NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F036283

Metagenome / Metatranscriptome Family F036283

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F036283
Family Type Metagenome / Metatranscriptome
Number of Sequences 170
Average Sequence Length 47 residues
Representative Sequence MWFELILAAALIVLYVAFWAWHSQGAGKLTQAEIDQYLAIIEKLPLP
Number of Associated Samples 139
Number of Associated Scaffolds 170

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 96.47 %
% of genes near scaffold ends (potentially truncated) 98.24 %
% of genes from short scaffolds (< 2000 bps) 93.53 %
Associated GOLD sequencing projects 131
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (63.529 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(11.765 % of family members)
Environment Ontology (ENVO) Unclassified
(28.235 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.882 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.67%    β-sheet: 0.00%    Coil/Unstructured: 53.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 170 Family Scaffolds
PF00561Abhydrolase_1 18.82
PF12697Abhydrolase_6 15.88
PF00271Helicase_C 1.76
PF00211Guanylate_cyc 1.76
PF00672HAMP 1.18
PF02878PGM_PMM_I 1.18
PF13576Pentapeptide_3 1.18
PF13924Lipocalin_5 1.18
PF01914MarC 0.59
PF08332CaMKII_AD 0.59
PF00903Glyoxalase 0.59
PF13548DUF4126 0.59
PF02880PGM_PMM_III 0.59
PF07045DUF1330 0.59
PF00270DEAD 0.59
PF03544TonB_C 0.59
PF01272GreA_GreB 0.59
PF01548DEDD_Tnp_IS110 0.59

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 170 Family Scaffolds
COG0033Phosphoglucomutase/phosphomannomutaseCarbohydrate transport and metabolism [G] 1.76
COG1109PhosphomannomutaseCarbohydrate transport and metabolism [G] 1.76
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 1.76
COG0782Transcription elongation factor, GreA/GreB familyTranscription [K] 0.59
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.59
COG2095Small neutral amino acid transporter SnatA, MarC familyAmino acid transport and metabolism [E] 0.59
COG3547TransposaseMobilome: prophages, transposons [X] 0.59
COG4875Protein kinase association domain CaMKII_AD, NTF2-like superfamilyPosttranslational modification, protein turnover, chaperones [O] 0.59
COG5470Uncharacterized conserved protein, DUF1330 familyFunction unknown [S] 0.59


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms67.06 %
UnclassifiedrootN/A32.94 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_17195145All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1735Open in IMG/M
3300000443|F12B_11017730All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium626Open in IMG/M
3300000550|F24TB_10622108All Organisms → cellular organisms → Bacteria1340Open in IMG/M
3300000890|JGI11643J12802_10205586All Organisms → cellular organisms → Bacteria1427Open in IMG/M
3300000955|JGI1027J12803_100138035All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300000955|JGI1027J12803_100408623All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium3117Open in IMG/M
3300000956|JGI10216J12902_111279234All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300001991|JGI24743J22301_10056930All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium802Open in IMG/M
3300004114|Ga0062593_101769879All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300004463|Ga0063356_106388090All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium505Open in IMG/M
3300005093|Ga0062594_100699867Not Available914Open in IMG/M
3300005166|Ga0066674_10559933All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium507Open in IMG/M
3300005179|Ga0066684_10939150All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium562Open in IMG/M
3300005180|Ga0066685_10312473All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Halobacteriales → Halobacteriaceae → Halomarina → Halomarina salina1089Open in IMG/M
3300005289|Ga0065704_10020058All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1632Open in IMG/M
3300005289|Ga0065704_10091727All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter2697Open in IMG/M
3300005290|Ga0065712_10607123All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium570Open in IMG/M
3300005295|Ga0065707_10710267All Organisms → cellular organisms → Bacteria → Acidobacteria635Open in IMG/M
3300005329|Ga0070683_100601550Not Available1052Open in IMG/M
3300005331|Ga0070670_101098378All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300005344|Ga0070661_101594614All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → alpha proteobacterium Mf 1.05b.01552Open in IMG/M
