisms → Bacteria | 1834 | Open in IMG/M |
| 3300006845|Ga0075421_100338698 | All Organisms → cellular organisms → Bacteria | 1820 | Open in IMG/M |
| 3300006845|Ga0075421_101303520 | Not Available | 804 | Open in IMG/M |
| 3300006846|Ga0075430_100001288 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 20222 | Open in IMG/M |
| 3300006846|Ga0075430_100116393 | All Organisms → cellular organisms → Bacteria | 2228 | Open in IMG/M |
| 3300006847|Ga0075431_100929256 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300006847|Ga0075431_101297973 | Not Available | 689 | Open in IMG/M |
| 3300006871|Ga0075434_100145198 | All Organisms → cellular organisms → Bacteria | 2393 | Open in IMG/M |
| 3300006871|Ga0075434_100867320 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300006871|Ga0075434_100895544 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300006876|Ga0079217_10106804 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1271 | Open in IMG/M |
| 3300006876|Ga0079217_11344344 | Not Available | 555 | Open in IMG/M |
| 3300006880|Ga0075429_100945650 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300006881|Ga0068865_100321840 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300006894|Ga0079215_10701243 | Not Available | 684 | Open in IMG/M |
| 3300006918|Ga0079216_10096819 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
| 3300006918|Ga0079216_10789609 | Not Available | 695 | Open in IMG/M |
| 3300006969|Ga0075419_11079201 | Not Available | 587 | Open in IMG/M |
| 3300007004|Ga0079218_11318671 | Not Available | 762 | Open in IMG/M |
| 3300007004|Ga0079218_11497323 | Not Available | 730 | Open in IMG/M |
| 3300007004|Ga0079218_12458831 | Not Available | 614 | Open in IMG/M |
| 3300007004|Ga0079218_13051234 | Not Available | 564 | Open in IMG/M |
| 3300009100|Ga0075418_11383744 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 763 | Open in IMG/M |
| 3300009147|Ga0114129_11810971 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300009176|Ga0105242_10579780 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1080 | Open in IMG/M |
| 3300009176|Ga0105242_10593800 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1068 | Open in IMG/M |
| 3300009840|Ga0126313_11193947 | Not Available | 627 | Open in IMG/M |
| 3300009840|Ga0126313_11227420 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 618 | Open in IMG/M |
| 3300010036|Ga0126305_10263252 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300010037|Ga0126304_10056724 | All Organisms → cellular organisms → Bacteria | 2392 | Open in IMG/M |
| 3300010041|Ga0126312_10639940 | Not Available | 766 | Open in IMG/M |
| 3300010398|Ga0126383_11160644 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 862 | Open in IMG/M |
| 3300010399|Ga0134127_11800554 | Not Available | 688 | Open in IMG/M |
| 3300010399|Ga0134127_12532199 | Not Available | 593 | Open in IMG/M |
| 3300010403|Ga0134123_11814970 | Not Available | 664 | Open in IMG/M |
| 3300012212|Ga0150985_107383274 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1120 | Open in IMG/M |
| 3300012212|Ga0150985_121459258 | Not Available | 505 | Open in IMG/M |
| 3300012212|Ga0150985_122423073 | All Organisms → cellular organisms → Bacteria | 1785 | Open in IMG/M |
| 3300012899|Ga0157299_10324704 | Not Available | 519 | Open in IMG/M |
| 3300012901|Ga0157288_10031685 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300012904|Ga0157282_10322923 | Not Available | 552 | Open in IMG/M |
| 3300012913|Ga0157298_10319997 | Not Available | 558 | Open in IMG/M |
| 3300012914|Ga0157297_10150199 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300012955|Ga0164298_10007583 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4045 | Open in IMG/M |
| 3300012957|Ga0164303_10312113 | Not Available | 933 | Open in IMG/M |
| 3300012987|Ga0164307_10555591 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300013306|Ga0163162_12569946 | Not Available | 586 | Open in IMG/M |
