Basic Information | |
---|---|
Family ID | F036252 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 170 |
Average Sequence Length | 41 residues |
Representative Sequence | RHLKNYRGKVTALSGQEQLELDAAAALEKPLPLLDKASA |
Number of Associated Samples | 152 |
Number of Associated Scaffolds | 170 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.41 % |
% of genes from short scaffolds (< 2000 bps) | 88.24 % |
Associated GOLD sequencing projects | 144 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.35 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (84.118 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.765 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.647 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.765 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.90% β-sheet: 0.00% Coil/Unstructured: 79.10% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 170 Family Scaffolds |
---|---|---|
PF04014 | MazE_antitoxin | 18.24 |
PF01850 | PIN | 6.47 |
PF04012 | PspA_IM30 | 5.29 |
PF01370 | Epimerase | 5.29 |
PF13738 | Pyr_redox_3 | 2.94 |
PF15975 | Flot | 1.76 |
PF03739 | LptF_LptG | 1.18 |
PF08282 | Hydrolase_3 | 1.18 |
PF00132 | Hexapep | 1.18 |
PF09720 | Unstab_antitox | 1.18 |
PF07238 | PilZ | 1.18 |
PF09722 | Xre_MbcA_ParS_C | 1.18 |
PF00535 | Glycos_transf_2 | 1.18 |
PF13211 | DUF4019 | 1.18 |
PF08281 | Sigma70_r4_2 | 1.18 |
PF14833 | NAD_binding_11 | 1.18 |
PF08808 | RES | 0.59 |
PF00112 | Peptidase_C1 | 0.59 |
PF04397 | LytTR | 0.59 |
PF00743 | FMO-like | 0.59 |
PF12911 | OppC_N | 0.59 |
PF01765 | RRF | 0.59 |
PF01120 | Alpha_L_fucos | 0.59 |
PF12146 | Hydrolase_4 | 0.59 |
PF01609 | DDE_Tnp_1 | 0.59 |
PF00588 | SpoU_methylase | 0.59 |
PF00135 | COesterase | 0.59 |
PF02646 | RmuC | 0.59 |
PF01569 | PAP2 | 0.59 |
PF13200 | DUF4015 | 0.59 |
PF08544 | GHMP_kinases_C | 0.59 |
PF06210 | DUF1003 | 0.59 |
COG ID | Name | Functional Category | % Frequency in 170 Family Scaffolds |
---|---|---|---|
COG1842 | Phage shock protein A | Transcription [K] | 10.59 |
COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 1.18 |
COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 1.18 |
COG0795 | Lipopolysaccharide export LptBFGC system, permease protein LptF | Cell wall/membrane/envelope biogenesis [M] | 1.18 |
COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 1.18 |
COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 1.18 |
COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 1.18 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.59 |
COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 0.59 |
COG5654 | Predicted toxin component of a toxin-antitoxin system, contains RES domain | Defense mechanisms [V] | 0.59 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.59 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.59 |
COG4420 | Uncharacterized membrane protein | Function unknown [S] | 0.59 |
COG3669 | Alpha-L-fucosidase | Carbohydrate transport and metabolism [G] | 0.59 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.59 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.59 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.59 |
COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.59 |
COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 0.59 |
COG1322 | DNA anti-recombination protein (rearrangement mutator) RmuC | Replication, recombination and repair [L] | 0.59 |
COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 0.59 |
COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.59 |
COG0233 | Ribosome recycling factor | Translation, ribosomal structure and biogenesis [J] | 0.59 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 84.12 % |
Unclassified | root | N/A | 15.88 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001166|JGI12694J13545_1022880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 576 | Open in IMG/M |
3300001661|JGI12053J15887_10515367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 571 | Open in IMG/M |
3300002908|JGI25382J43887_10458827 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300004091|Ga0062387_100108623 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1510 | Open in IMG/M |
3300004635|Ga0062388_102778651 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300005179|Ga0066684_10527224 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300005187|Ga0066675_11426350 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300005335|Ga0070666_10038943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3165 | Open in IMG/M |
3300005337|Ga0070682_101350924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
3300005367|Ga0070667_100464992 | Not Available | 1157 | Open in IMG/M |
3300005440|Ga0070705_100231258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1286 | Open in IMG/M |