3300005435|Ga0070714_101728104Not Available611Open in IMG/M
3300005439|Ga0070711_101599723All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300005439|Ga0070711_102048912All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300005445|Ga0070708_101057498Not Available760Open in IMG/M
3300005450|Ga0066682_10920842All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium520Open in IMG/M
3300005451|Ga0066681_10362590All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300005455|Ga0070663_101265237All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300005457|Ga0070662_101898154All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium515Open in IMG/M
3300005467|Ga0070706_101835706All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300005467|Ga0070706_101901527All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium540Open in IMG/M
3300005535|Ga0070684_101463650All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium643Open in IMG/M
3300005556|Ga0066707_10406277Not Available886Open in IMG/M
3300005558|Ga0066698_11095876All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium504Open in IMG/M
3300005561|Ga0066699_10289719Not Available1164Open in IMG/M
3300005566|Ga0066693_10002561All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia4396Open in IMG/M
3300005576|Ga0066708_10128297All Organisms → cellular organisms → Bacteria1537Open in IMG/M
3300005578|Ga0068854_101934367All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium543Open in IMG/M
3300005713|Ga0066905_102312456All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium503Open in IMG/M
3300005764|Ga0066903_102906510All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium929Open in IMG/M
3300005764|Ga0066903_103710752Not Available821Open in IMG/M
3300005764|Ga0066903_105532691All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300005764|Ga0066903_107865914All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Halobacteriales → Halobacteriaceae → Halomarina → Halomarina salina548Open in IMG/M
3300005764|Ga0066903_108304215Not Available531Open in IMG/M
3300005842|Ga0068858_100927469All Organisms → cellular organisms → Bacteria852Open in IMG/M
3300005843|Ga0068860_102716230All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium514Open in IMG/M
3300005937|Ga0081455_10472096All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Halobacteriales → Halobacteriaceae851Open in IMG/M
3300005937|Ga0081455_11060670All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium501Open in IMG/M
3300006237|Ga0097621_102200300All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium527Open in IMG/M
3300006796|Ga0066665_10007470All Organisms → cellular organisms → Bacteria6094Open in IMG/M
3300006852|Ga0075433_11925630All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium507Open in IMG/M
3300006871|Ga0075434_100295460All Organisms → cellular organisms → Bacteria1640Open in IMG/M
3300006881|Ga0068865_100758985All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium834Open in IMG/M
3300009137|Ga0066709_101121084All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1157Open in IMG/M
3300009137|Ga0066709_103607525All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium561Open in IMG/M
3300009148|Ga0105243_10142943All Organisms → cellular organisms → Bacteria2044Open in IMG/M
3300009174|Ga0105241_10879261Not Available831Open in IMG/M
3300009553|Ga0105249_13176486Not Available528Open in IMG/M
3300010038|Ga0126315_10882672Not Available593Open in IMG/M
3300010043|Ga0126380_11987259All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium532Open in IMG/M
3300010047|Ga0126382_12100219All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium541Open in IMG/M
3300010048|Ga0126373_10291193Not Available1624Open in IMG/M
3300010321|Ga0134067_10248661All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium669Open in IMG/M
3300010322|Ga0134084_10167971All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium749Open in IMG/M
3300010322|Ga0134084_10208992All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium687Open in IMG/M
3300010322|Ga0134084_10263511All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium627Open in IMG/M
3300010326|Ga0134065_10426502All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium538Open in IMG/M
3300010329|Ga0134111_10569419All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium504Open in IMG/M
3300010333|Ga0134080_10357128Not Available667Open in IMG/M
3300010358|Ga0126370_12379451Not Available526Open in IMG/M