| 3300014745|Ga0157377_10712077 | Not Available | 730 | Open in IMG/M |
| 3300015371|Ga0132258_10400130 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3411 | Open in IMG/M |
| 3300015371|Ga0132258_10600756 | All Organisms → cellular organisms → Bacteria | 2762 | Open in IMG/M |
| 3300015371|Ga0132258_11201979 | All Organisms → cellular organisms → Bacteria | 1916 | Open in IMG/M |
| 3300015371|Ga0132258_11588842 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1651 | Open in IMG/M |
| 3300015371|Ga0132258_12835390 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300015372|Ga0132256_101168151 | Not Available | 884 | Open in IMG/M |
| 3300015372|Ga0132256_103404785 | Not Available | 535 | Open in IMG/M |
| 3300015373|Ga0132257_100108550 | All Organisms → cellular organisms → Bacteria | 3205 | Open in IMG/M |
| 3300015373|Ga0132257_100452909 | All Organisms → cellular organisms → Bacteria | 1568 | Open in IMG/M |
| 3300015373|Ga0132257_102403381 | Not Available | 684 | Open in IMG/M |
| 3300015374|Ga0132255_101091579 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300018067|Ga0184611_1284293 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 578 | Open in IMG/M |
| 3300018422|Ga0190265_12789048 | Not Available | 584 | Open in IMG/M |
| 3300018469|Ga0190270_11136865 | Not Available | 816 | Open in IMG/M |
| 3300018476|Ga0190274_10228331 | All Organisms → cellular organisms → Bacteria | 1666 | Open in IMG/M |
| 3300019377|Ga0190264_11031303 | Not Available | 661 | Open in IMG/M |
| 3300020082|Ga0206353_11418253 | Not Available | 521 | Open in IMG/M |
| 3300021445|Ga0182009_10059625 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1642 | Open in IMG/M |
| 3300021445|Ga0182009_10146035 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300022756|Ga0222622_10083496 | All Organisms → cellular organisms → Bacteria | 1916 | Open in IMG/M |
| 3300024055|Ga0247794_10261626 | Not Available | 574 | Open in IMG/M |
| 3300025315|Ga0207697_10005104 | All Organisms → cellular organisms → Bacteria | 6146 | Open in IMG/M |
| 3300025893|Ga0207682_10369269 | Not Available | 677 | Open in IMG/M |
| 3300025907|Ga0207645_10933559 | Not Available | 589 | Open in IMG/M |
| 3300025908|Ga0207643_10035176 | All Organisms → cellular organisms → Bacteria | 2808 | Open in IMG/M |
| 3300025925|Ga0207650_11771754 | Not Available | 523 | Open in IMG/M |
| 3300025926|Ga0207659_10727808 | Not Available | 850 | Open in IMG/M |
| 3300025931|Ga0207644_11050298 | Not Available | 684 | Open in IMG/M |
| 3300025934|Ga0207686_10532276 | Not Available | 916 | Open in IMG/M |
| 3300025934|Ga0207686_11581100 | Not Available | 541 | Open in IMG/M |
| 3300025936|Ga0207670_11691671 | Not Available | 538 | Open in IMG/M |
| 3300025940|Ga0207691_10080886 | All Organisms → cellular organisms → Bacteria | 2921 | Open in IMG/M |
| 3300025941|Ga0207711_10363990 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300025960|Ga0207651_11133895 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300026078|Ga0207702_10842268 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300026078|Ga0207702_11089982 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 792 | Open in IMG/M |
| 3300026078|Ga0207702_11984342 | All Organisms → cellular organisms → Bacteria → FCB group | 572 | Open in IMG/M |
| 3300026088|Ga0207641_11048070 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 813 | Open in IMG/M |
| 3300026089|Ga0207648_10166231 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1949 | Open in IMG/M |
| 3300026089|Ga0207648_11980193 | Not Available | 544 | Open in IMG/M |
| 3300026142|Ga0207698_10342574 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1409 | Open in IMG/M |
| 3300026142|Ga0207698_10538315 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300027880|Ga0209481_10478541 | Not Available | 642 | Open in IMG/M |
