Basic Information | |
---|---|
Family ID | F036220 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 170 |
Average Sequence Length | 43 residues |
Representative Sequence | ASIERLEAEEPELAAALHRWLATTLAERLSDTLRSFDALLD |
Number of Associated Samples | 143 |
Number of Associated Scaffolds | 170 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.78 % |
% of genes near scaffold ends (potentially truncated) | 96.47 % |
% of genes from short scaffolds (< 2000 bps) | 88.82 % |
Associated GOLD sequencing projects | 138 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.65 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (82.941 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (24.118 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.294 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.176 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.07% β-sheet: 0.00% Coil/Unstructured: 44.93% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.65 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 170 Family Scaffolds |
---|---|---|
PF00916 | Sulfate_transp | 20.59 |
PF02142 | MGS | 11.76 |
PF03795 | YCII | 3.53 |
PF01740 | STAS | 3.53 |
PF04993 | TfoX_N | 1.76 |
PF00069 | Pkinase | 1.18 |
PF08241 | Methyltransf_11 | 1.18 |
PF07676 | PD40 | 1.18 |
PF09365 | DUF2461 | 1.18 |
PF02583 | Trns_repr_metal | 1.18 |
PF01243 | Putative_PNPOx | 1.18 |
PF12802 | MarR_2 | 1.18 |
PF05163 | DinB | 0.59 |
PF07366 | SnoaL | 0.59 |
PF13784 | Fic_N | 0.59 |
PF06032 | DUF917 | 0.59 |
PF13860 | FlgD_ig | 0.59 |
PF01850 | PIN | 0.59 |
PF00144 | Beta-lactamase | 0.59 |
PF08002 | DUF1697 | 0.59 |
PF12681 | Glyoxalase_2 | 0.59 |
PF02574 | S-methyl_trans | 0.59 |
PF09339 | HTH_IclR | 0.59 |
PF07730 | HisKA_3 | 0.59 |
PF00291 | PALP | 0.59 |
PF00884 | Sulfatase | 0.59 |
PF13378 | MR_MLE_C | 0.59 |
PF16400 | DUF5008 | 0.59 |
PF00782 | DSPc | 0.59 |
PF01522 | Polysacc_deac_1 | 0.59 |
PF02585 | PIG-L | 0.59 |
PF03174 | CHB_HEX_C | 0.59 |
PF12482 | DUF3701 | 0.59 |
PF11798 | IMS_HHH | 0.59 |
PF01145 | Band_7 | 0.59 |
PF08281 | Sigma70_r4_2 | 0.59 |
PF00440 | TetR_N | 0.59 |
PF13011 | LZ_Tnp_IS481 | 0.59 |
PF00211 | Guanylate_cyc | 0.59 |
PF00586 | AIRS | 0.59 |
PF00027 | cNMP_binding | 0.59 |
PF13180 | PDZ_2 | 0.59 |
PF00486 | Trans_reg_C | 0.59 |
PF00221 | Lyase_aromatic | 0.59 |
PF13385 | Laminin_G_3 | 0.59 |
PF00271 | Helicase_C | 0.59 |
PF13464 | DUF4115 | 0.59 |
COG ID | Name | Functional Category | % Frequency in 170 Family Scaffolds |
---|---|---|---|
COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 20.59 |
COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 20.59 |
COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 20.59 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 4.71 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 3.53 |
COG3070 | Transcriptional regulator of competence genes, TfoX/Sxy family | Transcription [K] | 1.76 |
COG1937 | DNA-binding transcriptional regulator, FrmR family | Transcription [K] | 1.18 |
COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.59 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.59 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.59 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.59 |
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.59 |
COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 0.59 |
COG3535 | Uncharacterized conserved protein, DUF917 family | Function unknown [S] | 0.59 |
COG3525 | N-acetyl-beta-hexosaminidase | Carbohydrate transport and metabolism [G] | 0.59 |
COG2986 | Histidine ammonia-lyase | Amino acid transport and metabolism [E] | 0.59 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.59 |
COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.59 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.59 |
COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 0.59 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.59 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.59 |
COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.59 |
COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 0.59 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 84.12 % |
Unclassified | root | N/A | 15.88 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000890|JGI11643J12802_12342167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 600 | Open in IMG/M |
3300000956|JGI10216J12902_104842102 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300001139|JGI10220J13317_10306921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
3300004067|Ga0055485_10174416 | Not Available | 599 | Open in IMG/M |
3300004114|Ga0062593_102810830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 555 | Open in IMG/M |
3300004157|Ga0062590_102509162 | Not Available | 546 | Open in IMG/M |
3300004463|Ga0063356_100592588 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
3300004463|Ga0063356_101603260 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