3300010361|Ga0126378_11355703All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium805Open in IMG/M
3300010364|Ga0134066_10057225All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1021Open in IMG/M
3300010366|Ga0126379_11804436Not Available716Open in IMG/M
3300010366|Ga0126379_12717443All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300010366|Ga0126379_12888049All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium575Open in IMG/M
3300010375|Ga0105239_12470682All Organisms → cellular organisms → Bacteria → Acidobacteria605Open in IMG/M
3300010376|Ga0126381_104630611All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium530Open in IMG/M
3300010398|Ga0126383_11230028Not Available839Open in IMG/M
3300012198|Ga0137364_10592176All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium835Open in IMG/M
3300012198|Ga0137364_10988032All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium637Open in IMG/M
3300012199|Ga0137383_10623540Not Available788Open in IMG/M
3300012199|Ga0137383_11024229All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium601Open in IMG/M
3300012202|Ga0137363_10113826All Organisms → cellular organisms → Bacteria2076Open in IMG/M
3300012202|Ga0137363_10566080Not Available958Open in IMG/M
3300012202|Ga0137363_11259619All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300012205|Ga0137362_11097956All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium676Open in IMG/M
3300012205|Ga0137362_11704509All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium517Open in IMG/M
3300012285|Ga0137370_10128824All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1449Open in IMG/M
3300012350|Ga0137372_11051542All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300012353|Ga0137367_10295322All Organisms → cellular organisms → Bacteria1160Open in IMG/M
3300012354|Ga0137366_10131057All Organisms → cellular organisms → Bacteria1891Open in IMG/M
3300012895|Ga0157309_10287952All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium550Open in IMG/M
3300012901|Ga0157288_10422907Not Available504Open in IMG/M
3300012923|Ga0137359_10974110All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium729Open in IMG/M
3300012961|Ga0164302_10094645All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1633Open in IMG/M
3300012971|Ga0126369_10634131Not Available1141Open in IMG/M
3300012975|Ga0134110_10046985All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1700Open in IMG/M
3300012977|Ga0134087_10280484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli774Open in IMG/M
3300012987|Ga0164307_10541414All Organisms → cellular organisms → Bacteria → Acidobacteria887Open in IMG/M
3300012988|Ga0164306_10271865All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Halobacteriales → Halobacteriaceae → Halomarina → Halomarina salina1224Open in IMG/M
3300014326|Ga0157380_11885528Not Available658Open in IMG/M
3300014968|Ga0157379_12144471Not Available554Open in IMG/M
3300015077|Ga0173483_10874937Not Available526Open in IMG/M
3300015242|Ga0137412_10091583All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2472Open in IMG/M
3300015265|Ga0182005_1041524Not Available1250Open in IMG/M
3300015356|Ga0134073_10339147All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium549Open in IMG/M
3300015357|Ga0134072_10360850All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium561Open in IMG/M
3300015359|Ga0134085_10091357Not Available1257Open in IMG/M
3300015371|Ga0132258_12956770Not Available1179Open in IMG/M
3300015372|Ga0132256_103007311Not Available567Open in IMG/M
3300015373|Ga0132257_104289342Not Available519Open in IMG/M
3300015373|Ga0132257_104332298Not Available516Open in IMG/M
3300018028|Ga0184608_10049788Not Available1646Open in IMG/M
3300018072|Ga0184635_10179474Not Available845Open in IMG/M
3300018072|Ga0184635_10410114Not Available511Open in IMG/M
3300018076|Ga0184609_10415999Not Available623Open in IMG/M
3300018431|Ga0066655_10158923All Organisms → cellular organisms → Bacteria1352Open in IMG/M
3300018431|Ga0066655_11135928All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium549Open in IMG/M
3300018433|Ga0066667_10082782All Organisms → cellular organisms → Bacteria2073Open in IMG/M
3300018433|Ga0066667_12242500All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium509Open in IMG/M
3300019362|Ga0173479_10034763Not Available1556Open in IMG/M
3300019362|Ga0173479_10882551Not Available504Open in IMG/M
3300020006|Ga0193735_1099572Not Available811Open in IMG/M
3300020018|Ga0193721_1089796All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300020062|Ga0193724_1009973All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2021Open in IMG/M