3300005447|Ga0066689_10801092 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300005536|Ga0070697_101062918 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
3300005536|Ga0070697_101931508 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300005545|Ga0070695_101712435 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300005547|Ga0070693_101377177 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300005552|Ga0066701_10254324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1086 | Open in IMG/M |
3300005561|Ga0066699_11274481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
3300005563|Ga0068855_100207400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2204 | Open in IMG/M |
3300005575|Ga0066702_10409431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
3300005586|Ga0066691_10623202 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300005617|Ga0068859_102416095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
3300005718|Ga0068866_10036868 | All Organisms → cellular organisms → Bacteria | 2398 | Open in IMG/M |
3300005921|Ga0070766_10272694 | Not Available | 1079 | Open in IMG/M |
3300005938|Ga0066795_10179919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 630 | Open in IMG/M |
3300005995|Ga0066790_10103128 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
3300006358|Ga0068871_102020411 | Not Available | 549 | Open in IMG/M |
3300006794|Ga0066658_10186078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1088 | Open in IMG/M |
3300006881|Ga0068865_100993864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
3300007255|Ga0099791_10369231 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300009012|Ga0066710_100216474 | All Organisms → cellular organisms → Bacteria | 2742 | Open in IMG/M |
3300009012|Ga0066710_100606404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1661 | Open in IMG/M |
3300009090|Ga0099827_10380275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1205 | Open in IMG/M |
3300009098|Ga0105245_10002489 | All Organisms → cellular organisms → Bacteria | 16632 | Open in IMG/M |
3300009098|Ga0105245_10539964 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
3300009148|Ga0105243_10206036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1728 | Open in IMG/M |
3300009177|Ga0105248_10404654 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
3300009518|Ga0116128_1216623 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300009551|Ga0105238_10926542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 890 | Open in IMG/M |
3300009553|Ga0105249_10564054 | Not Available | 1190 | Open in IMG/M |
3300009628|Ga0116125_1168329 | Not Available | 613 | Open in IMG/M |
3300009639|Ga0116122_1237917 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300009644|Ga0116121_1004121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5219 | Open in IMG/M |
3300009665|Ga0116135_1120110 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 964 | Open in IMG/M |
3300009700|Ga0116217_10014561 | All Organisms → cellular organisms → Bacteria | 6371 | Open in IMG/M |
3300009760|Ga0116131_1234447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 504 | Open in IMG/M |
3300009764|Ga0116134_1113574 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
3300010048|Ga0126373_11164097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 837 | Open in IMG/M |
3300010343|Ga0074044_10204098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1312 | Open in IMG/M |
3300010361|Ga0126378_11038988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 922 | Open in IMG/M |
3300010364|Ga0134066_10309466 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300010371|Ga0134125_10552886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1273 | Open in IMG/M |
3300010371|Ga0134125_11949722 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300010371|Ga0134125_12944110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300010373|Ga0134128_10383480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1570 | Open in IMG/M |
3300010376|Ga0126381_101704820 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
3300010376|Ga0126381_102412753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
3300010379|Ga0136449_100415032 | All Organisms → cellular organisms → Bacteria | 2380 | Open in IMG/M |
3300010379|Ga0136449_103404056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
3300010397|Ga0134124_10074147 | All Organisms → cellular organisms → Bacteria | 2911 | Open in IMG/M |
3300010397|Ga0134124_12074071 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300010401|Ga0134121_11286369 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300011269|Ga0137392_10188289 | All Organisms → cellular organisms → Bacteria | 1683 | Open in IMG/M |
