| Basic Information | |
|---|---|
| Family ID | F036407 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 170 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MAQVIEFYIPARFKQKVKWIPPEQRGKIIAFPTDLKKSA |
| Number of Associated Samples | 126 |
| Number of Associated Scaffolds | 170 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 82.94 % |
| % of genes near scaffold ends (potentially truncated) | 20.59 % |
| % of genes from short scaffolds (< 2000 bps) | 75.88 % |
| Associated GOLD sequencing projects | 115 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.118 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.529 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.706 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.353 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.48% β-sheet: 0.00% Coil/Unstructured: 95.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 170 Family Scaffolds |
|---|---|---|
| PF05193 | Peptidase_M16_C | 10.00 |
| PF03544 | TonB_C | 8.24 |
| PF02954 | HTH_8 | 2.94 |
| PF00158 | Sigma54_activat | 2.35 |
| PF03729 | DUF308 | 1.76 |
| PF04264 | YceI | 1.76 |
| PF00990 | GGDEF | 1.76 |
| PF06202 | GDE_C | 1.18 |
| PF00115 | COX1 | 1.18 |
| PF00753 | Lactamase_B | 1.18 |
| PF00486 | Trans_reg_C | 0.59 |
| PF03061 | 4HBT | 0.59 |
| PF13620 | CarboxypepD_reg | 0.59 |
| PF01494 | FAD_binding_3 | 0.59 |
| PF04389 | Peptidase_M28 | 0.59 |
| PF01149 | Fapy_DNA_glyco | 0.59 |
| PF17152 | CHASE8 | 0.59 |
| PF01161 | PBP | 0.59 |
| PF02321 | OEP | 0.59 |
| PF01058 | Oxidored_q6 | 0.59 |
| PF13520 | AA_permease_2 | 0.59 |
| PF04253 | TFR_dimer | 0.59 |
| PF01451 | LMWPc | 0.59 |
| PF13186 | SPASM | 0.59 |
| PF00174 | Oxidored_molyb | 0.59 |
| PF07228 | SpoIIE | 0.59 |
| PF00571 | CBS | 0.59 |
| PF11752 | DUF3309 | 0.59 |
| PF13432 | TPR_16 | 0.59 |
| PF13561 | adh_short_C2 | 0.59 |
| PF13477 | Glyco_trans_4_2 | 0.59 |
| PF00989 | PAS | 0.59 |
| PF13470 | PIN_3 | 0.59 |
| PF11066 | DUF2867 | 0.59 |
| PF00106 | adh_short | 0.59 |
| COG ID | Name | Functional Category | % Frequency in 170 Family Scaffolds |
|---|---|---|---|
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 8.24 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 1.76 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 1.76 |
| COG3408 | Glycogen debranching enzyme (alpha-1,6-glucosidase) | Carbohydrate transport and metabolism [G] | 1.18 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.18 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.18 |
| COG1740 | Ni,Fe-hydrogenase I small subunit | Energy production and conversion [C] | 0.59 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.59 |
| COG3260 | Ni,Fe-hydrogenase III small subunit | Energy production and conversion [C] | 0.59 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.59 |
| COG1941 | Coenzyme F420-reducing hydrogenase, gamma subunit | Energy production and conversion [C] | 0.59 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 0.59 |
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 0.59 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.59 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.59 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.59 |
| COG0377 | NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductase | Energy production and conversion [C] | 0.59 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.12 % |
| Unclassified | root | N/A | 25.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908043|A2_c1_ConsensusfromContig72252 | Not Available | 692 | Open in IMG/M |
| 2199352024|deeps__Contig_160151 | Not Available | 582 | Open in IMG/M |
| 3300001545|JGI12630J15595_10098839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300001593|JGI12635J15846_10672727 | Not Available | 598 | Open in IMG/M |
| 3300001686|C688J18823_10025550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4010 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100365695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1323 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100810436 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100892788 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300002568|C688J35102_120280553 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300002910|JGI25615J43890_1021999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1052 | Open in IMG/M |
| 3300004479|Ga0062595_100000460 | All Organisms → cellular organisms → Bacteria | 7638 | Open in IMG/M |
| 3300004479|Ga0062595_100024995 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2346 | Open in IMG/M |
| 3300004479|Ga0062595_101375409 | Not Available | 641 | Open in IMG/M |