3300020199|Ga0179592_10245998All Organisms → cellular organisms → Bacteria → Acidobacteria804Open in IMG/M
3300020199|Ga0179592_10338892All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium663Open in IMG/M
3300021363|Ga0193699_10042484All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1737Open in IMG/M
3300022694|Ga0222623_10325446Not Available589Open in IMG/M
3300022899|Ga0247795_1104744All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium507Open in IMG/M
3300025165|Ga0209108_10461579All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300025290|Ga0207673_1007596Not Available1362Open in IMG/M
3300025910|Ga0207684_11533928All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium541Open in IMG/M
3300025915|Ga0207693_10702587Not Available783Open in IMG/M
3300025922|Ga0207646_11121082Not Available692Open in IMG/M
3300025925|Ga0207650_11603140Not Available552Open in IMG/M
3300025929|Ga0207664_11411921All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium617Open in IMG/M
3300025930|Ga0207701_10128869All Organisms → cellular organisms → Bacteria2252Open in IMG/M
3300025939|Ga0207665_10309536Not Available1183Open in IMG/M
3300026023|Ga0207677_11802084All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium568Open in IMG/M
3300026312|Ga0209153_1254047All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium566Open in IMG/M
3300026323|Ga0209472_1065285All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1516Open in IMG/M
3300026374|Ga0257146_1084959All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium517Open in IMG/M
3300026536|Ga0209058_1212364All Organisms → cellular organisms → Archaea770Open in IMG/M
3300026542|Ga0209805_1086977All Organisms → cellular organisms → Bacteria1504Open in IMG/M
3300027876|Ga0209974_10061788Not Available1268Open in IMG/M
3300028709|Ga0307279_10109301All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium523Open in IMG/M
3300028819|Ga0307296_10145797Not Available1277Open in IMG/M
3300028875|Ga0307289_10229249Not Available764Open in IMG/M
3300028878|Ga0307278_10259515Not Available771Open in IMG/M
3300030854|Ga0075385_11512998Not Available1122Open in IMG/M
3300030855|Ga0075374_10032113Not Available596Open in IMG/M
3300030967|Ga0075399_10002711All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300031057|Ga0170834_109836697Not Available1600Open in IMG/M
3300031231|Ga0170824_100595067Not Available1545Open in IMG/M
3300031231|Ga0170824_118894286Not Available583Open in IMG/M
3300031231|Ga0170824_119779843Not Available995Open in IMG/M
3300031231|Ga0170824_119980317All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1051Open in IMG/M
3300031469|Ga0170819_13612523All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium606Open in IMG/M
3300031469|Ga0170819_17683985All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300031474|Ga0170818_104352626All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium532Open in IMG/M
3300031474|Ga0170818_107606318Not Available546Open in IMG/M
3300031545|Ga0318541_10655316All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium587Open in IMG/M
3300031910|Ga0306923_11092398All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium860Open in IMG/M
3300031910|Ga0306923_11188707Not Available816Open in IMG/M
3300031947|Ga0310909_11598439All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium517Open in IMG/M
3300032075|Ga0310890_10501326All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Halobacteriales → Halobacteriaceae → Halomarina → Halomarina salina923Open in IMG/M
3300032205|Ga0307472_101569414Not Available645Open in IMG/M
3300032261|Ga0306920_101468427Not Available975Open in IMG/M
3300033412|Ga0310810_10195480All Organisms → cellular organisms → Bacteria2293Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil11.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil7.