| 3300027886|Ga0209486_10467024 | Not Available | 778 | Open in IMG/M |
| 3300027907|Ga0207428_10218878 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
| 3300027909|Ga0209382_10031042 | All Organisms → cellular organisms → Bacteria | 6436 | Open in IMG/M |
| 3300027909|Ga0209382_10042682 | All Organisms → cellular organisms → Bacteria | 5431 | Open in IMG/M |
| 3300027909|Ga0209382_10067351 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4235 | Open in IMG/M |
| 3300027909|Ga0209382_10883754 | Not Available | 943 | Open in IMG/M |
| 3300027909|Ga0209382_11343939 | Not Available | 721 | Open in IMG/M |
| 3300028380|Ga0268265_11540525 | Not Available | 669 | Open in IMG/M |
| 3300028380|Ga0268265_12146956 | Not Available | 565 | Open in IMG/M |
| 3300028881|Ga0307277_10206902 | Not Available | 861 | Open in IMG/M |
| 3300030496|Ga0268240_10113514 | Not Available | 644 | Open in IMG/M |
| 3300031170|Ga0307498_10354664 | Not Available | 565 | Open in IMG/M |
| 3300031548|Ga0307408_100004674 | All Organisms → cellular organisms → Bacteria | 9251 | Open in IMG/M |
| 3300031548|Ga0307408_102234698 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300031716|Ga0310813_10819418 | Not Available | 839 | Open in IMG/M |
| 3300031731|Ga0307405_10187750 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
| 3300031731|Ga0307405_11056481 | Not Available | 696 | Open in IMG/M |
| 3300031740|Ga0307468_100480855 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 978 | Open in IMG/M |
| 3300031824|Ga0307413_10279582 | All Organisms → Viruses → Predicted Viral | 1255 | Open in IMG/M |
| (restricted) 3300031825|Ga0255338_1000191 | All Organisms → cellular organisms → Bacteria | 247862 | Open in IMG/M |
| 3300031852|Ga0307410_10426931 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300031854|Ga0310904_10219750 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300031901|Ga0307406_11872220 | Not Available | 534 | Open in IMG/M |
| 3300031939|Ga0308174_10491357 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1003 | Open in IMG/M |
| 3300031996|Ga0308176_12832637 | Not Available | 515 | Open in IMG/M |
| 3300032211|Ga0310896_10480917 | Not Available | 677 | Open in IMG/M |
| 3300033475|Ga0310811_10561801 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1165 | Open in IMG/M |
| 3300033513|Ga0316628_103276859 | Not Available | 588 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 18.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.41% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 7.06% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 5.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 5.29% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.12% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 4.12% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.35% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.35% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.76% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.76% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.76% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.18% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.18% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.59% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.59% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.59% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.59% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.59% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.59% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.59% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.59% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.59% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.59% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.59% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005890 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031825 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - MeOH1_35cm_T4_195 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F12B_111440182 | 3300000443 | Soil | MLGRIGVLGFLGIIVFVAWAIGWIFFNLHEGPYHLLFLAAVVLMIAQGVTRVAR* |