3300011271|Ga0137393_10493081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Gloeobacteria → Gloeobacterales → Gloeobacteraceae → Gloeobacter → Gloeobacter violaceus | 1051 | Open in IMG/M |
3300011271|Ga0137393_11579108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
3300012096|Ga0137389_10050145 | All Organisms → cellular organisms → Bacteria | 3150 | Open in IMG/M |
3300012189|Ga0137388_10171977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1935 | Open in IMG/M |
3300012189|Ga0137388_10935141 | Not Available | 801 | Open in IMG/M |
3300012202|Ga0137363_11691999 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300012203|Ga0137399_10481472 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
3300012208|Ga0137376_10477587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1082 | Open in IMG/M |
3300012351|Ga0137386_11259188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
3300012354|Ga0137366_11189053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
3300012363|Ga0137390_11499644 | Not Available | 615 | Open in IMG/M |
3300012582|Ga0137358_10293675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Gloeobacteria → Gloeobacterales → Gloeobacteraceae → Gloeobacter → Gloeobacter violaceus | 1104 | Open in IMG/M |
3300012923|Ga0137359_11579443 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300012930|Ga0137407_11994377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
3300012986|Ga0164304_11192180 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300013100|Ga0157373_10150790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1635 | Open in IMG/M |
3300013104|Ga0157370_11822174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
3300013297|Ga0157378_12980289 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300014162|Ga0181538_10448882 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300014491|Ga0182014_10262786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans | 900 | Open in IMG/M |
3300014969|Ga0157376_10464090 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
3300014969|Ga0157376_13042353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300015372|Ga0132256_100556871 | Not Available | 1259 | Open in IMG/M |
3300015373|Ga0132257_100734947 | Not Available | 1228 | Open in IMG/M |
3300016270|Ga0182036_10071810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2259 | Open in IMG/M |
3300016319|Ga0182033_10096960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2158 | Open in IMG/M |
3300016730|Ga0181515_1269594 | Not Available | 556 | Open in IMG/M |
3300017654|Ga0134069_1162835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 749 | Open in IMG/M |
3300017946|Ga0187879_10553553 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300017948|Ga0187847_10031578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3148 | Open in IMG/M |
3300017975|Ga0187782_10868379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
3300017999|Ga0187767_10387010 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
3300018001|Ga0187815_10038792 | All Organisms → cellular organisms → Bacteria | 2015 | Open in IMG/M |
3300018003|Ga0187876_1267910 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300018006|Ga0187804_10047504 | All Organisms → cellular organisms → Bacteria | 1671 | Open in IMG/M |
3300018008|Ga0187888_1035257 | All Organisms → cellular organisms → Bacteria | 2433 | Open in IMG/M |
3300018024|Ga0187881_10131764 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
3300018034|Ga0187863_10873261 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300018044|Ga0187890_10431104 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300018057|Ga0187858_10188675 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
3300018062|Ga0187784_11563767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
3300018085|Ga0187772_11374591 | Not Available | 524 | Open in IMG/M |
3300018090|Ga0187770_11423071 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300018433|Ga0066667_11619705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
3300019260|Ga0181506_1109740 | Not Available | 1126 | Open in IMG/M |
3300019275|Ga0187798_1589456 | Not Available | 630 | Open in IMG/M |
3300019284|Ga0187797_1613925 | Not Available | 607 | Open in IMG/M |
3300019787|Ga0182031_1407779 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
3300020002|Ga0193730_1023282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1790 | Open in IMG/M |
3300020199|Ga0179592_10494535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 524 | Open in IMG/M |
3300021088|Ga0210404_10234051 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
3300021181|Ga0210388_10913707 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 756 | Open in IMG/M |
3300021477|Ga0210398_11133211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