| 3300004479|Ga0062595_102256654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300005171|Ga0066677_10386846 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 800 | Open in IMG/M |
| 3300005174|Ga0066680_10032251 | All Organisms → cellular organisms → Bacteria | 2974 | Open in IMG/M |
| 3300005175|Ga0066673_10020408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3040 | Open in IMG/M |
| 3300005175|Ga0066673_10068713 | All Organisms → cellular organisms → Bacteria | 1834 | Open in IMG/M |
| 3300005177|Ga0066690_10906410 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300005181|Ga0066678_10241236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1166 | Open in IMG/M |
| 3300005293|Ga0065715_10667242 | Not Available | 656 | Open in IMG/M |
| 3300005332|Ga0066388_100930842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1443 | Open in IMG/M |
| 3300005332|Ga0066388_105550654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 639 | Open in IMG/M |
| 3300005332|Ga0066388_105793635 | Not Available | 625 | Open in IMG/M |
| 3300005332|Ga0066388_107357038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 553 | Open in IMG/M |
| 3300005434|Ga0070709_10208844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1387 | Open in IMG/M |
| 3300005436|Ga0070713_102270505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 525 | Open in IMG/M |
| 3300005437|Ga0070710_10747360 | Not Available | 694 | Open in IMG/M |
| 3300005439|Ga0070711_100780592 | Not Available | 809 | Open in IMG/M |
| 3300005445|Ga0070708_100008386 | All Organisms → cellular organisms → Bacteria | 8297 | Open in IMG/M |
| 3300005446|Ga0066686_10043503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2707 | Open in IMG/M |
| 3300005467|Ga0070706_102016595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 522 | Open in IMG/M |
| 3300005471|Ga0070698_100225469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1807 | Open in IMG/M |
| 3300005536|Ga0070697_100293839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1396 | Open in IMG/M |
| 3300005602|Ga0070762_10391054 | Not Available | 894 | Open in IMG/M |
| 3300005602|Ga0070762_10850794 | Not Available | 619 | Open in IMG/M |
| 3300005610|Ga0070763_10085921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 1564 | Open in IMG/M |
| 3300005610|Ga0070763_10293954 | Not Available | 891 | Open in IMG/M |
| 3300005614|Ga0068856_100593429 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300005764|Ga0066903_100270550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2650 | Open in IMG/M |
| 3300005764|Ga0066903_102058785 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300005841|Ga0068863_102501549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300005993|Ga0080027_10085195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1173 | Open in IMG/M |
| 3300006028|Ga0070717_10689175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 928 | Open in IMG/M |
| 3300006034|Ga0066656_10172748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1364 | Open in IMG/M |
| 3300006050|Ga0075028_100001215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9367 | Open in IMG/M |
| 3300006050|Ga0075028_100320575 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300006050|Ga0075028_100380330 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
| 3300006050|Ga0075028_100996700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 521 | Open in IMG/M |
| 3300006059|Ga0075017_100799941 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300006162|Ga0075030_100043075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3800 | Open in IMG/M |
| 3300006172|Ga0075018_10419661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 684 | Open in IMG/M |
| 3300006175|Ga0070712_100869956 | Not Available | 776 | Open in IMG/M |
| 3300006175|Ga0070712_101251839 | Not Available | 646 | Open in IMG/M |
| 3300006176|Ga0070765_100001848 | All Organisms → cellular organisms → Bacteria | 13121 | Open in IMG/M |
| 3300006176|Ga0070765_100747071 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300009038|Ga0099829_10006312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7313 | Open in IMG/M |
| 3300009038|Ga0099829_10863990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 751 | Open in IMG/M |
| 3300009088|Ga0099830_10100073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2162 | Open in IMG/M |
| 3300009089|Ga0099828_10606085 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300009098|Ga0105245_10386762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1394 | Open in IMG/M |
| 3300009792|Ga0126374_10145296 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