| JGI10216J12902_1016390111 | 3300000956 | Soil | MLGRIGVLGFLGIIVFVAWAIGWIFFGLHEGHYHLLFVVAVVLMIAQGVTRVAR* |
| soilL1_101163142 | 3300003267 | Sugarcane Root And Bulk Soil | MLDRIGILGFLGLVIFIAWAVGWLFFGFHEGLYHLWLAVAAVLMIAQGVRRIAR* |
| soilL2_101515082 | 3300003319 | Sugarcane Root And Bulk Soil | MLDRIGILGFLGIIVFVAWAIGWIAFGFHEGLYHLLFVVAVVLMIAQGVRRVAR* |
| soilH2_101681241 | 3300003324 | Sugarcane Root And Bulk Soil | FLGLIIFIAWFVGWIFLGFHAHGYHLLFLAAVVLMIAQGVVRVAR* |
| Ga0062593_1006330471 | 3300004114 | Soil | MLGRIGVLGFLGIIVFVGWAIGWIFFNLHDWHYHLLFLAAVVLMIAQGVTRIAR* |
| Ga0062593_1007159171 | 3300004114 | Soil | MLDRIGILGILGFLIFVAWFVGWVFLGFHEGLYHVLFPISVVLMVAQGVRRVAR* |
| Ga0063455_1011996351 | 3300004153 | Soil | MLGRIGVLGFLGIIVFVAWAIGWIFFNLHDWHYHLLFLAAVVLMIAQGVIRVAR* |
| Ga0062589_1002661632 | 3300004156 | Soil | MLGRIGILGFVGFLIFAAWFIGWVFLGFHNGLYHVLFPISVVLMVAQGVRRVAR* |
| Ga0062589_1010976321 | 3300004156 | Soil | MLDRIGIPGFLGFLIFAAWFIGWIFLGFHDGLYHLLFPISVVLMVAQWVRRVAR* |
| Ga0063356_1040901902 | 3300004463 | Arabidopsis Thaliana Rhizosphere | HMLGRIGVLGFLGIIVFVAWAIGWIFFNLHEGHYHLLFVAAVVLMIAQGVTRVAR* |
| Ga0062595_1000372313 | 3300004479 | Soil | MLGRIGVLGFLGIIVFVAWAIGWIFFNLHEGHYHLLFVAAVVLMIAQGVTRVAR* |
| Ga0065712_106896132 | 3300005290 | Miscanthus Rhizosphere | VNMLGRIGVLGFLGIIVFVGWAIGWIFFNLHDWHYHLLFLAAVVLMIAQGVTRIAR* |
| Ga0070683_1006496491 | 3300005329 | Corn Rhizosphere | MLGRIGILGFLGAIIFLAWFIGWIFFGFHDGLYHLLFPISVVLMMAQGVRRVAR* |
| Ga0066388_1019603002 | 3300005332 | Tropical Forest Soil | MLGRIGVLGFLGIIVFVAWAIGWIFFNLHEGHYHLLFLAAVVLMIAQGVTRVAR* |
| Ga0070677_100579342 | 3300005333 | Miscanthus Rhizosphere | MLDRIGILGFLGFLIFAAWFIGWIFLGFHDGLYHLLFPISVVLMLAQGVRRVARRAE* |
| Ga0070677_107036211 | 3300005333 | Miscanthus Rhizosphere | MLGRIGILGFLGAIIFLGWFIGWIFFGFHDGLYHLLFPISVVLMMAQGVTRVAR* |
| Ga0068868_1015368761 | 3300005338 | Miscanthus Rhizosphere | MLGRIGILGFLGAIIFLGWFIGWIFFGFHNGLYHLLFPISVVLMMAQGVRRVAR* |
| Ga0070692_113761111 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MLGRIGVLGFLGIIVFVVWAIGWIFFNFHDWHYHLLFLAAVVLMIAQGVNRVAR* |
| Ga0070671_1018983201 | 3300005355 | Switchgrass Rhizosphere | MLGRIGILGFLGAIIFLGWFIGWIFLGFHNGLYHLLFPISVVLMMAQGVTRVAR* |
| Ga0070674_1002437962 | 3300005356 | Miscanthus Rhizosphere | MLGRIGVLGFLGIIVFVAWAIGWIFFNFHEGYYHLLFLAAVVLMIAQGVTRVAR* |
| Ga0070674_1003092531 | 3300005356 | Miscanthus Rhizosphere | MLGRIGVLGFLGIIVFVAWAIGWIFLNLHDWHYHLLFLAAVVLMIAQGVNRVAR* |
| Ga0070674_1015181741 | 3300005356 | Miscanthus Rhizosphere | IGILGFLGFLIFAAWFIGWIFLGFHDGLYHLLFPISVVLMLAQGVRRVARRAE* |
| Ga0070667_1009935102 | 3300005367 | Switchgrass Rhizosphere | MLGRIGVLGFLGIIVFVGWAIGWIFFNLHDWHYHLLFLAAVVLMIAQGVTRVAR* |
| Ga0070711_1000708283 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MLGRIGVLGFLGIIVFVGWAIGWIFFNLHDWHYHLLFLAAVVMMIAQGVNRVAR* |
| Ga0070678_1005323921 | 3300005456 | Miscanthus Rhizosphere | MLGRIGILGFVGAIIFVCWFIGWIFLGFHNGLYHLLFPIALVLMIAQGVTRVAR |
| Ga0070662_1000582362 | 3300005457 | Corn Rhizosphere | MLGRIGILGFVGAIIFVCWFIGWIFLGFHNGLYHLLFPIALVLMIAQGVTRVAR* |
| Ga0070662_1001781631 | 3300005457 | Corn Rhizosphere | MLGRIGVLGFLGIIVFVGWAIGWIFFNLHDWHYHLLFLAAVVLMIAQGVT |
| Ga0070698_1000414082 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MLGRIGVLGFLGFIIFVGWFVGWVFFGLHDGLYHLLFPISVVLMVAQGVRRVAR* |
| Ga0070698_1014587522 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | EVHMLGRIGVLGFLGIIVFVAWAIGWIFFNLHEGHYHLLFVAAVVLMIAQGVTRVAR* |
| Ga0070664_1006590632 | 3300005564 | Corn Rhizosphere | MLGRIGILGFLGAIIFLGWFIGWIFLGFHNGLYHLLFPISVVLMMAQGV |
| Ga0070664_1011155002 | 3300005564 | Corn Rhizosphere | LGAIIFLAWFIGWIFFGFHDGLYHLLFPISVVLMMAQGVRRVAR* |