3300021559|Ga0210409_11265804 | Not Available | 613 | Open in IMG/M |
3300025917|Ga0207660_10915790 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 715 | Open in IMG/M |
3300025924|Ga0207694_10460898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1062 | Open in IMG/M |
3300025924|Ga0207694_11050580 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 689 | Open in IMG/M |
3300025927|Ga0207687_10044012 | All Organisms → cellular organisms → Bacteria | 3078 | Open in IMG/M |
3300025930|Ga0207701_10303618 | Not Available | 1386 | Open in IMG/M |
3300026023|Ga0207677_12089623 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300026294|Ga0209839_10061068 | Not Available | 1341 | Open in IMG/M |
3300026309|Ga0209055_1234056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
3300026318|Ga0209471_1038525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2283 | Open in IMG/M |
3300026332|Ga0209803_1016164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3786 | Open in IMG/M |
3300026527|Ga0209059_1306024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
3300026557|Ga0179587_10862076 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300027625|Ga0208044_1213067 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300027633|Ga0208988_1099190 | Not Available | 723 | Open in IMG/M |
3300027862|Ga0209701_10385659 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300027905|Ga0209415_10040379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6336 | Open in IMG/M |
3300027905|Ga0209415_10319522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1320 | Open in IMG/M |
3300027905|Ga0209415_10740698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
3300028800|Ga0265338_10856726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 620 | Open in IMG/M |
3300029911|Ga0311361_10325183 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
3300029915|Ga0311358_10481619 | Not Available | 974 | Open in IMG/M |
3300029922|Ga0311363_10321954 | All Organisms → cellular organisms → Bacteria | 1713 | Open in IMG/M |
3300029939|Ga0311328_10175914 | All Organisms → cellular organisms → Bacteria | 1682 | Open in IMG/M |
3300029945|Ga0311330_10278377 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
3300029989|Ga0311365_11180530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca | 659 | Open in IMG/M |
3300030114|Ga0311333_10132266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1891 | Open in IMG/M |
3300030617|Ga0311356_11566216 | Not Available | 594 | Open in IMG/M |
3300030707|Ga0310038_10413822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
3300031231|Ga0170824_103919199 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300031231|Ga0170824_109707482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
3300031239|Ga0265328_10095302 | Not Available | 1100 | Open in IMG/M |
3300031261|Ga0302140_10228158 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
3300031538|Ga0310888_10945435 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300031718|Ga0307474_10770246 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300031720|Ga0307469_10643730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 954 | Open in IMG/M |
3300031720|Ga0307469_12163874 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300031740|Ga0307468_100573604 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
3300031788|Ga0302319_10349347 | All Organisms → cellular organisms → Bacteria | 1689 | Open in IMG/M |
3300031788|Ga0302319_11510927 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300031996|Ga0308176_11472062 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300032160|Ga0311301_10085676 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6384 | Open in IMG/M |
3300032160|Ga0311301_11025156 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
3300032174|Ga0307470_11100005 | Not Available | 639 | Open in IMG/M |
3300032783|Ga0335079_10917893 | Not Available | 899 | Open in IMG/M |
3300032805|Ga0335078_12306640 | Not Available | 563 | Open in IMG/M |
3300032828|Ga0335080_11572704 | Not Available | 648 | Open in IMG/M |
3300032893|Ga0335069_11908631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
3300033158|Ga0335077_10727269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1019 | Open in IMG/M |
3300033402|Ga0326728_10430437 | Not Available | 1109 | Open in IMG/M |
3300033561|Ga0371490_1074312 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 946 | Open in IMG/M |
3300033808|Ga0314867_120006 | Not Available | 613 | Open in IMG/M |