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.47%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil5.29%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.29%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.53%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.53%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.76%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.76%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.18%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.18%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.18%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.18%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere1.18%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.18%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.18%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.18%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.18%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.18%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.18%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.18%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.18%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.18%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.59%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.59%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.59%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.59%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.59%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.59%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.59%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.59%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.59%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.59%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.59%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.59%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000443Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemlyEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001991Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2Host-AssociatedOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015265Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaGHost-AssociatedOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300020062Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300025165Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1EnvironmentalOpen in IMG/M
3300025290Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026374Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-AEnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300027876Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300028709Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300030854Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030855Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030967Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_021596202088090014SoilMWFELILAAAFVILYAGFWAWHSQGAGKLTRAEIDQYLAIIEKLP
F12B_1101773013300000443SoilSAERHKFRKETKMWFELILAAALVVLYVAFSAWYSQGAGKLTQAEIDHYLGIIEKLPLPEKG
F24TB_1062210813300000550SoilVWFELILAVALMVLYVAFWAWHSQGAGKLTQAEIDQY
JGI11643J12802_1020558613300000890SoilMWFEFILAAALVILYVAFWAWHSQGAGKLTQAEIDQYLAIIEKLPLPEK
JGI1027J12803_10013803523300000955SoilMWFELSFAAVLVILYLAFLAWHSQGGGKLTQAEIDRYVAIIEKLP
JGI1027J12803_10040862313300000955SoilMWFELILAAAFVILYAGFWAWHSQGAGKLTRAEIDQYLAIIEKLPLP
JGI10216J12902_11127923433300000956SoilMWFELILAAALLLLYLAFWAWHSQGAGKLTQAEID
JGI24743J22301_1005693023300001991Corn, Switchgrass And Miscanthus RhizosphereMWFDLILAAALAILYVAFWVWHSQGAGKLTQTEIDQYLAIIEKLPLPEKGVHA
Ga0062593_10176987913300004114SoilMWFELILAAALVVLYVAFWAWHSQGAGKLTQPEIDQYIAIIEKLPLPEKGVQAFTAR
Ga0063356_10638809023300004463Arabidopsis Thaliana RhizosphereMWFELILAAAFVVLYVTFWAWHSQGAGKLTQAEIDQYLAIIE
Ga0062594_10069986723300005093SoilMKMWFELIFAAVLVILYLAFLAWHSQGRGKLTQAEINQYV
Ga0066674_1055993313300005166SoilMWFELILAAALIVLYVAFWAWHSQGAGKLTQAEIDQYLAIIEKLP
Ga0066684_1093915033300005179SoilMWFELILAATLMVLYVAFWAWHSQGAGKLTQVEIDQYLAIIEKLPLPEKG
Ga0066685_1031247323300005180SoilMWFELILAATFVILYVIFWAWHSQGAGKLTQSEIDRYLAIIEKLPLPEKGVQAF
Ga0065704_1002005843300005289Switchgrass RhizosphereMWFELILAAALMVLYLAFWAWHSQGAGKLTQAEIDQYLAIIEKLPLPEKGVQAFTARLRPWA
Ga0065704_1009172713300005289Switchgrass RhizosphereMWFEFILAAALVILYVAFWAWHSQGAGKLTQAEIDQYLAIIEKLPLPEKG
Ga0065712_1060712313300005290Miscanthus RhizosphereMWFELILAAALMVLYVAFWAWHSQGAGKLTQVEIDQYLAIIEKLPLPEKGVQAFIARLRP
Ga0065707_1071026723300005295Switchgrass RhizosphereMWFEVIFAAVLVILYLAFVAWHSQGGGKLTEAEIDQYITNIEKLP
Ga0070683_10060155023300005329Corn RhizosphereMWVEFILAVALTILYIAFWAWHSQGAGKLTQAEIDQYLAIIEKLPLPEK
Ga0070670_10109837823300005331Switchgrass RhizosphereMWFDLILAAALAILYVAFWVWHSQGAGKLTQTEIDQYLAIIEKLPLPEK
Ga0070661_10159461413300005344Corn RhizosphereMWFDLILAAALAILYVAFWVWHSQGAGKLTQTEIDQYLAIIEKLPLPEKGVHAF
Ga0070714_10172810423300005435Agricultural SoilMWFELIFAAVLVTLYLAFLAWHSQGSGKLTQAEIDQYVANIEKLPLPEKAVQAFI
Ga0070711_10159972313300005439Corn, Switchgrass And Miscanthus RhizosphereMWFELILAAALMVLYVVFWAWHSQGGGKLTQAEIDQYLTMIEKLPLPEKAVQAF