| 3300010046|Ga0126384_10338204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1250 | Open in IMG/M |
| 3300010046|Ga0126384_10588753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 972 | Open in IMG/M |
| 3300010047|Ga0126382_10769781 | Not Available | 817 | Open in IMG/M |
| 3300010048|Ga0126373_10042683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3999 | Open in IMG/M |
| 3300010048|Ga0126373_10109003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2574 | Open in IMG/M |
| 3300010048|Ga0126373_11484606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
| 3300010048|Ga0126373_13047746 | Not Available | 522 | Open in IMG/M |
| 3300010358|Ga0126370_10041096 | All Organisms → cellular organisms → Bacteria | 2872 | Open in IMG/M |
| 3300010358|Ga0126370_10208398 | All Organisms → cellular organisms → Bacteria | 1483 | Open in IMG/M |
| 3300010358|Ga0126370_12177168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300010359|Ga0126376_12716865 | Not Available | 544 | Open in IMG/M |
| 3300010360|Ga0126372_10116079 | All Organisms → cellular organisms → Bacteria | 2055 | Open in IMG/M |
| 3300010360|Ga0126372_11032779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 836 | Open in IMG/M |
| 3300010366|Ga0126379_10000489 | All Organisms → cellular organisms → Bacteria | 21859 | Open in IMG/M |
| 3300010366|Ga0126379_10791268 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300010375|Ga0105239_10341357 | Not Available | 1690 | Open in IMG/M |
| 3300010376|Ga0126381_100153003 | All Organisms → cellular organisms → Bacteria | 3031 | Open in IMG/M |
| 3300010376|Ga0126381_100770992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1379 | Open in IMG/M |
| 3300010401|Ga0134121_13053139 | Not Available | 515 | Open in IMG/M |
| 3300010857|Ga0126354_1042128 | Not Available | 522 | Open in IMG/M |
| 3300011270|Ga0137391_10223822 | All Organisms → cellular organisms → Bacteria | 1634 | Open in IMG/M |
| 3300011270|Ga0137391_10285876 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
| 3300011270|Ga0137391_10518608 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300011270|Ga0137391_10909430 | Not Available | 720 | Open in IMG/M |
| 3300012189|Ga0137388_10638819 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300012189|Ga0137388_10815926 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300012189|Ga0137388_11264535 | Not Available | 676 | Open in IMG/M |
| 3300012202|Ga0137363_10396018 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300012208|Ga0137376_11511178 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300012209|Ga0137379_10479743 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300012209|Ga0137379_10678324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 936 | Open in IMG/M |
| 3300012363|Ga0137390_10072988 | All Organisms → cellular organisms → Bacteria | 3364 | Open in IMG/M |
| 3300012685|Ga0137397_10196916 | All Organisms → cellular organisms → Bacteria | 1498 | Open in IMG/M |
| 3300012924|Ga0137413_10495943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
| 3300012930|Ga0137407_10000974 | All Organisms → cellular organisms → Bacteria | 18814 | Open in IMG/M |
| 3300012930|Ga0137407_10563366 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300012958|Ga0164299_10168573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1232 | Open in IMG/M |
| 3300012984|Ga0164309_10833684 | Not Available | 745 | Open in IMG/M |
| 3300013297|Ga0157378_10214164 | All Organisms → cellular organisms → Bacteria | 1828 | Open in IMG/M |
| 3300014969|Ga0157376_11308139 | Not Available | 755 | Open in IMG/M |
| 3300015087|Ga0167637_1014320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1161 | Open in IMG/M |
| 3300017792|Ga0163161_11561005 | Not Available | 581 | Open in IMG/M |
| 3300017966|Ga0187776_11043540 | Not Available | 603 | Open in IMG/M |
| 3300017993|Ga0187823_10010341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2215 | Open in IMG/M |
| 3300018468|Ga0066662_10054807 | All Organisms → cellular organisms → Bacteria | 2566 | Open in IMG/M |
| 3300018482|Ga0066669_10237457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1430 | Open in IMG/M |
| 3300019887|Ga0193729_1226298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300019888|Ga0193751_1030060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2556 | Open in IMG/M |
| 3300019888|Ga0193751_1033418 | All Organisms → cellular organisms → Bacteria | 2380 | Open in IMG/M |
| 3300020199|Ga0179592_10390060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300020579|Ga0210407_10071340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2609 | Open in IMG/M |
| 3300020583|Ga0210401_10123263 | All Organisms → cellular organisms → Bacteria | 2430 | Open in IMG/M |