3300033822|Ga0334828_110729 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300034124|Ga0370483_0085240 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1029 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.06% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.88% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.88% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.12% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.12% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 4.12% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.94% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.94% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.94% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.94% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.35% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.35% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.35% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.76% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.76% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.76% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.76% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.76% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.76% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.76% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.18% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.18% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.18% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.18% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.18% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.18% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.18% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.18% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.18% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.18% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.18% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.18% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.18% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.18% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.59% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.59% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.59% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.59% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.59% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.59% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.59% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.59% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.59% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.59% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.59% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.59% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001166 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
3300033822 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 5-9 | Environmental | Open in IMG/M |
3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12694J13545_10228802 | 3300001166 | Forest Soil | RHLKNYRGKVTALSGQEQLELETSTSTSVEKPLPLLNKASA* |
JGI12053J15887_105153672 | 3300001661 | Forest Soil | AQRHLKNYRGKVSALSGQEQLELETGESSGKPLPLIDKASA* |
JGI25382J43887_104588272 | 3300002908 | Grasslands Soil | FETAQRHLKTYRGRVTALSGQEQLELDSPKSGEEPLPLTDKASA* |
Ga0062387_1001086231 | 3300004091 | Bog Forest Soil | AFETAQRHLKSYRGKVSALSGQEQLDLDAATKNGDGEETLPLLDKASA* |
Ga0062388_1027786511 | 3300004635 | Bog Forest Soil | EAFETAQRHLKNYRGKVSALSGQEQLELETSASTPAEKPLPLLDKASA* |
Ga0066684_105272242 | 3300005179 | Soil | AFETAQRHLKTYRGRVTVLSGQEQLALDAKNAEETQPPLTDKATA* |
Ga0066675_114263501 | 3300005187 | Soil | AQRHLKTYRGRVTALSGQEQLELDAKTAEDSPPLTDKATA* |
Ga0070666_100389433 | 3300005335 | Switchgrass Rhizosphere | DTAQRHLKTYRGKVSALSGQEQLELESPAADVAEGLLPLTDKASA* |
Ga0070682_1013509242 | 3300005337 | Corn Rhizosphere | EAFDTASRHLKTYRGKVSALSGQEQLELDSPSADSLPLTDKASA* |
Ga0070667_1004649921 | 3300005367 | Switchgrass Rhizosphere | FDTAQRHLKTYRGKVSSLSGQEQLELESTANDVAEELLPLTDKASA* |
Ga0070705_1002312582 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | TASRHLKTYRGKVSALSGQEQLELDSPSADSLPLTDKASA* |
Ga0066689_108010921 | 3300005447 | Soil | QRHLKTYRGRVTVLSGQEQLELDSPKNGEEPLPLSDKASA* |
Ga0070697_1010629181 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | RHLKTYRGRVTALSGQEQLELDAATAAPQNDEEPTLPLIDKASA* |
Ga0070697_1019315082 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LKTYRGRVTALSGQEQLELDAAIAKNDEEPSLPLTDKASA* |
Ga0070695_1017124352 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | AFDTAQRHLKTYRGKVSALSGQEQLELESPAADVAEDLLPLTDKASA* |
Ga0070693_1013771771 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | AQRHLKTYRGRVTALSGQEQLELDAATATTKSDEEPTLPLIDKASA* |
Ga0066701_102543242 | 3300005552 | Soil | TYRGRVTALSGQEQLELDSGKNGDDSLPLADKASA* |
Ga0066699_112744812 | 3300005561 | Soil | KTYRGRVSVLSGQEQLELDAANSDTLPLTDKASA* |