| Ga0068856_1004471611 | 3300005614 | Corn Rhizosphere | MLGRIGVLGLLGIIVFVGWAIGWIFFNLHDWHYHLLFLAAVVLMIAQGVNRVAR* |
| Ga0068852_1003244583 | 3300005616 | Corn Rhizosphere | MLGRIGVLGFLGIIVFVGWAIGWIFFNLHDWHYHLLFLAAVVLMIAQGVNRVAR* |
| Ga0068863_1011172821 | 3300005841 | Switchgrass Rhizosphere | REVNMLGRIGVLGFLGIIVFVGWAIGWIFFNLHDWHYHLLFLAAVVLMIAQGVTRIAR* |
| Ga0068862_1007776412 | 3300005844 | Switchgrass Rhizosphere | MLARIGILGFLGLIIFVAWFVGWVFLGFHEGMYHLLFPVSVVLMIAQGVRRVAR* |
| Ga0075285_10610442 | 3300005890 | Rice Paddy Soil | MLDRIGILGFLGILVFIAWAVGWLFFGLHEGFYHLWLVVAIVLMIAQGVRRIAR* |
| Ga0075432_104813461 | 3300006058 | Populus Rhizosphere | MLGRIGVLGFLGIIVFVAWAIGWIFFNFHEGPYHLLFLAAVVLMIAQGVTRVAR* |
| Ga0082029_13052182 | 3300006169 | Termite Nest | MFARIGILGSLGIIIFLAWFIGWIFLGFHDGLYHLLFPISVVLMVAQGVRRVAR* |
| Ga0097621_1009642612 | 3300006237 | Miscanthus Rhizosphere | PACSREVNMLGRIGVLGFLGIIVFVGWAIGWIFFNLHDWHYHLLFLAAVVLMIAQGVTRIAR* |
| Ga0079222_102486412 | 3300006755 | Agricultural Soil | MLGRIGILGFLGLIIFLAWLVGWIFLGFHAGPYHLLFLLAVVLMIAQGVLRVAR* |
| Ga0079222_120491542 | 3300006755 | Agricultural Soil | MFERIGILGFLGLIIFIAWFVGWIFFGLHAGLYHLLFLVAVVLMVAQGVRRVAR* |
| Ga0075428_1001451292 | 3300006844 | Populus Rhizosphere | MLGRIGVLGVLGIIVFVAWAVGWIFFGLHEGHYHLLFVVAVVLMVAQGVRRVAR* |
| Ga0075428_1003863642 | 3300006844 | Populus Rhizosphere | MLDRIGILGFVGFLIFAAWFIGWIFLGFHDGLYHLLFPISVVLMLAQWVRRVARVE* |
| Ga0075428_1006134161 | 3300006844 | Populus Rhizosphere | MLDRIGVLGFLGIIIFLAWFIGWVFLGFHEGLYHLLFPISVVLMMAQWVRRVAR* |
| Ga0075428_1009773561 | 3300006844 | Populus Rhizosphere | TGAPATRGKERAMLDRIGIPGFLGFLIFAAWFIGWIFLGFHDGLYHLLFPISVVLMVAQWVRRVAR* |
| Ga0075428_1010448663 | 3300006844 | Populus Rhizosphere | MLDRIGILGFLGIIIFVAWFVGWIFLGFHDGLYHLLFPVSVVLMVAQGVRRVAR* |
| Ga0075428_1017923842 | 3300006844 | Populus Rhizosphere | MLGRIGVLGFLGIIVFVAWAIGWIGFGLHEGHYHLLFVVAVALMIAQGVRRVAR* |
| Ga0075421_1001338094 | 3300006845 | Populus Rhizosphere | MFDRIGILGILGFIIFVAWFVGWVFLGFHDGLYHVLFPIAVVLMVAQGVRRVAR* |
| Ga0075421_1001376893 | 3300006845 | Populus Rhizosphere | MFDRIGILGFLGIIIFLAWFIGWVFLGFHDGLYHVLFPVSVVLMVAQGVRRVAR* |
| Ga0075421_1001952551 | 3300006845 | Populus Rhizosphere | MLDRIGILGSIGFLIFAAWFIGWVFLGFHEGLYHVLFPLSVVLMVAQWVRRVAR* |
| Ga0075421_1003342302 | 3300006845 | Populus Rhizosphere | MLDRIGILGFVGFLIFAAWFIGWIFLGFHDGLYHLLFPISVVLMLAQWVRRVAR* |
| Ga0075421_1003386982 | 3300006845 | Populus Rhizosphere | MLGRIGILGFVGFLIFAAWFIGWVFLGFHDGLYHLLFPVSVVLMMAQWVRRVAR* |
| Ga0075421_1013035201 | 3300006845 | Populus Rhizosphere | MLDRIGILGSIGFLIFAAWFIGWIFLGFHEGLYHVLFPISVVLMVAQWVRRVAR* |
| Ga0075430_1000012882 | 3300006846 | Populus Rhizosphere | MFDRIGILGILGFIIFLAWFIGWVFLGFHEGLYHVLFPIAVVLMVAQGVRRVAR* |
| Ga0075430_1001163933 | 3300006846 | Populus Rhizosphere | SLVRRRTMFDRIGILGILGFIIFVAWFVGWVFLGFHDGLYHVLFPIAVVLMVAQGVRRVAR* |
| Ga0075431_1009292562 | 3300006847 | Populus Rhizosphere | MLDRIGILGSIGFLIFAAWFIGWIFLGFHEGLYHVLFPISVVLIVAQWVRRVAR* |
| Ga0075431_1012979732 | 3300006847 | Populus Rhizosphere | MLDRIGILGFVGFLIFAAWFIGWIFLGFHDGLYHLLFPISVVLMLGQW |
| Ga0075434_1001451981 | 3300006871 | Populus Rhizosphere | MLDRIGVLGFLGIIIFLAWFIGWVFLGFHEGPYHLLFPISVVLMMVQWVRRVAR* |
| Ga0075434_1008673202 | 3300006871 | Populus Rhizosphere | LGRIGVLGFLGIIVFVAWAIGWIGFGLHEGHYHLLFVVAVALMIAQGVRRVAR* |
| Ga0075434_1008955442 | 3300006871 | Populus Rhizosphere | MLGRIGVLGFLGIIIFVAWFVGWVFLGFHEGPYHLLFLVAVVLMIAQGVRRVAR* |
| Ga0079217_101068041 | 3300006876 | Agricultural Soil | MLGRIGILGFLGIIIFVAWFVGWVFLGFHDGLYHLLFPISVVLMVAQGVRRVAR* |
| Ga0079217_113443441 | 3300006876 | Agricultural Soil | MIDRIGVLGFLGFLIFVAWFVGWIFLGFHDGLYHLLFPIAVVLMVAQGVRRVA |
| Ga0075429_1009456501 | 3300006880 | Populus Rhizosphere | RIGVLGFLGIIVFVAWAIGWIGFGLHEGHYHLLFVVAVALMIAQGVRRVAR* |
| Ga0068865_1003218401 | 3300006881 | Miscanthus Rhizosphere | MLGRIGILGFVGAIIFVCWFIGWIFLGFHNGLYHLLFPIALVLMIAQ |
| Ga0079215_107012431 | 3300006894 | Agricultural Soil | KPQLAPGGSMFDRIGILGILGIVIFVAWFVGWVFLGFHDGLYHVLFPIAVVLMEAQGVRRDAR* |