| 3300021080|Ga0210382_10545981 | Not Available | 514 | Open in IMG/M |
| 3300021171|Ga0210405_10129247 | All Organisms → cellular organisms → Bacteria | 1996 | Open in IMG/M |
| 3300021344|Ga0193719_10012453 | All Organisms → cellular organisms → Bacteria | 3581 | Open in IMG/M |
| 3300021401|Ga0210393_11115072 | Not Available | 637 | Open in IMG/M |
| 3300021406|Ga0210386_11475674 | Not Available | 568 | Open in IMG/M |
| 3300021407|Ga0210383_11115009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300021420|Ga0210394_10848258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
| 3300021432|Ga0210384_10786075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 849 | Open in IMG/M |
| 3300021478|Ga0210402_11233682 | Not Available | 675 | Open in IMG/M |
| 3300021560|Ga0126371_10023440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5714 | Open in IMG/M |
| 3300021560|Ga0126371_13275633 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300024288|Ga0179589_10438981 | Not Available | 601 | Open in IMG/M |
| 3300025509|Ga0208848_1042981 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300025900|Ga0207710_10057399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1758 | Open in IMG/M |
| 3300025906|Ga0207699_10398185 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300025910|Ga0207684_10003772 | All Organisms → cellular organisms → Bacteria | 14644 | Open in IMG/M |
| 3300025915|Ga0207693_10617786 | Not Available | 843 | Open in IMG/M |
| 3300025916|Ga0207663_10505310 | Not Available | 939 | Open in IMG/M |
| 3300025927|Ga0207687_10434430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1086 | Open in IMG/M |
| 3300025961|Ga0207712_12131499 | Not Available | 501 | Open in IMG/M |
| 3300026281|Ga0209863_10055371 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300026304|Ga0209240_1055869 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
| 3300026312|Ga0209153_1005001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4144 | Open in IMG/M |
| 3300026351|Ga0257170_1028809 | Not Available | 746 | Open in IMG/M |
| 3300026514|Ga0257168_1000586 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3908 | Open in IMG/M |
| 3300026551|Ga0209648_10019147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5984 | Open in IMG/M |
| 3300027651|Ga0209217_1046927 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300027651|Ga0209217_1180363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300027660|Ga0209736_1155714 | Not Available | 606 | Open in IMG/M |
| 3300027727|Ga0209328_10100951 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300027846|Ga0209180_10060282 | All Organisms → cellular organisms → Bacteria | 2109 | Open in IMG/M |
| 3300027874|Ga0209465_10589921 | Not Available | 551 | Open in IMG/M |
| 3300027884|Ga0209275_10463783 | Not Available | 719 | Open in IMG/M |
| 3300027889|Ga0209380_10009668 | All Organisms → cellular organisms → Bacteria | 5647 | Open in IMG/M |
| 3300027894|Ga0209068_10000083 | All Organisms → cellular organisms → Bacteria | 56073 | Open in IMG/M |
| 3300027894|Ga0209068_10015578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3657 | Open in IMG/M |
| 3300027894|Ga0209068_10372095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300027910|Ga0209583_10782950 | Not Available | 506 | Open in IMG/M |
| 3300028047|Ga0209526_10215331 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300028047|Ga0209526_10357231 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300029636|Ga0222749_10039143 | All Organisms → cellular organisms → Bacteria | 2051 | Open in IMG/M |
| 3300030991|Ga0073994_10051369 | Not Available | 1423 | Open in IMG/M |
| 3300031231|Ga0170824_125874587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1028 | Open in IMG/M |
| 3300031474|Ga0170818_101706552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300031708|Ga0310686_108813543 | Not Available | 1343 | Open in IMG/M |
| 3300031720|Ga0307469_10015587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3938 | Open in IMG/M |
| 3300031720|Ga0307469_11415301 | Not Available | 663 | Open in IMG/M |
| 3300031753|Ga0307477_10021465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4411 | Open in IMG/M |
| 3300031753|Ga0307477_10208672 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
| 3300031754|Ga0307475_10346390 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300031754|Ga0307475_10489778 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300031771|Ga0318546_10935550 | Not Available | 610 | Open in IMG/M |
| 3300032180|Ga0307471_101214048 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300032205|Ga0307472_100931860 | Not Available | 807 | Open in IMG/M |