3300004479|Ga0062595_102511859 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300004480|Ga0062592_102641437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 507 | Open in IMG/M |
3300004778|Ga0062383_10321228 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300005105|Ga0066812_1026100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
3300005162|Ga0066814_10086660 | Not Available | 569 | Open in IMG/M |
3300005332|Ga0066388_100876920 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
3300005332|Ga0066388_102612840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 920 | Open in IMG/M |
3300005338|Ga0068868_102109599 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300005341|Ga0070691_10961877 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300005458|Ga0070681_11489547 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300005536|Ga0070697_100904660 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300005558|Ga0066698_10669464 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300005561|Ga0066699_10115540 | All Organisms → cellular organisms → Bacteria | 1791 | Open in IMG/M |
3300005568|Ga0066703_10488273 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300005617|Ga0068859_100801008 | Not Available | 1030 | Open in IMG/M |
3300005719|Ga0068861_100173530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1789 | Open in IMG/M |
3300005719|Ga0068861_100536841 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
3300005842|Ga0068858_100666632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1011 | Open in IMG/M |
3300006580|Ga0074049_12740581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
3300006581|Ga0074048_11380079 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300006605|Ga0074057_11393670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
3300006844|Ga0075428_101256591 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300006846|Ga0075430_100726479 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300006865|Ga0073934_10029095 | All Organisms → cellular organisms → Bacteria | 5385 | Open in IMG/M |
3300006865|Ga0073934_10256606 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
3300006876|Ga0079217_11400845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 546 | Open in IMG/M |
3300006880|Ga0075429_100215231 | All Organisms → cellular organisms → Bacteria | 1683 | Open in IMG/M |
3300006903|Ga0075426_11427756 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300006954|Ga0079219_10895207 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300009098|Ga0105245_10969575 | Not Available | 894 | Open in IMG/M |
3300009100|Ga0075418_13082964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 508 | Open in IMG/M |
3300009147|Ga0114129_11314109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 896 | Open in IMG/M |
3300009147|Ga0114129_13198012 | Not Available | 533 | Open in IMG/M |
3300009156|Ga0111538_11109301 | Not Available | 1000 | Open in IMG/M |
3300009157|Ga0105092_10223846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1054 | Open in IMG/M |
3300009168|Ga0105104_10869321 | Not Available | 527 | Open in IMG/M |
3300009171|Ga0105101_10033780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2483 | Open in IMG/M |
3300009537|Ga0129283_10181733 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
3300009789|Ga0126307_10747962 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300009800|Ga0105069_1037972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
3300009809|Ga0105089_1037178 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300009811|Ga0105084_1049761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 741 | Open in IMG/M |
3300010029|Ga0105074_1038485 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Kerfeldbacteria → Candidatus Kerfeldbacteria bacterium CG15_BIG_FIL_POST_REV_8_21_14_020_45_12 | 828 | Open in IMG/M |
3300010047|Ga0126382_11198666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 680 | Open in IMG/M |
3300010301|Ga0134070_10428674 | Not Available | 526 | Open in IMG/M |
3300010322|Ga0134084_10453815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 511 | Open in IMG/M |
3300010400|Ga0134122_13009294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
3300010403|Ga0134123_10950921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 870 | Open in IMG/M |
3300012199|Ga0137383_10400661 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300012204|Ga0137374_10397802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1096 | Open in IMG/M |
3300012210|Ga0137378_11492912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 587 | Open in IMG/M |
3300012349|Ga0137387_11269365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. Soil774 | 517 | Open in IMG/M |
3300012355|Ga0137369_10119758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2131 | Open in IMG/M |
3300012355|Ga0137369_10163029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1757 | Open in IMG/M |
3300012355|Ga0137369_10629677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 743 | Open in IMG/M |