Ga0068855_1002074001 | 3300005563 | Corn Rhizosphere | LKNYRGKVSALSGQEQLELDSAGIDSLPLTDKASA* |
Ga0066702_104094311 | 3300005575 | Soil | KASTHLKTYRGRVSALSGQEQLELDAASGDTTLPLTDKATA* |
Ga0066691_106232021 | 3300005586 | Soil | HLKTYRGRVTVLSGQEQLELDSPKNGEEPLPLSDKASA* |
Ga0068859_1024160951 | 3300005617 | Switchgrass Rhizosphere | AFDTASKHLKTYRGRVSVLSGQEQLELDSPKAEAELPLTDKASA* |
Ga0068866_100368681 | 3300005718 | Miscanthus Rhizosphere | AQRHLKTYRGRVTALSGQEQLELDAATATTTKSDEEPTLPLIDKASA* |
Ga0070766_102726942 | 3300005921 | Soil | STHLKAYRGKVTGLSGQEQLDLDTGAAAPDQLPLTDKASA* |
Ga0066795_101799191 | 3300005938 | Soil | LKSYRGKVSALSGQEQLELETAASSDKPLPLLDKASA* |
Ga0066790_101031284 | 3300005995 | Soil | KSYRGKVSALSGQEQLELETSASTEKPLPLLDKASA* |
Ga0068871_1020204112 | 3300006358 | Miscanthus Rhizosphere | FDTAQRHLKTYRGKVSALSGQEQLELESPANDVAEELLPLTDKASA* |
Ga0066658_101860784 | 3300006794 | Soil | HLKTYRGRVSALSGQEQLELDTGPTETLPLIDKASA* |
Ga0068865_1009938641 | 3300006881 | Miscanthus Rhizosphere | KTYRGRVSALSGQEQLELDSASSEVLPLTDKASA* |
Ga0099791_103692311 | 3300007255 | Vadose Zone Soil | HLKNYRGKVSALSGQEQLELETSASNDKPVSLIDKASA* |
Ga0066710_1002164745 | 3300009012 | Grasslands Soil | TAQRHLKTYRGRVTVLSGQEQLELDAKTAEDTPPLTDKASA |
Ga0066710_1006064041 | 3300009012 | Grasslands Soil | TYRGRVTVLSGQEQLELESPKNGEEPLPLSDKASA |
Ga0099827_103802753 | 3300009090 | Vadose Zone Soil | SALSGQEQLELETSASNDKPVSLIDEPRIDKASA* |
Ga0105245_1000248918 | 3300009098 | Miscanthus Rhizosphere | RHLKTYRGRVTALSGQEQLELETSKNGDDTLPLLDKASA* |
Ga0105245_105399642 | 3300009098 | Miscanthus Rhizosphere | LKTYRGRVTALSGQEQLELDAATAAAKNDDEPTLPLIDKASA* |
Ga0105243_102060361 | 3300009148 | Miscanthus Rhizosphere | KTYRGKVSALSGQEQLELDSPSADSLPLTDKASA* |
Ga0105248_104046544 | 3300009177 | Switchgrass Rhizosphere | AQRHLKTYRGRVTALSGQEQLELDAATAAPQNDEEPTLPLIDKASA* |
Ga0116128_12166231 | 3300009518 | Peatland | QEAFETAQRHLKSYRGKVSALSGQEQLELEAAAGDKPVPLLDKASA* |
Ga0105238_109265421 | 3300009551 | Corn Rhizosphere | HLKTYRGRVTALSGQEQLELETSKNGDDTLPLLDKASA* |
Ga0105249_105640541 | 3300009553 | Switchgrass Rhizosphere | PLKTYRGKVSALSGQEQLELESTANDVAEELLPLTDKASA* |
Ga0116125_11683291 | 3300009628 | Peatland | LKSYRGKVTALSGQEQLDLDAANAAPLPLIDKASA* |
Ga0116122_12379171 | 3300009639 | Peatland | KSYRGKVSALSGQEQLELETSATVEKPLPLLDKASA* |
Ga0116121_10041211 | 3300009644 | Peatland | ETAQRHLKNYRGKVTALSGQEQLELDAAAALEKPLPLLDKASA* |
Ga0116135_11201101 | 3300009665 | Peatland | HLKSYRGKVSALSGQEQLELETPVSTPASVSTSASASTLDEKPLPLLDKASA* |
Ga0116217_100145611 | 3300009700 | Peatlands Soil | RHLKSYRGKVSALSGQEQLELETSASSDKPLPLLDKASA* |
Ga0116131_12344471 | 3300009760 | Peatland | AQRHLKSYRGKVTALSGQEQLELESSASADKPLPLIDKASA* |
Ga0116134_11135743 | 3300009764 | Peatland | KVSALSGQEQLELETSTSGDKPVPLIDEAKLDKASA* |
Ga0126373_111640971 | 3300010048 | Tropical Forest Soil | THLKTYRGRVSALSGQEQLELDAASEGALPLPAKATA* |
Ga0074044_102040981 | 3300010343 | Bog Forest Soil | QEAFETAQRHLKNYRGKVSALSGQEQLELESSATPEKPLPLLDKASA* |
Ga0126378_110389882 | 3300010361 | Tropical Forest Soil | ASTHLKTYRGRVSALSGQEQLELDAASEGALPLPAKATA* |
Ga0134066_103094662 | 3300010364 | Grasslands Soil | YRGKVSALSGQEQLELETTTPAEEKPLPLIDKASA* |
Ga0134125_105528861 | 3300010371 | Terrestrial Soil | LKTYRGRVTALSGQEQLELDAANEAALPLIDKASA* |
Ga0134125_119497222 | 3300010371 | Terrestrial Soil | GRVTALSGQEQLELDAATATTTKSDEEPTLPLIDKASA* |
Ga0134125_129441102 | 3300010371 | Terrestrial Soil | EAFDKASTHLKTYRGRVTALSGQEQLELDAANEAAALPLIDKASA* |
Ga0134128_103834802 | 3300010373 | Terrestrial Soil | AFDKATTHLKNYRGKVSALSGQEQLELDSAGSDSLPLTDKASA* |
Ga0126381_1017048202 | 3300010376 | Tropical Forest Soil | FDKASTHLKTYRGRVSALSGQEQLELDAGNADTPPLTEKTSA* |
Ga0126381_1024127531 | 3300010376 | Tropical Forest Soil | STHLKTYRGRVTALSGQEQLELETKNGGGDDHLPVLDKASA* |
Ga0136449_1004150323 | 3300010379 | Peatlands Soil | QRHLKSYRGKVSALSGQEQLELETSASSDKPLPLLDKASA* |
Ga0136449_1034040561 | 3300010379 | Peatlands Soil | HLKSYRGKVSALSGQEQLELEASASSEKPLPLLDKASA* |
Ga0134124_100741471 | 3300010397 | Terrestrial Soil | THLKTYRGRVSALSGQEQLELDAPKEESLPLVDKASA* |
Ga0134124_120740713 | 3300010397 | Terrestrial Soil | HLKTYRGRVSALSGQEQLELDAPKEETLPLIEKASA* |
Ga0134121_112863691 | 3300010401 | Terrestrial Soil | ASTHLKTYRGRVSALSGQEQLELDAANDAANNEGMLPLIDKASA* |
Ga0137392_101882894 | 3300011269 | Vadose Zone Soil | FETAQRHLKNYRGKVSALSGQEQLELETSPPSPAEEKPLPLIDKASA* |
Ga0137393_104930811 | 3300011271 | Vadose Zone Soil | TAQRHLKTYRGKVSALSGQEQLELETSPPSPAEEKPLPLIDKASA* |
Ga0137393_115791081 | 3300011271 | Vadose Zone Soil | AFDKASTHLKTYRGRVTALSGQEQLELDSGKNGDDTLPLADKASA* |
Ga0137389_100501451 | 3300012096 | Vadose Zone Soil | GRVTALSGQEQLELDAATAKNDEEPSLPLTDKASA* |
Ga0137388_101719773 | 3300012189 | Vadose Zone Soil | YRGRVTVLSGQEQLELETPKNGEEPLPLSDKASA* |
Ga0137388_109351412 | 3300012189 | Vadose Zone Soil | KTYRGRVTVLSGQEQLELESPKNGEEPLPLSDKASA* |