| 3300032205|Ga0307472_102236187 | Not Available | 552 | Open in IMG/M |
| 3300032770|Ga0335085_10000642 | All Organisms → cellular organisms → Bacteria | 92819 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.53% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.24% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.47% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.47% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.29% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.12% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.53% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.35% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.18% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.18% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.18% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.18% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.18% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.59% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.59% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.59% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.59% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.59% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.59% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.59% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908043 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2 | Environmental | Open in IMG/M |
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010857 | Boreal forest soil eukaryotic communities from Alaska, USA - W1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015087 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6A, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A2_c1_00227280 | 2124908043 | Soil | MAQVIEFYIPARFKPKVKWIPLEQRGKILAFPVDLKKSA |
| deeps_02948310 | 2199352024 | Soil | RVWRDRRMAMAQVIEFYIPSRFKSRVKWIPSERRGRVLAFPTAIKKSA |
| JGI12630J15595_100988392 | 3300001545 | Forest Soil | GRVMAQVIEFYIPERFKVKVKWIPAEQRGKIITFPTDLKKSA* |
| JGI12635J15846_106727272 | 3300001593 | Forest Soil | MAQVIEFYIPTRFKPKVKWVPVAQRGKIIVFPTDLKKSA* |
| C688J18823_100255504 | 3300001686 | Soil | MMKLWRVWRDRRMAMAQVIEFYIPSRFKPRVKWIPSDRRGRVIAFPAAIKKSA* |
| JGIcombinedJ26739_1003656952 | 3300002245 | Forest Soil | MAQVIEFYIPERFKVKVKWXPAEQRGKIITFPTDLKKSA* |
| JGIcombinedJ26739_1008104362 | 3300002245 | Forest Soil | MAQVIEFYIPARFKQKVKWIPPEQRGKIIAFPTDLKKSA* |
| JGIcombinedJ26739_1008927882 | 3300002245 | Forest Soil | MAQVIEFYIPARFKPKVKWVPVEQRGKILVFPAELKKSA* |
| C688J35102_1202805532 | 3300002568 | Soil | MAQVIEFYIPSRFKAKVKWIPLEQRGKIIAFPIDFKKSA* |
| JGI25615J43890_10219992 | 3300002910 | Grasslands Soil | MARVIEFYIPARFKPKAKREIQEQRGKVIAFPSDLKKPA* |
| Ga0062595_1000004606 | 3300004479 | Soil | MAQVIEFYIPTRFQRRMKWVPPTQRGKILQFPGELKKSA* |
| Ga0062595_1000249952 | 3300004479 | Soil | MAQVIEFYIPARFKPKVKWVPLEQRGKILLFSADLKKSA* |
| Ga0062595_1013754092 | 3300004479 | Soil | VILQYEGWTAVDRRMVMAEVIEFYIPARFKQKVRWIPPEQRGKVIAFPTELKKSA* |
| Ga0062595_1022566542 | 3300004479 | Soil | MAQVIEFYIPTRFKPKVRWIPAEQRGKLLAFPTDLKKSA* |
| Ga0066677_103868461 | 3300005171 | Soil | MAHVIEFYIPARFNTKPKGVTQEKRGKVIAFPSDRKKSA* |
| Ga0066680_100322514 | 3300005174 | Soil | MAHVIEFYIPARFSTKPKGVTQEKRGKVIAFPSDRKKSA* |
| Ga0066673_100204082 | 3300005175 | Soil | MAQVIEFYIPASFKRKVKWIPAEQRGKIIFFPSDLKKSA* |
| Ga0066673_100687134 | 3300005175 | Soil | DRRGDMAQVIEFYIPTRFQRRMKWVPPTQRGKILQFPGELKKSA* |
| Ga0066690_109064102 | 3300005177 | Soil | ETCLIALDRRVVMAQVIEFYVPAKFHKKVKWVPPEQRGRMIEFPAEIKKSA* |
| Ga0066678_102412362 | 3300005181 | Soil | MAYVIEFYIPARFSTKPKGVTQEKRGKVIAFPSDRKKSA* |
| Ga0065715_106672421 | 3300005293 | Miscanthus Rhizosphere | MMEEVRWTAVDRRMVMAQVIEFYIPARFKPKVKWVPLEQRGKILLFSADLKKSA* |
| Ga0066388_1009308422 | 3300005332 | Tropical Forest Soil | MAQVIEFYIPERFKKRVKWVPAENRGKVLSFPVDIKKTA* |
| Ga0066388_1055506541 | 3300005332 | Tropical Forest Soil | MLFRIRGFMAQVIEFYIPTRFKQKVKWIPPQERGKIIDSPSQLNKWA* |
| Ga0066388_1057936351 | 3300005332 | Tropical Forest Soil | MAQVIEFYVPARFQRKVKWIPPTQRGKILQFPGELKRSA* |
| Ga0066388_1073570381 | 3300005332 | Tropical Forest Soil | MAQVIEFYIPTRFKQKVKWVPPEQRGKIIDFPSDLKKSA* |
| Ga0070709_102088442 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEVIEFYIPARFKQKVRWIPPEQRGKVIAFPTELKKSA* |
| Ga0070713_1022705051 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MVMAEVIEFYIPARFKQKVRWIPPEQRGKVIAFPTELKKSA* |
| Ga0070710_107473602 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MMEEVRWTAVDRRMVMAQVIEFYIPARFKPKVKWVPLEQRGKILLFSTDLKKSA* |
| Ga0070711_1007805921 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQVIEFYIPARFKPRMKWIPPEQRGKIITFPTDLKKSA* |