Ga0070711_10204891223300005439Corn, Switchgrass And Miscanthus RhizosphereMWFELILAAVLVSLYLAFWAWHSQGRGKLTQAEIDQYLAII
Ga0070708_10105749833300005445Corn, Switchgrass And Miscanthus RhizosphereMWFELILAAVLATLYVAFWAWHSQGAGKLTQAEIDRYLAIIEKLPLPEKG
Ga0066682_1092084213300005450SoilVLYVAFWAWHSQGAGKLTHAEIDQYLAIIEKLPLPEKGVQAFIARLRP*
Ga0066681_1036259023300005451SoilMWFELILAAALVVLYVVFWAWHSQGAGKLTQAEIDQYLAIIEKL
Ga0070663_10126523723300005455Corn RhizosphereMWFDLILAAALAILYVAFWVWHSQGAGKLTQTEIDQYLAIIEKL
Ga0070662_10189815423300005457Corn RhizosphereMWFELILAAALMFLYVAFWAWHSQGAGKLTQAEIDQYLAIIEKLPLP
Ga0070706_10183570613300005467Corn, Switchgrass And Miscanthus RhizosphereMLFELILAAALLVLYLAFWAWHSQGAGKLTQAEIDQYLAIIEKLPLP
Ga0070706_10190152713300005467Corn, Switchgrass And Miscanthus RhizosphereMWFELILAAVLATLYVAFWAWHSQGAGKLTQAEIDRYLAIIEKLPLP
Ga0070684_10146365023300005535Corn RhizosphereMWFELILAAVLVILYLVFQAWHSQGGGKLTQGEIDQYLAIIEKLPLPEKAVEAFIARLRPWAEA
Ga0066707_1040627723300005556SoilMWFELILAAALVVLYMAFWAWHSQGASKLTQAEIDQYIAIIEKLPLPEKGV
Ga0066698_1109587623300005558SoilMSFELILAAALVILYVAFSAWHSQGAGKLTQAEIDRYLAII
Ga0066699_1028971913300005561SoilMSFELILAAALVILYVAFWAWHSQGAGKLTQAEIDRYL
Ga0066693_1000256163300005566SoilMWFELILAAGLVILYVAFWVWYSQGAGKLTQAEIDHYLAIIEKLPLPEKGVQVFIARL
Ga0066708_1012829713300005576SoilVWSELILAVVIILYVAFWAWHSQGAGKLTQAEIDRYLA
Ga0068854_10193436713300005578Corn RhizosphereMWFELILAAALMFLYVAFWAWHSQGAGKLTQAEIDQYLAIIEKLPLPGKGAEAFTARLRPWAE
Ga0066905_10231245623300005713Tropical Forest SoilMWFELILAAAFVILYVVFWAWHSQGAGKLTQQEIDHYVAIIERLPLPEKAVRAFIARLRPWAEA
Ga0066903_10290651033300005764Tropical Forest SoilMWFDVILAAAFVILYVAFWAWHSQGAGKLTQAEIDQY
Ga0066903_10371075223300005764Tropical Forest SoilMWFELILAAVFVILYVAFSAWHSQGAGKLTQAEIDQ
Ga0066903_10553269123300005764Tropical Forest SoilMWFEFILAAALVIMYVAFWAWHSQGAGKLTQAEIDQY
Ga0066903_10786591423300005764Tropical Forest SoilMWFELILAVTFAALYMAFSAWHSQGAGKLTQAEIDEYLARIEK
Ga0066903_10830421513300005764Tropical Forest SoilMWFELILAAVFVILYVAFWLWHSQGAGKLTQAEIDRYLAI
Ga0068858_10092746923300005842Switchgrass RhizosphereMWFDLILAAALAILYVAFWVWHSQGAGKLTQTEIDQYLAIIEKLPLPEKG
Ga0068860_10271623013300005843Switchgrass RhizosphereMWFELILAAALVIAYVAFWAWHSQGAGKLTQAEIDQYLAIIEKLPLPGKGG*
Ga0081455_1047209633300005937Tabebuia Heterophylla RhizosphereMWFEFILAAALMILYVAFWAWHSQGAGKLTQAEIDQYLAIIEKL
Ga0081455_1106067013300005937Tabebuia Heterophylla RhizosphereMWFEFIFAAALVILYVAFWAWHSQGAGKLTQAEIDQYLASIEKLPLPEKRVQEF
Ga0097621_10220030013300006237Miscanthus RhizosphereMWFELILAAALVILYVAFWSWHSQGAGKLTQAEIDHYLAIIEKLPLPEKGVQAFIARL
Ga0066665_1000747083300006796SoilMSFELILAAALVILYVAFWVWHSQGAGKLTQAEIDRYLAIIEKLP
Ga0075433_1192563023300006852Populus RhizosphereMWFELILATALVILYVAFWAWHRQGAGKLTPAEID
Ga0075434_10029546013300006871Populus RhizosphereMWFELILAAVLVILYLAFCAWHSQGGGKLTQAEVDQYVTS
Ga0068865_10075898523300006881Miscanthus RhizosphereMWFEFILAAALVILYVAFWAWHSQGAGKLTQAEIDQYLAIIEKLPLP
Ga0066709_10112108413300009137Grasslands SoilMWFELILAAALIVLYVAFWAWHSQGAGKLTQAEIDQY
Ga0066709_10360752523300009137Grasslands SoilMWFDLILAAALMVLYVAFWAWHSQGAGKLTQAEIDQYLAIIEKLPLPEK
Ga0105243_1014294313300009148Miscanthus RhizosphereMWFEFILAAALVILYVAFWAWHSQGAGKLTQAEIDQYLAMIEKLPL
Ga0105241_1087926113300009174Corn RhizosphereMWFELTLAAVLVSLYLAFWAWHSQGRGKLTQAEIDQYVAIIEKLPLPEKAVQ
Ga0105249_1317648623300009553Switchgrass RhizosphereMLFELILAAAFVILYVAFWAWHSQGAGKLTQAEIDQ
Ga0126315_1088267223300010038Serpentine SoilMWFELILAAALAILYLAFWGWHSQGTGKLSQGEINE
Ga0126380_1198725913300010043Tropical Forest SoilMWFELILAAVLVILYLVFWAWHSQGSGKLTQAEIDQYVAKTEKLPL
Ga0126382_1210021923300010047Tropical Forest SoilMWFELILAAAFVILYVAFWAWHSQGAGKLTQTEIDQYLAIIQRLPLPEKGVQAF
Ga0126373_1029119323300010048Tropical Forest SoilMWFELILAAALVIVYVAFWAWHSQGAGKLTQAEIDQY
Ga0134067_1024866133300010321Grasslands SoilMWFELILAAALVVLYMAFWAWHSQGASKLTQAEIDPYIAIIEKLP
Ga0134084_1016797113300010322Grasslands SoilMWFELILAAALIVLYVAFWAWHSQGAGKLTQAEIDQYLAIIEKLPLP
Ga0134084_1020899223300010322Grasslands SoilMWFELILAAALMVSYVVFWAWHSQGAGKLTQAEIDQYLAIIEKLPLPEKGLHGFTARLRPWAEAD
Ga0134084_1026351123300010322Grasslands SoilMWFEFILAAVFVILYVAFWAWHSQGAGKLTQAEID
Ga0134065_1042650223300010326Grasslands SoilMWFELILAAALMVLYVAFWAWHSQGAGKLTQVEIDQYLAIIEKLPLPEKGIQ
Ga0134111_1056941913300010329Grasslands SoilMWFELILAAALMVSYVVFWAWHSQGAGKLTQEEIDQYLAIIEKLPLPGKGVQAFTARLRSWAEADGGK
Ga0134080_1035712813300010333Grasslands SoilMWFELILAAALMVSYVVFWAWHSQGAGKLTQAEIDQ
Ga0126370_1237945123300010358Tropical Forest SoilMLFEIIFFAVLVVLYVAFLAWHSQGAGKLTQAEIDQYVAIIEELPLPKKAVQAFTARLRP
Ga0126378_1135570313300010361Tropical Forest SoilMWFDVILAAAFVILYVAFWAWHSQGAGKLTQAEIDQYL