Ga0137363_116919991 | 3300012202 | Vadose Zone Soil | AQRHLKSYRGKVSALSGQEQLELETSASGDKPVSLIDEARIDKASA* |
Ga0137399_104814721 | 3300012203 | Vadose Zone Soil | QRHLKNYRGKVSALSGQEQLELETSASNDKPVSLIDKASA* |
Ga0137376_104775874 | 3300012208 | Vadose Zone Soil | FDTAQKHLKTYRGRVTVLSGQEQLELDAKNGNEPSPLADKASA* |
Ga0137386_112591882 | 3300012351 | Vadose Zone Soil | HLRTYRGRVSALSGQEQLELDAGTTETLPLIDKASA* |
Ga0137366_111890531 | 3300012354 | Vadose Zone Soil | HLKTYRGRVTVLSGQEQLELESPKNGEEPLPLSDKASA* |
Ga0137390_114996443 | 3300012363 | Vadose Zone Soil | KTYRGRVTALSGQEQLELDAATAKADEEPTLPLIDKASA* |
Ga0137358_102936751 | 3300012582 | Vadose Zone Soil | QEAFETAQRHLKSYRGKVSALSGQEQLELETSASNDKPVSLIDKASA* |
Ga0137359_115794432 | 3300012923 | Vadose Zone Soil | QRHLKTYRGRVTALSGQEQLELDAATAKADEEPTLPLIDKASA* |
Ga0137407_119943771 | 3300012930 | Vadose Zone Soil | KTYRGRVTALSGQEQLELDSGKNGDDSLPLADKASA* |
Ga0164304_111921803 | 3300012986 | Soil | RGRVTALSGQEQLELDAATATTKSDEEPTLPLIDKASA* |
Ga0157373_101507902 | 3300013100 | Corn Rhizosphere | DKATTHLKNYRGKVSALSGQEQLELDSAGSDSLPLTDKASA* |
Ga0157370_118221741 | 3300013104 | Corn Rhizosphere | DTANKHLKTYRGRVSALSGQEQLELDSASSEVLPLTDKASA* |
Ga0157378_129802892 | 3300013297 | Miscanthus Rhizosphere | FDKASTHLKTYRGRVSALSGQEQLELDAANDAANNEGMLPLIDKASA* |
Ga0181538_104488823 | 3300014162 | Bog | QRHLKSYRGKVSALSGQEQLELDASSAADKPLPLLDKASA* |
Ga0182014_102627861 | 3300014491 | Bog | FDKATTHLKAYRGKVTALSGQEQLELDPAPSVEVEEEKPLPLLDKASA* |
Ga0157376_104640903 | 3300014969 | Miscanthus Rhizosphere | RHLKTYRGRVTALSGQEQLELDAAMATGKNDDEPTLPLTDKASA* |
Ga0157376_130423531 | 3300014969 | Miscanthus Rhizosphere | LKTYRGRVTALSGQEQLELETSKNGDDTLPLLDKASA* |
Ga0132256_1005568711 | 3300015372 | Arabidopsis Rhizosphere | TAQRHLKTYRGKVSALCGQEQLELDSPAADVAEGLLPLTDKASA* |
Ga0132257_1007349471 | 3300015373 | Arabidopsis Rhizosphere | TYRGKVSALSGQEQLELESPAADVAEGLLPLTDKASA* |
Ga0182036_100718101 | 3300016270 | Soil | HLKTYRGRVSVLSGQEQLDLESAPSNAQSLPLAEKAGA |
Ga0182033_100969601 | 3300016319 | Soil | THLKTYRGRVSVLSGQEQLDLESAPSNAQSLPLAEKAGA |
Ga0181515_12695941 | 3300016730 | Peatland | SYRGKVSALSGQEQLELETSASIDKPLPLIDKASA |
Ga0134069_11628352 | 3300017654 | Grasslands Soil | DTAQKHLKTYRGRVTALSGQEQLELDAKNGAETLPLADKASA |
Ga0187879_105535533 | 3300017946 | Peatland | ETAQRHLKNYRGKVTALSGQEQLELDAAAALEKPLPLLDKASA |
Ga0187847_100315784 | 3300017948 | Peatland | QRHLKNYRGKVTALSGQEQLELDSAPDPAKPLPLLDKASA |
Ga0187782_108683791 | 3300017975 | Tropical Peatland | LKTYRGRVSVLSGQEQLDLESAPSDAQSLPLADKASA |
Ga0187767_103870102 | 3300017999 | Tropical Peatland | HLKTYRGKVSALSGQEQLELDSAAEAASTPAEIEKPLPLLDKASA |
Ga0187815_100387926 | 3300018001 | Freshwater Sediment | FETAQRHLKTYRGKVSALSGQEQLELEPTQPEEKPLPLIDKASA |
Ga0187876_12679102 | 3300018003 | Peatland | ETAQRHLKSYRGKVSALSGQEQLELESGGNPVPLIDKASA |
Ga0187804_100475044 | 3300018006 | Freshwater Sediment | ETAQRHLKTYRGKVTALSGQEQLELDSAAEAEKPLPLIDKASA |
Ga0187888_10352571 | 3300018008 | Peatland | QRHLKSYRGKVSALSGQEQLELETSATVEKPLPLLDKASA |
Ga0187881_101317641 | 3300018024 | Peatland | TAQRHLKSYRGKVSALSGQEQLELETSATVEKPLPLLDKASA |
Ga0187863_108732611 | 3300018034 | Peatland | ETAQRHLKSYRGKVSALSGQEQLELDTAASASPPIDKPLPLLDKASA |
Ga0187890_104311041 | 3300018044 | Peatland | QEAFETAQRHLKNYRGKVTALSGQEQLELDTAASASIEKPLPLLDKASA |
Ga0187858_101886751 | 3300018057 | Peatland | TAQRHLKSYRGKVSALSGQEQLELESGGNPVPLIDKASA |
Ga0187784_115637671 | 3300018062 | Tropical Peatland | KAATHLKTYRGRVSVLSGQEQLDLESAAGDAPSLPLADKASA |
Ga0187772_113745913 | 3300018085 | Tropical Peatland | RGKVTALSGQEQLELDSAPENGEPREAKLPLLDKASA |
Ga0187770_114230711 | 3300018090 | Tropical Peatland | FETAQRHLKSYRGKVTALSGQEQLELDTGASVADSLTLPDKASA |
Ga0066667_116197051 | 3300018433 | Grasslands Soil | EAFDKASTHLKTYRGRVTALSGQEQLELDSGKNGDESLPLADKASA |
Ga0181506_11097401 | 3300019260 | Peatland | DAFETAQRHLKAYRGKVTALSGQEQLPLDSENTPEQRSLLDKASA |
Ga0187798_15894561 | 3300019275 | Peatland | YRGKVTALSGQEQLELDSAPEDAEPREEKPLPLLDKASA |
Ga0187797_16139251 | 3300019284 | Peatland | QRHLKTYRGKVTALSGQEQLELDSPQSQEKTLPLEKPLPLIDKASA |
Ga0182031_14077792 | 3300019787 | Bog | QRHLKKLSGKVTALSGQEQLELDTAASASVEKPLPLLDKASA |
Ga0193730_10232821 | 3300020002 | Soil | KAFETAQRHLKTYRGRVTVLSGQEQLELDAKNAEESPPLTDKATA |
Ga0179592_104945352 | 3300020199 | Vadose Zone Soil | RHLKTYRGKVSALSGQEQLELETSAPSADEKPLPLLDKASA |
Ga0210404_102340513 | 3300021088 | Soil | LKTYRGRVTALSGQEQLELDAATAKADEEPTLPLIDKASA |
Ga0210388_109137071 | 3300021181 | Soil | KVSALSGQEQLELETSAPSTTANDRPLPLLDKASA |
Ga0210398_111332112 | 3300021477 | Soil | HLKTYRGRVTVLSGQEQLELDTAAATAKTEEESLPLLDKASA |
Ga0210409_112658041 | 3300021559 | Soil | GRVTALSGQEQLELDAATAKSDEEPTLPLIDKASA |
Ga0207660_109157901 | 3300025917 | Corn Rhizosphere | RHLKTYRGRVTALSGQEQLELDAATATTKSDEEPTLPLIDKASA |