3300012355|Ga0137369_10758645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 664 | Open in IMG/M |
3300012362|Ga0137361_11595876 | Not Available | 573 | Open in IMG/M |
3300012392|Ga0134043_1080629 | Not Available | 974 | Open in IMG/M |
3300012944|Ga0137410_11154849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 665 | Open in IMG/M |
3300012955|Ga0164298_10285922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1014 | Open in IMG/M |
3300012957|Ga0164303_10351638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 891 | Open in IMG/M |
3300012984|Ga0164309_10799827 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300012985|Ga0164308_10910261 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300012986|Ga0164304_10774762 | Not Available | 737 | Open in IMG/M |
3300013764|Ga0120111_1114177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 631 | Open in IMG/M |
3300013770|Ga0120123_1061876 | Not Available | 816 | Open in IMG/M |
3300013772|Ga0120158_10051926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2824 | Open in IMG/M |
3300013772|Ga0120158_10448526 | Not Available | 581 | Open in IMG/M |
3300014157|Ga0134078_10198738 | Not Available | 817 | Open in IMG/M |
3300014268|Ga0075309_1110008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 677 | Open in IMG/M |
3300014272|Ga0075327_1019214 | All Organisms → cellular organisms → Bacteria | 2051 | Open in IMG/M |
3300014298|Ga0075341_1006227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1361 | Open in IMG/M |
3300014321|Ga0075353_1102501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 671 | Open in IMG/M |
3300014324|Ga0075352_1151704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 652 | Open in IMG/M |
3300014326|Ga0157380_11455148 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300015357|Ga0134072_10337462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
3300015373|Ga0132257_100474574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1531 | Open in IMG/M |
3300017657|Ga0134074_1230885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 662 | Open in IMG/M |
3300017965|Ga0190266_11295736 | Not Available | 511 | Open in IMG/M |
3300018000|Ga0184604_10211832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 668 | Open in IMG/M |
3300018031|Ga0184634_10556180 | Not Available | 507 | Open in IMG/M |
3300018063|Ga0184637_10630008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 600 | Open in IMG/M |
3300018078|Ga0184612_10110427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1440 | Open in IMG/M |
3300018078|Ga0184612_10435575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 655 | Open in IMG/M |
3300018081|Ga0184625_10186455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1087 | Open in IMG/M |
3300018082|Ga0184639_10543256 | Not Available | 579 | Open in IMG/M |
3300018429|Ga0190272_11397147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 704 | Open in IMG/M |
3300018429|Ga0190272_13197166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 510 | Open in IMG/M |
3300018465|Ga0190269_11562217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → unclassified Nakamurella → Nakamurella sp. PAMC28650 | 548 | Open in IMG/M |
3300018466|Ga0190268_10304762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 959 | Open in IMG/M |
3300018469|Ga0190270_10306629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1418 | Open in IMG/M |
3300018469|Ga0190270_10673509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1021 | Open in IMG/M |
3300018469|Ga0190270_11210087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 794 | Open in IMG/M |
3300018481|Ga0190271_11419905 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300019255|Ga0184643_1159617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
3300019279|Ga0184642_1120611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
3300019377|Ga0190264_11273187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 618 | Open in IMG/M |
3300020059|Ga0193745_1110333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 579 | Open in IMG/M |
3300020215|Ga0196963_10389957 | Not Available | 623 | Open in IMG/M |
3300021080|Ga0210382_10001633 | All Organisms → cellular organisms → Bacteria | 7450 | Open in IMG/M |
3300021081|Ga0210379_10346639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 653 | Open in IMG/M |
3300021081|Ga0210379_10374359 | Not Available | 628 | Open in IMG/M |
3300022309|Ga0224510_10451417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 769 | Open in IMG/M |
3300022756|Ga0222622_10445770 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
3300025319|Ga0209520_10080343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2079 | Open in IMG/M |
3300025927|Ga0207687_11331449 | Not Available | 617 | Open in IMG/M |
3300025972|Ga0207668_10520738 | All Organisms → Viruses → Predicted Viral | 1026 | Open in IMG/M |
3300026032|Ga0208419_1031653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 607 | Open in IMG/M |