| Ga0079216_100968192 | 3300006918 | Agricultural Soil | MIDRIGVLGFLGFLIFVAWFVGWIFLGFHDGLYHLLFPIAVVLMVAQGVRRVAR* |
| Ga0079216_107896092 | 3300006918 | Agricultural Soil | MFDRFGILGILAFVIFAAWFIGWVFLGFHDGLYHLLFPIAVVLMVAQGVRR |
| Ga0075419_110792012 | 3300006969 | Populus Rhizosphere | MLGRIGVLGLLGIIVFVAWAIGWIFFNLHEGPYHLLFLAAVVLMIAQGVTRVAR* |
| Ga0079218_113186712 | 3300007004 | Agricultural Soil | MLDRIGILGTLGFLIFAAWFIGWIFLGFHDGLYHLLFPISVVLMLAQWVRRVAR* |
| Ga0079218_114973231 | 3300007004 | Agricultural Soil | MFDRIGILGILGIVIFVAWFVGWVFLGFHDGLYHVLFPIAVVLMVAQGVRRVAR* |
| Ga0079218_124588311 | 3300007004 | Agricultural Soil | MLDRIGILGSIGFLIFAAWFIGWVFLGFHEGLYHVLFPISVVLMLAQWVRRVAR* |
| Ga0079218_130512341 | 3300007004 | Agricultural Soil | MLGRIGILGFLGIIIFVAWFVGWIFLGFHDGLYHLLFPISVVLMVAQGVRRVAR* |
| Ga0075418_113837442 | 3300009100 | Populus Rhizosphere | LDRIGILGFLGFLIFAAWFIGWIFLGFHDGLYHLLFPISVVLMVAQWVRRVAR* |
| Ga0114129_118109712 | 3300009147 | Populus Rhizosphere | MLGRIGVLGFLGIIVFVAWAVGWIFFNLHEGTYHLLFLAAVVLMIAQGVTRVAR* |
| Ga0105242_105797801 | 3300009176 | Miscanthus Rhizosphere | LGRIGVLGFLGIIVFVAWAIGWIFFNFHEGYYHLLFLAAVVLMIAQGVTRVAR* |
| Ga0105242_105938001 | 3300009176 | Miscanthus Rhizosphere | REVHMLGRIGVLGFLGIIVFVAWAIGWIFLNLHDWHYHLLFLAAVVLMIAQGVNRVAR* |
| Ga0126313_111939472 | 3300009840 | Serpentine Soil | MLGRIGILGFVGAIIFIGWFIGWVFFGFHDGLYHLLFPISVVLMMAQGVTRVAR* |
| Ga0126313_112274201 | 3300009840 | Serpentine Soil | MLGRIGILGFVGAIIFVSWFIGWIFLGFHNGLYHLLFPIALVLMIA |
| Ga0126305_102632522 | 3300010036 | Serpentine Soil | MLGRIGILVFVGAIIFVCWFIGWIFLGFHNGLYHLLFPIALVLMIAQGVTRVAR* |
| Ga0126304_100567243 | 3300010037 | Serpentine Soil | MLDRIGILGFLGSLIFAAWFIGWIFLGFHDGLYHLLFPISVVLMLAQWVRRVAR* |
| Ga0126312_106399401 | 3300010041 | Serpentine Soil | LGSLIFAAWFIGWIFLGFHDGLYHLLFPISVVLMLAQWVRRVAR* |
| Ga0126383_111606441 | 3300010398 | Tropical Forest Soil | MVGRIGVLGFLGIIVFVGWAIGWIFFNLHDWHYHLLFLAAVVLMIAQGVNRVAR* |
| Ga0134127_118005541 | 3300010399 | Terrestrial Soil | MLGRIGILGFVGFLIFVAWFVGWVFLGYHDGLYHVLFPISVVLMVAQGVRRVAR* |
| Ga0134127_125321992 | 3300010399 | Terrestrial Soil | MLGRIGVLGFLGIIVFVGWAIGWIFFNLHDWHYHLLFLAAVVLMI |
| Ga0134123_118149702 | 3300010403 | Terrestrial Soil | MLGRIGVLGFLGIIVFVAWAIGWIFFNLHEGHYHLLFVAAVVLMIAQGVNRVAR* |
| Ga0150985_1073832741 | 3300012212 | Avena Fatua Rhizosphere | VQQEVHMLGRIGVLGFLGIIVFVAWAIGWIFFNLHDWHYHLLFLAAVVLMIAQGVIRVAR |
| Ga0150985_1214592581 | 3300012212 | Avena Fatua Rhizosphere | MLGRIGILGFVGALIFIGWFIGWIFFGFHNGLYHLLFPISLVLMIAQGVTRVAR* |
| Ga0150985_1224230732 | 3300012212 | Avena Fatua Rhizosphere | MLGRIGILGFVGAIIFVCWFIGWIFLGFHNGLYHLLFPIALILMIAQGVTRVAR* |
| Ga0157299_103247041 | 3300012899 | Soil | MLGRIGVLGFLGIIVFVAWAIGWIFFNLHEGHYHLLFVAAVVLMIAQG |
| Ga0157288_100316851 | 3300012901 | Soil | LGIIVFVAWAIGWIFFNLHEGHYHLLFVAAVVLMIAQGVTRVAR* |
| Ga0157282_103229231 | 3300012904 | Soil | MLGRIGVLGFLGIIVFVAWAIGWIFFNLHEGHYHLLFVAAVVLMIAQGVTRVSR* |
| Ga0157298_103199972 | 3300012913 | Soil | MLDRIGILGFLGFLIFAAWFIGWIFLGFHNGLYHLLFPISVVLMLAQGVRRVARRTE* |
| Ga0157297_101501991 | 3300012914 | Soil | ARRCSMLGRIGILGFVGAIIFVCWFIGWIFLGFHNGLYHLLFPIALVLMIAQGVTRVAR* |
| Ga0164298_100075834 | 3300012955 | Soil | MLGRIGVLGFLGIIVFVAWAIGWIFFNFHEGYYHLLFLAAVVLMVAQGVTRVAR* |
| Ga0164303_103121131 | 3300012957 | Soil | MLDRIGVLGFLGLIVFVAWAIGWIFFGFHEGYYHLLFALAAVLMIAQGVRRVAR* |
| Ga0164307_105555911 | 3300012987 | Soil | MLGRIGVLGFLGIIVFVAWAIGWIFFNFHEGYYHLLFLAAVVLMVAQ |
| Ga0163162_125699462 | 3300013306 | Switchgrass Rhizosphere | MLGRIGVLGFLGIIVFVAWAIGWIFFILHEGHYHLLFVAAVVLMIAQGVTRVAR* |
| Ga0157377_107120771 | 3300014745 | Miscanthus Rhizosphere | MLDRIGILGFLGFLIFAAWFIGWIFLGFHDGLYHLLFPISVVLLLAQGVRRVAR |
| Ga0132258_104001304 | 3300015371 | Arabidopsis Rhizosphere | MLGRIGILGFLGLLVFVAWAIGWLFLGFHEGLYHLWFVVAVVLMIAQGVRRIAR* |
| Ga0132258_106007562 | 3300015371 | Arabidopsis Rhizosphere | MLGRIGILGFVGALIFIGWFVGWIFFGFHDGLYHLLFPISVVLMIAQGVTRVAR* |