| Ga0070708_1000083862 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQVIEFYIPASFKSKVKWIPPEQRGKVITFPTDLKKSA* |
| Ga0066686_100435034 | 3300005446 | Soil | MAHVIEFYIPARFKTKPKGVTQEQRGKVIAFPSDRKKSA* |
| Ga0070706_1020165951 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VAHVIEFYIPARFKTKPKGVTQEQRGKVIAFPSDRKKSA* |
| Ga0070698_1002254692 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VAHVIEFYIPARFKTKPKGVTQEQRGKVIAFPADRKKSA* |
| Ga0070697_1002938391 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MMEEVRWTAVDRRMVMAQVIEFYIPARFKPKVKWLPLEQRGKIILFPTDLKKSA* |
| Ga0070762_103910542 | 3300005602 | Soil | MAHVIEFYIPARFKTKPNGATQEQREKVIAFPSDRKKSA* |
| Ga0070762_108507941 | 3300005602 | Soil | MAPVIEFYIPARFKPKVKWVPQEQPEKVIAFPSDLKKSA* |
| Ga0070763_100859213 | 3300005610 | Soil | MAPVIEFYIPARFKPKVKWVPQEQREQVIAFPSDLKKSA* |
| Ga0070763_102939541 | 3300005610 | Soil | MAHVIQFYIPTRFKQKVKWVPQEQRGKIIAFPSDLKKSA* |
| Ga0068856_1005934292 | 3300005614 | Corn Rhizosphere | MAQVIEFYIPSRFKAKEKWIPLEQRGKIIAFPIDFKKSA* |
| Ga0066903_1002705502 | 3300005764 | Tropical Forest Soil | MAQVIEFYIPARFQRRVKWVPPAQRGKILQFPGELKKSA* |
| Ga0066903_1020587852 | 3300005764 | Tropical Forest Soil | MALVIEFYIPKRFKQKVKWVPPQERGKIIDFPSDLKKSA* |
| Ga0068863_1025015492 | 3300005841 | Switchgrass Rhizosphere | MAQVIEFYIPSRFKAKVKWIPLEQRGKVIAFPIDFKKSA* |
| Ga0080027_100851952 | 3300005993 | Prmafrost Soil | MAQVIEYYIPTRFKPKAKWVPAEQRGKIIVFPTDLKKSA* |
| Ga0070717_106891751 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VDRRMVMAEVIEFYIPARFKQKVRWIPPEQRGKVIAFPTELKKSA* |
| Ga0066656_101727482 | 3300006034 | Soil | MAHVIVFYIPARFKTKPKGVTQEQRGKVIAFPSDRKKSA* |
| Ga0075028_1000012154 | 3300006050 | Watersheds | MAQVIEFYIPARFKSKVKWIPLEQRGKILSFPADLKKSA* |
| Ga0075028_1003205752 | 3300006050 | Watersheds | MAQVIEFYIPARFKPKVKWIPLEQRGKILAFPVDLKKSA* |
| Ga0075028_1003803302 | 3300006050 | Watersheds | MAQVIEFYIPATFKQKVKWIPPEQRGKIISFPADLKKSA* |
| Ga0075028_1009967001 | 3300006050 | Watersheds | MAQVIEFYIPSRFKVKVKWIPLEQRGKIIAFPVDFKKSA* |
| Ga0075017_1007999411 | 3300006059 | Watersheds | EYYIPTRFKPKVKWVPAEQRGKIIVFPTDLKKSA* |
| Ga0075030_1000430754 | 3300006162 | Watersheds | MAQLIEFYIPARFKPKVKWVPVEQRGKIIAFPTDLKKSA* |
| Ga0075018_104196611 | 3300006172 | Watersheds | MMKEAKRAAVDRRMVMAQVIEFYIPSRFKPKIKWVSMEQRGKIIAFPTDLKKSA* |
| Ga0070712_1008699562 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQVIEFYIPARFKPRIKWIPPEQRGKIITFPTDLKKSA* |
| Ga0070712_1012518391 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MMEEVRWTAVDRRMVMAQVIEFYIPTRFKPKVKWIPVEQRGRIIAFPADLKKSA* |
| Ga0070765_1000018483 | 3300006176 | Soil | MAWEIEFHVPTSFKPKAKWVPQDQRGKIIAFTPDLKKSA* |
| Ga0070765_1007470712 | 3300006176 | Soil | MDRRMVMAQVIEFYIPARFKQKVKWIPPEQRGKIIAFPTDLKKSA* |
| Ga0099829_100063122 | 3300009038 | Vadose Zone Soil | MAQVIEFYIPARFKPKVKWMPLEQRGKILWFPADLKKSA* |
| Ga0099829_108639902 | 3300009038 | Vadose Zone Soil | MAQVIEFYIPTRFKPKVKWTPPEQRGKILAFAADLKKSA* |
| Ga0099830_101000732 | 3300009088 | Vadose Zone Soil | MAQVIEFYIPARFKPKVKWIPLEQRGKILWFPADLKKSA* |
| Ga0099828_106060852 | 3300009089 | Vadose Zone Soil | MAHVIEFYIPARFKTKPKGVTQEQRGKVIAFTSYRKKSA* |
| Ga0105245_103867621 | 3300009098 | Miscanthus Rhizosphere | MAQVIEFYIPARFKPKVKWIPPEQRGKILAFPVDLKKSA* |
| Ga0126374_101452961 | 3300009792 | Tropical Forest Soil | MAQVIEFYIPTRFKQKVKWVPQGQRGRIIAFRSDFKKS |
| Ga0126384_103382042 | 3300010046 | Tropical Forest Soil | MAQVIEFYIPARFKQKVKWVPPEQRGKIIDFPSDLKKSA* |
| Ga0126384_105887531 | 3300010046 | Tropical Forest Soil | VRLFRRSEDVMAQVIEFYIPTRFKQKVKWVPQGQRGRIIVFRSDLKRSA* |
| Ga0126382_107697811 | 3300010047 | Tropical Forest Soil | MKLWHVWRDRRMVMARVIEFYIPDRFKPRVKWIPREQRGRVIAFPGVIRKSA* |
| Ga0126373_100426832 | 3300010048 | Tropical Forest Soil | MAQVIEFYIPTRFKQKVKWVPQGQRGRIIAFRSDFKKSA* |
| Ga0126373_101090032 | 3300010048 | Tropical Forest Soil | MAQVIEFYIPMRFKQKMKWVPQQQRGKIIDFPSKLKKSA* |
| Ga0126373_114846061 | 3300010048 | Tropical Forest Soil | QVIEFYIPTRFKQKVKWVPPEQRGKIIDFPSDLKKSA* |
| Ga0126373_130477461 | 3300010048 | Tropical Forest Soil | MAQVIEIYIPPGFKRKMKWVPPEQRGKIIVFPSDLKKSA* |
| Ga0126370_100410961 | 3300010358 | Tropical Forest Soil | MAQVIEFYIPTRFKQKVKWVPQGQRGRIIVFRSDLKRSA* |
| Ga0126370_102083982 | 3300010358 | Tropical Forest Soil | VRPFRRSEDVMAQVIEFYIPTRFKQKVKWVPQRQRGRIIAFRSDFKKSA* |
| Ga0126370_121771681 | 3300010358 | Tropical Forest Soil | LWNVYEMARLIEFYIPGRFQRKVKWIPPNQRGKLIEFFVKKSA* |
| Ga0126376_127168651 | 3300010359 | Tropical Forest Soil | MAQVIEFYIPARFKQKVKWVPPERRGKIIDFPSDLKKSA* |
| Ga0126372_101160792 | 3300010360 | Tropical Forest Soil | MAQVIEFYIPARFKQNVKWVPPEQRGKIIDFPSDLKKSA* |
| Ga0126372_110327791 | 3300010360 | Tropical Forest Soil | MAQVIEFYIPARFQRRVKWVPPAQRGKILQFPGELKKS |