3300026050|Ga0208293_1014533 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300026095|Ga0207676_10022163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4670 | Open in IMG/M |
3300026102|Ga0208914_1029922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 644 | Open in IMG/M |
3300026530|Ga0209807_1336979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
3300026548|Ga0209161_10347815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 667 | Open in IMG/M |
3300026550|Ga0209474_10078399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2276 | Open in IMG/M |
3300027332|Ga0209861_1017680 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
3300027560|Ga0207981_1051197 | Not Available | 754 | Open in IMG/M |
3300027907|Ga0207428_10790351 | All Organisms → cellular organisms → Archaea | 675 | Open in IMG/M |
3300027907|Ga0207428_10961249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
3300027955|Ga0209078_1113513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 770 | Open in IMG/M |
(restricted) 3300028043|Ga0233417_10431648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 611 | Open in IMG/M |
3300028381|Ga0268264_10896030 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
3300028716|Ga0307311_10273988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
3300028722|Ga0307319_10318363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
3300028787|Ga0307323_10260279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 625 | Open in IMG/M |
3300028791|Ga0307290_10247092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 654 | Open in IMG/M |
3300028791|Ga0307290_10361940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
3300028793|Ga0307299_10082605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 1195 | Open in IMG/M |
3300028793|Ga0307299_10119306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 989 | Open in IMG/M |
3300028810|Ga0307294_10226617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 655 | Open in IMG/M |
3300028811|Ga0307292_10003922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5042 | Open in IMG/M |
3300028811|Ga0307292_10068068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1358 | Open in IMG/M |
3300028819|Ga0307296_10019464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3571 | Open in IMG/M |
3300028824|Ga0307310_10206392 | Not Available | 929 | Open in IMG/M |
3300028824|Ga0307310_10231142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 882 | Open in IMG/M |
3300028828|Ga0307312_10311888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1025 | Open in IMG/M |
3300028872|Ga0307314_10062795 | Not Available | 955 | Open in IMG/M |
3300028875|Ga0307289_10016603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2826 | Open in IMG/M |
3300028878|Ga0307278_10039544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2147 | Open in IMG/M |
3300028878|Ga0307278_10105117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1269 | Open in IMG/M |
3300028878|Ga0307278_10389017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 613 | Open in IMG/M |
3300028884|Ga0307308_10612973 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300030006|Ga0299907_10024899 | All Organisms → cellular organisms → Bacteria | 4565 | Open in IMG/M |
3300030006|Ga0299907_10143200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1975 | Open in IMG/M |
3300030006|Ga0299907_10329363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1240 | Open in IMG/M |
3300030006|Ga0299907_10627614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 832 | Open in IMG/M |
3300030990|Ga0308178_1069728 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300031228|Ga0299914_11604375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
3300031229|Ga0299913_10033254 | All Organisms → cellular organisms → Bacteria | 4863 | Open in IMG/M |
3300031229|Ga0299913_11824825 | Not Available | 556 | Open in IMG/M |
3300031576|Ga0247727_10065290 | All Organisms → cellular organisms → Bacteria | 4199 | Open in IMG/M |
3300031731|Ga0307405_11166642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
3300031847|Ga0310907_10786052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
3300031854|Ga0310904_10340389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 964 | Open in IMG/M |
3300031949|Ga0214473_11935078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 577 | Open in IMG/M |
3300032017|Ga0310899_10383608 | Not Available | 670 | Open in IMG/M |
3300032516|Ga0315273_11649296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 780 | Open in IMG/M |
3300033416|Ga0316622_100663525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1204 | Open in IMG/M |
3300033551|Ga0247830_10022500 | All Organisms → cellular organisms → Bacteria | 3763 | Open in IMG/M |
3300033551|Ga0247830_10049354 | All Organisms → cellular organisms → Bacteria | 2752 | Open in IMG/M |
3300034176|Ga0364931_0019726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1891 | Open in IMG/M |