Ga0134066_1005722523300010364Grasslands SoilMWFELILAAALIVLYVAFWAWHSQGAGKLTQAEID
Ga0126379_1180443613300010366Tropical Forest SoilMWFEFILAAALMVLYVAFRAWHSQGAGKLTQAEIDQYLAIIEKLPLPENGVQAFIARLRP
Ga0126379_1271744313300010366Tropical Forest SoilMWFEFILAAALVILYVAFRAWHSQGAGKLTHAEIDQYLAIIEKLPLPEQRVQEFT
Ga0126379_1288804913300010366Tropical Forest SoilMWFELILAAAFVVLYVAVWVWHSQGAGKLTQAEIDQYL
Ga0105239_1247068223300010375Corn RhizosphereMWFEIIFAAVLVILYLAFVAWHSQGGGKLTEAEIDQYI
Ga0126381_10463061113300010376Tropical Forest SoilMWFELILAAVFVILYVAFSAWHSQGAGKLTQAEIDHYL
Ga0126383_1123002813300010398Tropical Forest SoilMSFELILAAGLTILYVAFWAWHSQGAGKLTQAEIDRYLAIIEKLPLPEKGV
Ga0137364_1059217623300012198Vadose Zone SoilMWSELILAAAVIILYVAFWAWHSQGAGKLTQAEID
Ga0137364_1098803223300012198Vadose Zone SoilMWFELILAAALNSLYVVFWARHSQGAGKLTQPKSDEYMTISEKLKMAE
Ga0137383_1062354033300012199Vadose Zone SoilMSFELILAAALVILYVAFWAWHSQGAGKLTQAEIDRYLAIIEKLPLPEKGV
Ga0137383_1102422913300012199Vadose Zone SoilMWSELILAAAVIILYVAFWAWHSQGAGKLTQAEIDRYLAIIEKLP
Ga0137363_1011382643300012202Vadose Zone SoilMWFELILAAALMVSYVVFWAWHSQGAGKLTQAEIDQYL
Ga0137363_1056608023300012202Vadose Zone SoilMWFELILAVALMVLYMAFWAWHSQGAGKLTQAEIDHYLALIEKLPLPES
Ga0137363_1125961913300012202Vadose Zone SoilMWFELILAAVLTLLYLAFWAWHSQGAGKLTQAEIDQYLPMIEK
Ga0137362_1109795613300012205Vadose Zone SoilMWFELILAAALLVLYVAFWAWHSQGAGKLTQAEID
Ga0137362_1170450913300012205Vadose Zone SoilMWFELILAAVLTLLYLAFWAWHSQGAGKLTRAEIDQYLPMIEKLPLPEKG
Ga0137370_1012882413300012285Vadose Zone SoilMWFDLILAAALMVLYVAFWAWHSQGAGKLTQAEIDQYLAIIEKLPLP
Ga0137372_1105154213300012350Vadose Zone SoilMWFELILAAAFVVLNVAFWAWHSQGAGKLTQAEID
Ga0137367_1029532223300012353Vadose Zone SoilMWFELILAAALLVLYVAFWAWHSQGAGKLTQAEIDQY
Ga0137366_1013105743300012354Vadose Zone SoilMWFELILAAALVVLYVVFWAWHSQGAGKLTQAEIDQY
Ga0157309_1028795223300012895SoilMWFELILAAALVILYVAFWSWHSQGAGKLTQAEIDHYLAIIEKLPLPEK
Ga0157288_1042290713300012901SoilMWFELVLAAALVVLYVAFSAWHSQGAGKLTQAEIDHYLGIIEK
Ga0137359_1097411033300012923Vadose Zone SoilMWFDLILAAALMVLYVAFWAWHFQGAGKLTHAEIDQ
Ga0164302_1009464513300012961SoilMWFELTLAAVLVSLYLAFSAWHSQGRGKLTQAEIDQYLAIIEKLPLPEKAVQAFI
Ga0126369_1063413113300012971Tropical Forest SoilMWFELIVVAVLVILYLAFWAWHSQGSGKLTQGEIDQYVANIEKLPLPEKAVQAFITRLRS
Ga0134110_1004698533300012975Grasslands SoilMWFELILAAAVVILYMAFSVWHSQGAGKLTQAEIDQYLAIIE
Ga0134087_1028048423300012977Grasslands SoilVVIILYVAFWAWHSQGAGKLTQAEIDRYLAMIEKLPLPEKGIQGFIARLRSWA
Ga0164307_1054141423300012987SoilMWFELTLAAVLVSLYLAFWAWHSQGRGKLTQAEIDQYLAIIEKLPLPEKAVQAFIARLRPWAE
Ga0164306_1027186523300012988SoilMWFELTLAAVLVSLYLVFWAWHSQGRGKLTQAEIDQYLAIIEKLPLPEKAVQAFIARLRPWAEA
Ga0157380_1188552813300014326Switchgrass RhizosphereMWFDLILAAALAILYVAFWVWHSQGAGKLTQTEIDQYLAI
Ga0157379_1214447113300014968Switchgrass RhizosphereMWFELILAAVLVILYLAFWAWHSQGGGKLTQAEIDQYLAAIEKLPLPE
Ga0173483_1087493713300015077SoilMWFELILAAALVIVYVAFWAWHSQGAGKLTQAEIDQYLAMIEKLP
Ga0137412_1009158343300015242Vadose Zone SoilMWFELTLAAVLVSLYLAFWAWHSQGRGKLTQAEIDQYLAIIEK
Ga0182005_104152413300015265RhizosphereMWFELILAAALVILYLAFWAWHSQGAGKLSQAEIDRYLAM
Ga0134073_1033914723300015356Grasslands SoilMWFEFILAAVFVILYVAFWAWHSQGAGKLTQVEIDQYLAIIEKLPLPEKGVQAFIARLRP
Ga0134072_1036085013300015357Grasslands SoilMWFELILAAALVILYVAFSAWHSQGAGKLTQAEIDRYLAIIEKLPLPEKRVQAFIARLRPWAEAD
Ga0134085_1009135713300015359Grasslands SoilMWFELILAAALMVSYVVFWAWHSQGAGKLTQAEIDQYLAIIEKLP
Ga0132258_1295677013300015371Arabidopsis RhizosphereMWFELILAAALAIVYLAFWAWHSQGAGKLTQAEIDR
Ga0132256_10300731113300015372Arabidopsis RhizosphereMWFELILAAALMVLYVAFWAWHSQGGGKLTQAEIDQY
Ga0132257_10428934213300015373Arabidopsis RhizosphereMWFEFILAAALLILYVAFWVWHSQGAGKLTHAEIDQYLAIIEKLPL
Ga0132257_10433229823300015373Arabidopsis RhizosphereMWFELILAGVLVILYLAFWAWHSQGSGKLTQAEIDQYVANIEKLPLPEKAVQAFITRLR
Ga0184608_1004978833300018028Groundwater SedimentMWFELILAAALVVLYVAFWAWHSQGAGKLTQEEIDQYI
Ga0184635_1017947423300018072Groundwater SedimentMWFELILAAVLVILYLAFLAWHSQGGGKLTQAEIDQYVAIVEK
Ga0184635_1041011423300018072Groundwater SedimentMWFELILAAALVVLYVAFWAWHSQGAGKLTQEEIDQYIAIIEKL
Ga0184609_1041599913300018076Groundwater SedimentMWFELILAAVLVILYLAFLAWHSQGRGKLTQGEIDQYAAIIEKLPLPEK
Ga0066655_1015892313300018431Grasslands SoilMWFEFILAAVFVILYVAFWAWHSQGAGKLTQAEIDHY
Ga0066655_1113592823300018431Grasslands SoilMWFELILAAAFVVLYVAFWGWHSQGAGKLTHAEIEQYLAIIEKLPLPEKAVQAFTARLRP
Ga0066667_1008278233300018433Grasslands SoilVWSELILAAAVIILYVAFWAWHSQGAGKLTQAEID
Ga0066667_1224250013300018433Grasslands SoilMWFELILAAALMVLYVAFWAWHSQGAGKLTQAEIDQYLANIEKLPLP