| Ga0132258_112019793 | 3300015371 | Arabidopsis Rhizosphere | MLDRIGILGFLGLIVFIAWAVGWLFFGFHEGLYHLWLAVAAVLMIAQGVRRIAR* |
| Ga0132258_115888422 | 3300015371 | Arabidopsis Rhizosphere | MLGRIGVLGFLGIILFVAWAVGWIFFNLHEGHYHLLFLAAVVLMIAQGVTRVAR* |
| Ga0132258_128353902 | 3300015371 | Arabidopsis Rhizosphere | MLGRIGILGFLGFIIFVAWFIGWIFFGFHEGLYHLLFPIAVVLMVAQGVRRVAR* |
| Ga0132256_1011681512 | 3300015372 | Arabidopsis Rhizosphere | MLGRIGVLGFLGIIVFVAWAIGWIGFGLHEGHYHLLFVLAVVLMIAQGVRRVAR* |
| Ga0132256_1034047851 | 3300015372 | Arabidopsis Rhizosphere | MLGRIGILGFVGALIFIGWFVGWIFFGFHDGLYHLLFPISVVLM |
| Ga0132257_1001085502 | 3300015373 | Arabidopsis Rhizosphere | MLGRIGVLGFLGIIVFVAWAIGWIGFGLHEGHYHLLFVLAVALMIAQGVRRVAR* |
| Ga0132257_1004529092 | 3300015373 | Arabidopsis Rhizosphere | MLDRIGVLGFLGLIIFVAWAIGWIFLGFHEGYYHVLFPLAAVLLIAQGVRRVAR* |
| Ga0132257_1024033812 | 3300015373 | Arabidopsis Rhizosphere | MLGRIGILGFVGAIIFVCWFIGWIFLGFHNGLYHLLFPISLVLMIAQGVTRVAR* |
| Ga0132255_1010915791 | 3300015374 | Arabidopsis Rhizosphere | MLGRIGVLGFLGIIVFVAWAIGWIGFGLHEGHYHLLFVVAVVLMIAQGVRRVAR* |
| Ga0184611_12842932 | 3300018067 | Groundwater Sediment | LGRIGILGFVGAIIFVCWFIGWIFLGFHNGLYHLLFPIALVLMIAQGVTRVAR |
| Ga0190265_127890482 | 3300018422 | Soil | MLDRIGILGFLGFLIFAGWFIGWVFLGFHDGLYHLLFPIAVVLMVAQGVRRV |
| Ga0190270_111368652 | 3300018469 | Soil | MLDRIGILGILGILIFCAWFIGWVFLGFHDGLYHVLFPVSVVLMVVQGVRRVAR |
| Ga0190274_102283312 | 3300018476 | Soil | MLDRIGILGFLGFLIFAAWFIGWIFLGFHDGLYHLLFPISVVLMVAQWVRRVAR |
| Ga0190264_110313032 | 3300019377 | Soil | MLDRIGILGFLGIIIFIAWCGRWLFLDFRAGLSQLLFPISVVLMVAQGVRRVAR |
| Ga0206353_114182531 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MLGRIDVLGFLGIIVFVGWAIGWIFFNLHDWHYHLLFLAAVVLMIAQGVTRIAR |
| Ga0182009_100596251 | 3300021445 | Soil | IGVLGFLGIIVFVGWAIGWIFFNLHDWHYHLLFLAAVVLMIAQGVTRIAR |
| Ga0182009_101460352 | 3300021445 | Soil | MLGRIGILGFLGAIIFLAWFIGWIFFGFHDGLYHLLFPISVVLMMAQGVRRVAR |
| Ga0222622_100834962 | 3300022756 | Groundwater Sediment | MLARIGILGFVGAIIFVCWFIGWIFLGFHNGLYHLLFPIALVLMIAQGVTRVAR |
| Ga0247794_102616262 | 3300024055 | Soil | MLGRIGVLGFLGIIVFVGWAIGWIFFNLHDWHYHLLFLAAVVLMIAQGVTRIAR |
| Ga0207697_100051044 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MLGRIGVLGFLGIIVFVAWAIGWIFFNLHEGHYHLLFVAAVVLMIAQGVTRVAR |
| Ga0207682_103692692 | 3300025893 | Miscanthus Rhizosphere | MLGRIGILGFLGAIIFLGWFIGWIFFGFHDGLYHLLFPISVVLMMAQGVTRVAR |
| Ga0207645_109335591 | 3300025907 | Miscanthus Rhizosphere | GFVGAIIFVCWFIGWIFLGFHNGLYHLLFPIALVLMIAQGVTRVAR |
| Ga0207643_100351762 | 3300025908 | Miscanthus Rhizosphere | MLDRIGIPGFLGFLIFAAWFIGWIFLGFHDGLYHLLFPISVVLMVAQWVRRVAR |
| Ga0207650_117717542 | 3300025925 | Switchgrass Rhizosphere | MLGRIGILGFLGAIIFLGWFIGWIFFGFHNGLYHLLFPISVVLMMAQGVRRVAR |
| Ga0207659_107278082 | 3300025926 | Miscanthus Rhizosphere | MLGRIGILGFLGAIIFLAWFIGWIFLGFHNGLYHLLFPISVVLMMAQGVRRVAR |
| Ga0207644_110502981 | 3300025931 | Switchgrass Rhizosphere | MLGRIGVLGFLGIIVFVAWAIGWIFFNLHDWHYHLLFLAAVVLMIAQGVIRVAR |
| Ga0207686_105322762 | 3300025934 | Miscanthus Rhizosphere | MLGRIGVLGFLGIIVFVAWAIGWIFLNLHDWHYHLLFLAAVVLMIAQGVNRVAR |
| Ga0207686_115811001 | 3300025934 | Miscanthus Rhizosphere | MLGRIGVLGFLGIIVFVAWAIGWIFFNFHEGHYHLLFLAAVVLMIAQGVTRVAR |
| Ga0207670_116916711 | 3300025936 | Switchgrass Rhizosphere | MLGRIGVLGFLGIIVFVVWAIGWIFFNFHDWHYHLLFLAAVVLMIAQGVNRVAR |
| Ga0207691_100808863 | 3300025940 | Miscanthus Rhizosphere | MLDRIGILGFLGFLIFAAWFIGWIFLGFHDGLYHLLFPISVVLMLAQGVRRVARRTE |
| Ga0207711_103639902 | 3300025941 | Switchgrass Rhizosphere | MLGRIGILGFVGAIIFVCWFIGWIFLGFHNGLYHLLFPIALVLMIAQGVT |
| Ga0207651_111338952 | 3300025960 | Switchgrass Rhizosphere | MLGRIGVLGFLGFIVFVAWAIGWIFFNLHEGHYHLLFVAAVVLMIAQGVT |
| Ga0207702_108422682 | 3300026078 | Corn Rhizosphere | MLGRIGVLGLLGIIVFVGWAIGWIFFNLHDWHYHLLFLAAVVLMIAQGVTR |
| Ga0207702_110899821 | 3300026078 | Corn Rhizosphere | NMLGRIGVLGFLGIIVFVGWAIGWIFFNLHDWHYHLLFLAAVVLMIAQGVTRIAR |