| Ga0126379_1000048921 | 3300010366 | Tropical Forest Soil | MAQVIEFYIPTRFKQKVKWVPQRQRGRIIAFRSDFKKSA* |
| Ga0126379_107912682 | 3300010366 | Tropical Forest Soil | MAQVIEFYIPERFKKRVKWVPAENRGKVLSFPIDIKKTA* |
| Ga0105239_103413572 | 3300010375 | Corn Rhizosphere | CLMAQVIEFYIPSRFKAKVKWIPLEQRGKVIAFPIDFKKSA* |
| Ga0126381_1001530032 | 3300010376 | Tropical Forest Soil | MAHVIEFYIPARFKLKVKWVPREQRGKIIAFRSDLKKSA* |
| Ga0126381_1007709922 | 3300010376 | Tropical Forest Soil | IEFYIPMRFNQKMKWVPQQQRGKIIDFPSKLKKSA* |
| Ga0134121_130531392 | 3300010401 | Terrestrial Soil | MAQVIEFYIPARFKPKVKWIPPEQRGKILTFPVDLKKSA* |
| Ga0126354_10421281 | 3300010857 | Boreal Forest Soil | KPGAVMMEEVRWTAVDRRMVMAQVIEFYIPARFKPKVKWVPLEQRGKILLFPTDLKKSA* |
| Ga0137391_102238221 | 3300011270 | Vadose Zone Soil | MVMAQVIELYIPARFKPKVKWVPVEQRGKIIAFPTDLKKSA* |
| Ga0137391_102858763 | 3300011270 | Vadose Zone Soil | AQVIEFYIPVSFKPKVKWVPQEERGKVIAFPPELKKSA* |
| Ga0137391_105186082 | 3300011270 | Vadose Zone Soil | MAQVIEFYTPPRFKPKVKWIPPEQRGKILAFPTELKKSA* |
| Ga0137391_109094301 | 3300011270 | Vadose Zone Soil | MMKEAKRAAVDRRMVMAQVIEFYIPSRFKRKVKWVPMEQRGKIIAFPTDLKKSA* |
| Ga0137388_106388192 | 3300012189 | Vadose Zone Soil | RTAVDRRMVMAQVIEFYIPARLKPKVKWVPVEQRGKIIAFPTDLKKSA* |
| Ga0137388_108159263 | 3300012189 | Vadose Zone Soil | MAHIIEFYIPARFKTKPKGATQEQRGKVIAFPSDRKKS |
| Ga0137388_112645351 | 3300012189 | Vadose Zone Soil | MAQVIEFYIRARFKQKVKWIPPEQRGKIISFPADLKKSA* |
| Ga0137363_103960182 | 3300012202 | Vadose Zone Soil | MVMAQVIEFYIPARFKQKVKWIPPEQRGKIIEFPADLKKSA* |
| Ga0137376_115111782 | 3300012208 | Vadose Zone Soil | VKRVGVLLFSDRRVEMAQVIEFYIPARFHKKVKWIPPEQRGKVIDFPAEIRKSA* |
| Ga0137379_104797432 | 3300012209 | Vadose Zone Soil | MAMAQVIEFYIPSRFKPKVKWIPSDRRGRVIAFPAAIKKSA* |
| Ga0137379_106783242 | 3300012209 | Vadose Zone Soil | MARVIEFYVPAGFQRKSKWISPDERGKILEFPLAVKRTA* |
| Ga0137390_100729881 | 3300012363 | Vadose Zone Soil | MAQVIGFYIPTRFKPKVQWIPPEQRGKILAFPTELKKSA* |
| Ga0137397_101969161 | 3300012685 | Vadose Zone Soil | MMKEAKRAAVDRRMVMAQVIEFYIAARFKPKVKWVPVEQRGKIIAFPTDLKKSA* |
| Ga0137413_104959432 | 3300012924 | Vadose Zone Soil | MAQVIEFYIPASYRPKVKWIPPERRGKVIEFRADLKKSA* |
| Ga0137407_100009746 | 3300012930 | Vadose Zone Soil | MDRRLIMAQVIEFYIPTRFKQKVKWVPMEQRGKILSFPVDFKKSA* |
| Ga0137407_105633662 | 3300012930 | Vadose Zone Soil | MAQVIEFYIPKRFKPKVKWIPPEQRGKILVFPTDLKKSA* |
| Ga0164299_101685732 | 3300012958 | Soil | MAQVIEFYIPAGFRAKVKWIPPEQRGKILAFPVDLKKSA* |
| Ga0164309_108336842 | 3300012984 | Soil | MAQVIEFYIPSRFKPKVKWVPVEQRGKILLFSTDLKKSA* |
| Ga0157378_102141643 | 3300013297 | Miscanthus Rhizosphere | AQVIEFYIPARFKPKVKWIPPEQRGKILTFPVDLKKSA* |
| Ga0157376_113081391 | 3300014969 | Miscanthus Rhizosphere | QVIEFYIPSRFKPKVKWIPLEQRGKIIAFPIDFKKSA* |
| Ga0167637_10143202 | 3300015087 | Glacier Forefield Soil | MVMAQVIEYYIPTRFKPKVKWVPAEQRGKIIVFPADLKKSA* |
| Ga0163161_115610052 | 3300017792 | Switchgrass Rhizosphere | MAQVIEFYIPSRFKAKEKWIPLEQRGKIIAFPIDFKKSA |
| Ga0187776_110435402 | 3300017966 | Tropical Peatland | MVMAQAIEFYISARFKPKVKWVPEEMRGKILVFPADLKKSA |
| Ga0187823_100103413 | 3300017993 | Freshwater Sediment | MAQVIEFYIPTRFKQKVKWIPPEQRGKVIAFPTDLKKSA |
| Ga0066662_100548073 | 3300018468 | Grasslands Soil | MAYVIEFYIPARFSTKPKGVTQEKRGKVIAFPSDRKKSA |
| Ga0066669_102374572 | 3300018482 | Grasslands Soil | MAQVIEFYIPASFKRKVKWIPAEQRGKIIFFPSDLKKSA |
| Ga0193729_12262982 | 3300019887 | Soil | MVMAQVIEFYIPARFKQKVKWIPPEQRGKIIEFPTDLKKSA |
| Ga0193751_10300603 | 3300019888 | Soil | MAQVIEFYTPGSFKPKAKWVPQEQRGRVIAFPSELKKSA |
| Ga0193751_10334183 | 3300019888 | Soil | MAHIEFYIPARFKTKPKGVTQEQRGKVIAFPSDRKKSA |
| Ga0179592_103900601 | 3300020199 | Vadose Zone Soil | MAQVIEFYIPASYRPKVKWIPPERRGKVIEFRADLKKSA |
| Ga0210407_100713402 | 3300020579 | Soil | MAQVIEFYIPARFKQKVKWIPPEQRGKIIAFPTDLKKSA |
| Ga0210401_101232632 | 3300020583 | Soil | MAQVIEFYIAVDRRMVMAQVIEFYIPARFKQKVKWIPPEQRGKIIAFPTDLKKSA |
| Ga0210382_105459812 | 3300021080 | Groundwater Sediment | VDRRLDMAQVIEFYVPTRFKPKVKWIPPEQRGKILVFPTDLKKSA |
| Ga0210405_101292473 | 3300021171 | Soil | MDRRMVMAQVIEFYIPARFKQKVKWIPPEQRGKIIAFPTDLKKSA |
| Ga0193719_100124533 | 3300021344 | Soil | MAPVIEFYIPASFKPKVKWIPAEQRGKILAFPTDLKKSA |
| Ga0210393_111150722 | 3300021401 | Soil | MVMAQVIEFYIPARFKQKVKWIPPEQRGKIIAFPTDLKKSA |
| Ga0210386_114756741 | 3300021406 | Soil | CNEEDRRGFMAQVIEFYIPTRFTATVRWVPEKERGKVLTFPTDLEKSA |
| Ga0210383_111150091 | 3300021407 | Soil | VILQEEGWAAMDRRMVMAQVIEFYIPARFKQKVKWIPPEQRGKIIAFPTDLKKSA |
| Ga0210394_108482581 | 3300021420 | Soil | MAQVIEFYIPARFKQKVKWIPPEQRGKIIAFPTDLK |
| Ga0210384_107860752 | 3300021432 | Soil | MAQVIEFYIPARFKPKVKWVPVEQRGKILEFPADMKKSA |