Ga0207694_104608982 | 3300025924 | Corn Rhizosphere | LKTYRGKVSALSGQEQLELDSPSADSLPLTDKASA |
Ga0207694_110505803 | 3300025924 | Corn Rhizosphere | RVTALSGQEQLELDAAIATGKNDDEPTLPLTDKASA |
Ga0207687_100440126 | 3300025927 | Miscanthus Rhizosphere | LKTYRGRVTALSGQEQLELDAAMATGKNDDEPTLPLTDKASA |
Ga0207701_103036182 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | TAQRHLKTYRGKVSALSGQEQLELESPAADVAEGLLPLTDKASA |
Ga0207677_120896231 | 3300026023 | Miscanthus Rhizosphere | DTAQRHLKTYRGRVTALSGQEQLELDAAMATGKNDDEPTLPLTDKASA |
Ga0209839_100610682 | 3300026294 | Soil | HLKSYRGKVSALSGQEQLELETSASTEKPLPLLDKASA |
Ga0209055_12340562 | 3300026309 | Soil | STHLKTYRGRVTALSGQEQLELDSGKNGDDTLPLADKASA |
Ga0209471_10385252 | 3300026318 | Soil | AFDTASKHLKTYRGRVSVLSGQEQLELDQSTETSALTDKASA |
Ga0209803_10161641 | 3300026332 | Soil | LKTYRGRVTALSGQEQLELDSGKNGDDSLPLADKASA |
Ga0209059_13060241 | 3300026527 | Soil | KASTHLKTYRGRVSALSGQEQLELDAASGDTTLPLTDKATA |
Ga0179587_108620763 | 3300026557 | Vadose Zone Soil | LKNYRGKVSALSGQEQLELETSASNDKPVSLIDKASA |
Ga0208044_12130671 | 3300027625 | Peatlands Soil | SYRGKVSALSGQEQLELETSTSGDKPVPLIDEAKLDKASA |
Ga0208988_10991901 | 3300027633 | Forest Soil | HLKNYRGKVTALSGQEQLELETSASTDKPLPLADKASA |
Ga0209701_103856591 | 3300027862 | Vadose Zone Soil | KTYRGRVTALSGQEQLELDAAATAKTDEEPTLPLTDKASA |
Ga0209415_100403796 | 3300027905 | Peatlands Soil | TAQRHLKSYRGKVSALSGQEQLELETSASSDKPLPLLDKASA |
Ga0209415_103195221 | 3300027905 | Peatlands Soil | TAQRHLKSYRGKVSALSGQEQLELESPASGEKPVPLLDKASA |
Ga0209415_107406982 | 3300027905 | Peatlands Soil | RHLKSYRGKVSALSGQEQLELDAASAADKPLPLLDKASA |
Ga0265338_108567263 | 3300028800 | Rhizosphere | EAFETAQRHLKNYRGKVSALSGQEQLELDTAAESPIEKPLPLLDKANA |
Ga0311361_103251835 | 3300029911 | Bog | FETAQRHLKNYRGKVTALSGQEQLELDAAAALEKPLPLLDKASA |
Ga0311358_104816191 | 3300029915 | Bog | QRHLKAYRGKVTALSGQEQLPLDSENTPEQRSLLDKASA |
Ga0311363_103219545 | 3300029922 | Fen | QRHLKNYRGKVTALSGQEQLELDAAAALEKPLPLLDKASA |
Ga0311328_101759145 | 3300029939 | Bog | ETAQRHLKNYRGKVTALSGHEQLELDAAAALEKPLPLLDKASA |
Ga0311330_102783771 | 3300029945 | Bog | RHLKNYRGKVTALSGQEQLELDAAAALEKPLPLLDKASA |
Ga0311365_111805302 | 3300029989 | Fen | AFDKATTHLKAYRGKVTALSGQEQLELEPAPELDKPLPLLDKASA |
Ga0311333_101322661 | 3300030114 | Fen | ATTHLKAYRGKVTALSGQEQLELEPAPELDKPLPLLDKASA |
Ga0311356_115662161 | 3300030617 | Palsa | TAQRHLKSYRGKVSALSGQEQLELETSASVDKPLPLIDKASA |
Ga0310038_104138221 | 3300030707 | Peatlands Soil | RHLKSYRGKVSALSGQEQLELDASSAADKPLPLLDKASA |
Ga0170824_1039191991 | 3300031231 | Forest Soil | TYRGRVSALSGQEQLELDAANDAANNEGMLPLIDKASA |
Ga0170824_1097074822 | 3300031231 | Forest Soil | QRHLKTYRGKVTVLSGQEQLELDAKNENEANALPFADKASA |
Ga0265328_100953021 | 3300031239 | Rhizosphere | AYRGKVTVLSGQEQLELETTLDLETPLPLIDKASA |
Ga0302140_102281585 | 3300031261 | Bog | NYRGKVTALSGQEQLELDAAAALEKPLPLLDKASA |
Ga0310888_109454351 | 3300031538 | Soil | GRVTALSGQEQLELDAATATTTKSDEEPTLPLIDKASA |
Ga0307474_107702462 | 3300031718 | Hardwood Forest Soil | SYRGKVSALSGQEQLELETSTTGEKALPLLDKASA |
Ga0307469_106437302 | 3300031720 | Hardwood Forest Soil | KSYRGKVSALSGQEQLELETSASNDKPLSLIDEARIDKASA |
Ga0307469_121638742 | 3300031720 | Hardwood Forest Soil | FDKATTHLKNYRGKVSALSGQEQLELETTPALDENPLPLLDKFTA |
Ga0307468_1005736041 | 3300031740 | Hardwood Forest Soil | QRHLKTYRGRVTALSGQEQLELDAATAAPQNDEEPTLPLIDKASA |
Ga0302319_103493471 | 3300031788 | Bog | LKNYRGKVTALSGQEQLELDAAAALEKPLPLLDKASA |
Ga0302319_115109272 | 3300031788 | Bog | KNYRGKVTALSGQEQLELDTAASASVEKPLPLLDKASA |
Ga0308176_114720622 | 3300031996 | Soil | STHLKTYRGRVTALSGQEQLELDAANEAAALPLIDKASA |
Ga0311301_100856766 | 3300032160 | Peatlands Soil | AQRHLKSYRGKVSALSGQEQLELETSASSDKPLPLLDKASA |
Ga0311301_110251561 | 3300032160 | Peatlands Soil | NYRGKVSALSGQEQLELETSASSDKPLPLPLLDKASA |
Ga0307470_111000051 | 3300032174 | Hardwood Forest Soil | QRHLKTYRGKVTALSGQEQLELDAATAKSDDEPGLPLVDKASA |
Ga0335079_109178933 | 3300032783 | Soil | AQRHLKTYRGKVTALSGQEQLELDTAAKANEEPLPLIDKASA |
Ga0335078_123066401 | 3300032805 | Soil | YRGKVTALSGQEQLELDTPPGQEKPLPLESPLSMEKPLPLIDKASA |
Ga0335080_115727041 | 3300032828 | Soil | LKSYRGKVSALSGQEQLDLDTATAKNGEGEQPLPLLDKASA |
Ga0335069_119086312 | 3300032893 | Soil | EAFDKAATHLKTYRGRVSVLSGQEQLELEPATSEPEPLPLIDKASA |
Ga0335077_107272693 | 3300033158 | Soil | YRGKVTALSGQEQLALDSTVEPGNSDEKALPLLDKASA |
Ga0326728_104304372 | 3300033402 | Peat Soil | LKSYRGKVSALSGQEQLELESSASIDKPLPLIDKASA |
Ga0371490_10743122 | 3300033561 | Peat Soil | EAFETAQRHLKSYRGKVSALSGQEQLELETSAPVDKPLPLLDKASA |
Ga0314867_120006_1_123 | 3300033808 | Peatland | KSYRGKVSALSGQEQLDLDTAAAKNGDSPETLPLLDKASA |
Ga0334828_110729_524_667 | 3300033822 | Soil | TAQRHLKSYRGKVSALSGQEQLELESSDPVDKPLSLIDKARIDKASA |
Ga0370483_0085240_892_1029 | 3300034124 | Untreated Peat Soil | AFETAQRHLKSYRGKVSALSGQEQLELDTAASLEKPLPLIDKASA |
⦗Top⦘ |