| Ga0207702_119843422 | 3300026078 | Corn Rhizosphere | MLGRIGVLGFLGIIVFVGWAIGWIFFNLHDWHYHLLFLAAVVLMIAQGVTRIA |
| Ga0207641_110480702 | 3300026088 | Switchgrass Rhizosphere | PACRREVNMLGRIGVLGFLGIIVFVGWAIGWIFFNLHDWHYHLLFLAAVVLMIAQGVTRIAR |
| Ga0207648_101662312 | 3300026089 | Miscanthus Rhizosphere | MLGRIGVLGFLGIIVFVAWAIGWIFFNFHEGYYHLLFLAAVVLMIAQGVTRVAR |
| Ga0207648_119801931 | 3300026089 | Miscanthus Rhizosphere | MLDRIGILGFLGFLIFAAWFIGWIFLGFHNGLYHLLFPISVVLMLAQGVRRVARRAE |
| Ga0207698_103425741 | 3300026142 | Corn Rhizosphere | REVHMLGRIGVLGFLGIIVFVVWAIGWIFFNFHDWHYHLLFLAAVVLMIAQGVNRVAR |
| Ga0207698_105383151 | 3300026142 | Corn Rhizosphere | MLGRIGILGFVGAIIFVCWFIGWIFLGFHNGLYHLLFPIALVLMIAQGVTR |
| Ga0209481_104785412 | 3300027880 | Populus Rhizosphere | MLDRIGILGFLGIIIFVAWFVGWIFLGFHDGLYHLLFPVSVVLMVAQGVRRVAR |
| Ga0209486_104670241 | 3300027886 | Agricultural Soil | MFDRIGILGILGIVIFVAWFVGWVFLGFHDGLYHVLFPIAVVLMVAQGVRRVAR |
| Ga0207428_102188782 | 3300027907 | Populus Rhizosphere | MLGRIGVLGFLGIIVFVAWAIGWIFFNLHEGPYHLLFLAAVVLMIAQGVTRVAR |
| Ga0209382_100310424 | 3300027909 | Populus Rhizosphere | MFDRIGILGILGFIIFVAWFVGWVFLGFHDGLYHVLFPIAVVLMVAQGVRRVAR |
| Ga0209382_100426823 | 3300027909 | Populus Rhizosphere | MFDRIGILGFLGIIIFLAWFIGWVFLGFHDGLYHVLFPVSVVLMVAQGVRRVAR |
| Ga0209382_100673513 | 3300027909 | Populus Rhizosphere | MLGRIGVLGFLGIIVFVAWAIGWIGFGLHEGHYHLLFVVAVALMIAQGVRRVAR |
| Ga0209382_108837542 | 3300027909 | Populus Rhizosphere | MLGRIGVLGVLGIIVFVAWAVGWIFFGLHEGHYHLLFVVAVVLMVAQGVRRVAR |
| Ga0209382_113439392 | 3300027909 | Populus Rhizosphere | MLGRIGILGFVGFLIFAAWFIGWVFLGFHDGLYHLLFPVSVVLMMAQWVRRVAR |
| Ga0268265_115405251 | 3300028380 | Switchgrass Rhizosphere | MLARIGILGFLGLIIFVAWFVGWVFLGFHEGMYHLLFPVSVVLMIAQGVRRVAR |
| Ga0268265_121469562 | 3300028380 | Switchgrass Rhizosphere | MLARIGVLGFLGFLIFVAWFVGWIFLGYHDGLYHVLFPISVVLMVAQG |
| Ga0307277_102069022 | 3300028881 | Soil | MLGRIGVLGFLGFAIFVGWFVGWIFFGLHNGLYHLLFPISVVLMIAQGVTRVAR |
| Ga0268240_101135142 | 3300030496 | Soil | MLGRIGVLGFLGIIVFVAWAIGWIFFNLHEGHYHLLFLAAVVLMIAQGVTRVAR |
| Ga0307498_103546641 | 3300031170 | Soil | MLDRIGVLGFLGLIIFVAWAIGWIFFGFHEGYYHLLFPLAAVLMIAQGVRRVAR |
| Ga0307408_1000046745 | 3300031548 | Rhizosphere | MLGRIGVLGFLGIIVFVAWAIGWIFFNLHEGPYHLLFVAAVVLMIAQGVTRVAR |
| Ga0307408_1022346981 | 3300031548 | Rhizosphere | HMLGRIGILGFLGFLIFVAWFVGWIFLGFHEGLYHVLFPISVVLMVAQGVRRVAR |
| Ga0310813_108194182 | 3300031716 | Soil | MLGRIGVLGFLGLIVFVAWAIGWLVFGLHEGHYHLWLAVAAVLMIAQGVRRVAR |
| Ga0307405_101877502 | 3300031731 | Rhizosphere | MLDRIGILGILGFLIFAAWFIGWIFLGFHDGLYHLLFPISVVLMLAQWVRRVAR |
| Ga0307405_110564811 | 3300031731 | Rhizosphere | MLGRIGILGFVGFLIFVAWFVGWIFFGFHEGLYHVLFPISVVLMVAQGVRRVAR |
| Ga0307468_1004808552 | 3300031740 | Hardwood Forest Soil | MLGRIGVLGFLGIIIFVAWAIGWIFFGLHEGHYHLLFVVAVVLMIAQGVTRVAR |
| Ga0307413_102795822 | 3300031824 | Rhizosphere | MLGRIGILGFLGFIIFVAWFVGWIFLGFHDGLYHLLFPISVVLMVAQ |
| (restricted) Ga0255338_100019164 | 3300031825 | Sandy Soil | MLERIGILGMLGFIIFVAWFIGWVFLGFHNGLYHVLFPISVVLMVAQGVRRVAR |
| Ga0307410_104269312 | 3300031852 | Rhizosphere | MLGRIGILGFLGFIIFVAWFVGWIFLGFHDGLYHLLFPISVVLMVAQGVRRVAR |
| Ga0310904_102197502 | 3300031854 | Soil | MLGRIGVLGFLGIIVFVAWAIGWIFFNLHEGHYHLLFVAAVVLMIAQGVTR |
| Ga0307406_118722201 | 3300031901 | Rhizosphere | RRVRGGRRTMLGRIGILGFVGFLIFAAWFIGWVFLGFHDGLYHLLFPVSVVLMMAQWVRRVAR |
| Ga0308174_104913572 | 3300031939 | Soil | MLGRIGILGFVGALIFIGWFVGWIFFGFHDGLYHLLFPVSVVLMIAQGVTRVAR |
| Ga0308176_128326371 | 3300031996 | Soil | VLDRIGIPGFLGLILFIAWFVGWVFLGFHAHGYHLLFLLSVVLMIAQGVRRVAR |
| Ga0310896_104809172 | 3300032211 | Soil | MLGRIGVLGFLGIIVFVAWAIGWIFFNLHEGHYHLLFVAAVVLMIALGVTRVAR |
| Ga0310811_105618012 | 3300033475 | Soil | MLGRIGILGFLGAIIFFGFHDGLYHLLFPISVVLMMAQGVRRVAR |
| Ga0316628_1032768591 | 3300033513 | Soil | MLGRIGILGFLGIIVFAGWFVGWVFFGLHDGLYHLLFPISVVLMIAQGVTRVAR |
| ⦗Top⦘ |