| Ga0210402_112336822 | 3300021478 | Soil | MAQVIEFYIPSRYKQKVKWVPPELRGKIIAFPADLKKSA |
| Ga0126371_100234406 | 3300021560 | Tropical Forest Soil | MAQVIEFYIPTRFKQKVRWVPQRQRGRIIAFRSDFKKSA |
| Ga0126371_132756331 | 3300021560 | Tropical Forest Soil | NMAQVIEFYIPARFQRRVKWVPPAQRGKILQFPGELKKSA |
| Ga0179589_104389811 | 3300024288 | Vadose Zone Soil | MAEVIEFYIPTRFKPKVKWIPPELRGKVIEFPTELKKSA |
| Ga0208848_10429812 | 3300025509 | Arctic Peat Soil | MAQVIEYYIPTRFKPKVKWVPAEQRGKIIVFPTDLKKSA |
| Ga0207710_100573992 | 3300025900 | Switchgrass Rhizosphere | MAQVIEFYIPARFKPKVKWVPLEQRGKILLFSTDLKKSA |
| Ga0207699_103981852 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MVMAEVIEFYIPARFKQKVRWIPPEQRGKVIAFPTELKKSA |
| Ga0207684_1000377216 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQVIEFYIPASFKSKVKWIPPEQRGKVITFPTDLKKSA |
| Ga0207693_106177862 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MMEEVRWTAVDRRMVMAQVIEFYIPARFKPKVKWIPVEQRGRIIAFPADLKKSA |
| Ga0207663_105053102 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VDRRRVMAQVIEFYIPARFKPRMKWIPPEQRGKIITFPTDLKKSA |
| Ga0207687_104344302 | 3300025927 | Miscanthus Rhizosphere | MAQVIEFYIPSRFKAKVKWIPLEQRGKVIAFPIDFKKSA |
| Ga0207712_121314991 | 3300025961 | Switchgrass Rhizosphere | MAQVIEFYIPTRFKPKVKWVPPEQRGKILAFPTDLK |
| Ga0209863_100553711 | 3300026281 | Prmafrost Soil | MAQVIEYYIPTRFKPKAKWVPAEQRGKIIVFPTDLKKSA |
| Ga0209240_10558692 | 3300026304 | Grasslands Soil | MARVIEFYIPARFKPKAKREIQEQRGKVIAFPSDLKKPA |
| Ga0209153_10050011 | 3300026312 | Soil | MAQVIEFYIPTRFQRRMKWVPPTQRGKILQFPGELKKSA |
| Ga0257170_10288091 | 3300026351 | Soil | MVMAQVIEFYIPARFKPKVKWIPLEQRGKILWFPADLKKSA |
| Ga0257168_10005864 | 3300026514 | Soil | VAHVIEFYIPARFKTKPKGVTQEQRGKVIAFPSDRKKSA |
| Ga0209648_100191476 | 3300026551 | Grasslands Soil | VAHVIEFYIPARFKTKPKGMTQEQRGKVIAFPSDRKKSA |
| Ga0209217_10469272 | 3300027651 | Forest Soil | MAQVIEFYIPSRFKPKVKWVPVEQRGKILVFPAELKKSA |
| Ga0209217_11803631 | 3300027651 | Forest Soil | MAQVIEFYIPERFKVKVKWIPAEQRGKIITFPTDLKKSA |
| Ga0209736_11557141 | 3300027660 | Forest Soil | MVMAQVIEFYIPTRFKPKVKWVPVAQRGKIIVFPTDLKKSA |
| Ga0209328_101009511 | 3300027727 | Forest Soil | MAQVIEFYIPTRFKPKVKWVPVAQRGKIIAFPTDLKKSA |
| Ga0209180_100602821 | 3300027846 | Vadose Zone Soil | MAQVIEFYIPARFKPKVKWIPLEQRGKILWFPADLKKSA |
| Ga0209465_105899211 | 3300027874 | Tropical Forest Soil | VWRDRRMVMARVIEFYIPDRFKPRVKWIPREQRGRVIAFPGVIRKSA |
| Ga0209275_104637831 | 3300027884 | Soil | MAPVIEFYIPARFKPKVKWVPQEQPEKVIAFPSDLKKSA |
| Ga0209380_100096682 | 3300027889 | Soil | MAPVIEFYIPARFKPKVKWVPQEQREQVIAFPSDLKKSA |
| Ga0209068_1000008314 | 3300027894 | Watersheds | MAQVIEFYIPARFKSKVKWIPLEQRGKILSFPADLKKSA |
| Ga0209068_100155781 | 3300027894 | Watersheds | MAQVIEFYIPATFKQKVKWIPPEQRGKIISFPADLKKSA |
| Ga0209068_103720951 | 3300027894 | Watersheds | MMKEAKRAAVDRRMVMAQVIEFYIPSRFKPKIKWVSMEQRGKIIAFPTDLKKSA |
| Ga0209583_107829501 | 3300027910 | Watersheds | VMAQVIEFYIPARFKSKVKWIPLEQRGKILSFPADLKKSA |
| Ga0209526_102153313 | 3300028047 | Forest Soil | MARVIEFYIPARFKVNVKWIPPEQRGKIITFPTDLKKSA |
| Ga0209526_103572311 | 3300028047 | Forest Soil | MAQVIEFYIPTRFKPKVKWVPVAQRGKIIVFPTDLKKSA |
| Ga0222749_100391431 | 3300029636 | Soil | AVILQEEGWAAMDRRMVMAQVIEFYIPARFKQKVKWIPPEQRGKIIAFPTDLKKSA |
| Ga0073994_100513692 | 3300030991 | Soil | MAQVIEFYIHARFKPRVKWVPQEQRGKVVEFPSELKQSA |
| Ga0170824_1258745871 | 3300031231 | Forest Soil | MAQVIEFYIPSRFKSKAKWIPAELRGKVLTFPANLKKP |
| Ga0170818_1017065522 | 3300031474 | Forest Soil | MAQVIEFYIPSRFKSKVKWIPAELRGKVLTFPANLKK |
| Ga0310686_1088135432 | 3300031708 | Soil | MAPVIEFYIPARFKPKVKWMPQEQCEQVIASPSDLKKSA |
| Ga0307469_100155876 | 3300031720 | Hardwood Forest Soil | DRRLVMAQVIEFYIPTRFKPKVRWIPAEQRGKLLAFPTDLKKSA |
| Ga0307469_114153011 | 3300031720 | Hardwood Forest Soil | MAQVIEFYIPVRFKPKVKWVPVEQRGKILAFPTDLKKSA |
| Ga0307477_100214656 | 3300031753 | Hardwood Forest Soil | MAQVIEIYIPARFKTKPKGVSREQRGKVIAFPSDRKKSA |
| Ga0307477_102086722 | 3300031753 | Hardwood Forest Soil | MAQVIEFYIPTRFKQKVKWVPQEQRGKIVALPSDLKK |
| Ga0307475_103463902 | 3300031754 | Hardwood Forest Soil | MAEVIEFYIPARFKPKVKWIPLEQRGKVLSFPTDLKKSA |
| Ga0307475_104897782 | 3300031754 | Hardwood Forest Soil | MAQVIEFYIPTRFKQKVKWVPQEQRGKIVALPSDLKKSA |
| Ga0318546_109355501 | 3300031771 | Soil | MAYVIEFYVPARFKPKAKCAPEQRGKLIAFPSDAKKRFRSFLASV |
| Ga0307471_1012140482 | 3300032180 | Hardwood Forest Soil | MAQVIEFYIPTRFKPKVKWTPPEQRGKVLAFPADLKKSA |
| Ga0307472_1009318602 | 3300032205 | Hardwood Forest Soil | MAQVIEFYIPARFKPKVKWVPVEQRGKILEFPAAMKKSA |
| Ga0307472_1022361871 | 3300032205 | Hardwood Forest Soil | MDRRMDGSEDDMAQVIEYYIPARFKPKVKWVPVEQRGKILEFPADLKKSA |
| Ga0335085_1000064235 | 3300032770 | Soil | MAQVIEFYIPTRFKPKVKWVPAEQRGKILVFPTDLKKSA |
| ⦗Top⦘ |