Ga0173479_1003476323300019362SoilMWFELSLGAVLGSLYLAFWAWHSQGSGKLTQAEIDQYVAIIEKLPLPEKAVQAFI
Ga0173479_1088255113300019362SoilMWFELILAGVLVILYLAFWAWHSQGSGKLTQAEIDQYVAN
Ga0193735_109957213300020006SoilMWFELILVAALMVLYVAFWAWHSQGAGKLTQAEIDQYLAMIE
Ga0193721_108979623300020018SoilMWFELILVAALMVLYVAFWAWHSQGAGKLTQAEIDQCLAMIEQLPLPENGV
Ga0193724_100997313300020062SoilMWFELTLAAVLVSLYLAFWAWHSQGRGKLTQAEIDQ
Ga0179592_1024599823300020199Vadose Zone SoilMWFELILAAAFVILYLAFWAWHSQGAGKLTQAEIDQY
Ga0179592_1033889223300020199Vadose Zone SoilMWFELILAAALMVLYVAFWAWHSQGAGKLTQVEIDQYLAIIEKL
Ga0193699_1004248413300021363SoilMWFELTLAAVLVSFYLAFWAWHCQGGGKLTQAEIDQYVAII
Ga0222623_1032544623300022694Groundwater SedimentMWFELILAAVLVILYLAFLAWHSQGRGKLTQAEIDQY
Ga0247795_110474423300022899SoilMWFDLILAAALAILYVAFWVWHSQGAGKLTQTEIDQYLAIIEKLPLPEKGVHAFI
Ga0209108_1046157933300025165SoilMKKHRFEIILGAALVALYLVFAGWHAQWGGKLTQAEI
Ga0207673_100759633300025290Corn, Switchgrass And Miscanthus RhizosphereMWFEVIFTAVLVILYLAFVAWHSQGGGKLTEAEID
Ga0207684_1153392823300025910Corn, Switchgrass And Miscanthus RhizosphereMWFELILAAAFVVLYVTFWAWHSQGAGKLTQAEIDQYLA
Ga0207693_1070258723300025915Corn, Switchgrass And Miscanthus RhizosphereMWFELISVAVLVILYLAFWAWHSQGAGKLTQAEIDQYIAIIEKLPLP
Ga0207646_1112108213300025922Corn, Switchgrass And Miscanthus RhizosphereMWFELILAAALMVLYVAFWAWHSQGAGKLTQAEIDQYLAIIEKLPLPEKGVQAF
Ga0207650_1160314013300025925Switchgrass RhizosphereMWVEFILAVALTILYIAFWAWHSQGAGKLTQAEIDQYLAIIEKLPLPEKGVQAFTSRLRP
Ga0207664_1141192123300025929Agricultural SoilMWFELILAAALMVLYVAFWAWHSQGAGKLTQVEIDQYLAIIEKLPLPEKGVQ
Ga0207701_1012886913300025930Corn, Switchgrass And Miscanthus RhizosphereMWFELILAAALMFLYVAFWAWHSQGAGKLTQAEIDQYLAIIE
Ga0207665_1030953613300025939Corn, Switchgrass And Miscanthus RhizosphereMWFELILAAALVVLYVAFSAWHSQGAGKLTQAEIDHYLSII
Ga0207677_1180208413300026023Miscanthus RhizosphereMWFELILAAALMFLYVAFWAWHSQGAGKLTQAEIDQYLAIIEKLPLPGKGVEAFTARLRPWAE
Ga0209153_125404723300026312SoilMWFELILAAALMVLYVAFWAWHSQGAGKLTQAEIDQYLANIEKLPLPGKGVQAFTA
Ga0209472_106528513300026323SoilMWFELILAAALIVLYVAFWAWHSQGAGKLTQAEIDQYLAIIEKLPLPE
Ga0257146_108495913300026374SoilMWFELILAAVLTLLYLAFWAWHSQGAGKLTQAEIDQYLAMIEKVPLPEK
Ga0209058_121236433300026536SoilMWFELILAAALVVLYAAFWVWHSQGAGKLTQAEIDQYLAIIEKLPL
Ga0209805_108697733300026542SoilMWFELILAAALMVLYVAFWAWHSQGAGKLTQAEIDRYLAIIEKLPLPEKGVQAF
Ga0209974_1006178813300027876Arabidopsis Thaliana RhizosphereMWFELILAAALLVLYVAFSAWHSQGAGKLTQAEIDHYLSIIEKLPLPEKGVQAFTARLRP
Ga0307279_1010930113300028709SoilMWFELILATASVIAYLAFWAWHSQGAGKLTQAEIDRYLAIIEKLPLPDKGVQAFIARLRP
Ga0307296_1014579713300028819SoilMWFELILAAALVVLYVAFWAWHSQGAGKLTPAEIDQYLAIIERLP
Ga0307289_1022924913300028875SoilMWFELILAAALVIVYVAFWAWHSQGAGKLTQAEIDRYLAIIE
Ga0307278_1025951523300028878SoilMWFELILAAALVVLYVAFWAWHSQGAGKLTQAEIDQYLAIIEKLPLPEKGVQA
Ga0075385_1151299823300030854SoilMWFELILAAALMVLYVAFWAWHSQGAGKLTHAEIDHYVAIIEKLPLPEKAVQAFIARLRPWAEA
Ga0075374_1003211313300030855SoilMWFELILAAAFVILYVAFWAWHSQGAGKLTQAEIDQYLA
Ga0075399_1000271123300030967SoilMWFELILATALMVLYLAFWAWHSQGAGKLTQAEIDQ
Ga0170834_10983669733300031057Forest SoilMWFELILAAALMVSYVVFWAWHSQGAGKLTQAEIDQYLAIIE
Ga0170824_10059506723300031231Forest SoilMWFELILAAVLVILYLAFWAWHSQGSGKLTQAEIDQYV
Ga0170824_11889428613300031231Forest SoilMWFELILAAALMVSYVVFWAWHSQGAGKLTQAEIDQY
Ga0170824_11977984313300031231Forest SoilMWFELTLAAVLVSLYLAFCAWHSQGRGKLTQAEID
Ga0170824_11998031713300031231Forest SoilMWFELILAAALMVLYLAFWAWHSQGAGKLTQVEIDQYLAIIEKLPLPEKG
Ga0170819_1361252313300031469Forest SoilMWFELILAAVLMVLYLAFWVWHSQGAGKLTQAEIDQYLAMIEKLPLPEKGVQEFTARQNTWAEA
Ga0170819_1768398523300031469Forest SoilMWFELILAAALMVLYVAFWAWHSQGGGKLTQAEIDQYVA
Ga0170818_10435262623300031474Forest SoilMWFELILAAALMVLYVAFWAWHSQGAGKLTQAEIDKYLAIIEKLPLPEKGVQAFTA
Ga0170818_10760631813300031474Forest SoilMWFELTLAAALMVLYAAFWAWHSQGGGKLTQAEIDQYVAIIEKLPLPEKAVQA
Ga0318541_1065531613300031545SoilMWFEFILAAALTVLYVAFCVWHSQGAGKLTQGEIDRYLAIIEKLPL
Ga0306923_1109239813300031910SoilMWFEFILAAALTVLYVAFCVWHSQGAGKLTQGEIDRYLAIIEKLPLPKERVQEFTARLRPWAEAD
Ga0306923_1118870723300031910SoilMWFELILAVAFVILYVAFWGWHSQGAGKLTEAEIDQYLARLAK
Ga0310909_1159843913300031947SoilMWFELILAAAFVVLYVTFWAWHSQGAGKLTQAEIDQYLAIIEKLPLPEK
Ga0310890_1050132623300032075SoilMWFELILAAALIVLYVVFWAWHSQGAGTLTQAEIDQYIAIVEKLPLPEKAVQAF
Ga0307472_10156941413300032205Hardwood Forest SoilMWFELILAAALVVLYVVFWAWHSQGAGKLTQAEIDQYLA
Ga0306920_10146842713300032261SoilMWFELILAAVLVILYLAFWAWHSQGSGKLTQAEIDQYVANIEKLPLPEKAVQAFITRLRS
Ga0310810_1019548013300033412SoilMWFELILAAALMVLYVAFWAWHSQGVGKLTQAEIDQYLAMIERLPLPEK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.