3300034257|Ga0370495_0141587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 760 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 24.12% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.88% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.29% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 4.71% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.12% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.12% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.53% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 3.53% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.53% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.94% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.35% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.35% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.18% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 1.18% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.18% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.18% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.18% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.18% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.18% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.18% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.59% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.59% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.59% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.59% |
Beach Aquifer Porewater | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater | 0.59% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.59% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.59% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.59% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.59% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.59% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.59% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.59% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.59% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.59% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.59% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.59% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.59% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.59% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
3300004067 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
3300005105 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPC | Environmental | Open in IMG/M |
3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009537 | Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - D-2W | Environmental | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009800 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_30_40 | Environmental | Open in IMG/M |
3300009809 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 | Environmental | Open in IMG/M |
3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012392 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014268 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1 | Environmental | Open in IMG/M |
3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
3300014298 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
3300020215 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5 | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300022309 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026032 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026050 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026102 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027332 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027955 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
3300034257 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI11643J12802_123421671 | 3300000890 | Soil | AEDPELAAALHRWLATTLAGRLGESLKAFDALFD* |
JGI10216J12902_1048421022 | 3300000956 | Soil | IAEVPSVVLTLSRASIRRLEAEEPATAAALHRWLATTLAVRLTDAQRVYSALLD* |
JGI10220J13317_103069212 | 3300001139 | Soil | VAETPCVVLRLSRAAIARMEAEEPELGAALHGWLARTMALRLTDRTRALDSLLD* |
Ga0055485_101744162 | 3300004067 | Natural And Restored Wetlands | RLEAEQPELAAEFHRWLATALADRLSDTMRTFDALVDQT* |
Ga0062593_1028108302 | 3300004114 | Soil | LDEIERTDPELAAALHRWLAATLAGRLNDAMNAFDALLD* |
Ga0062590_1025091622 | 3300004157 | Soil | SLERMQRVDPALAADVHRWFARVLADRLGDTLRAVDALSD* |
Ga0063356_1005925881 | 3300004463 | Arabidopsis Thaliana Rhizosphere | RNADVVAETPCVVLGLTRAALERLEIEEPDAAAALHRWLATTLSVRLTDSQRAYLTMLD* |
Ga0063356_1016032602 | 3300004463 | Arabidopsis Thaliana Rhizosphere | IERLEAEEPELAAALHRWLATTLAERLTDTMRTFDVLLD* |
Ga0062595_1025118591 | 3300004479 | Soil | ASIQRLEAEEPATAAALHRWLATTLAVRLTDAQRVYSALLD* |
Ga0062592_1026414371 | 3300004480 | Soil | YTGAARNADVVAETPCVVLGLTRAALERLEIEEPDAAAALHRWLATTLSVRLTDSQRAYLTMLD* |
Ga0062383_103212282 | 3300004778 | Wetland Sediment | VVLHLPAGSIAQMEAEEPELAAALHRWLARTLASRLNETLRAADALFD* |
Ga0066812_10261002 | 3300005105 | Soil | SIERIEADDPELAAALHRWLAATLAGRLGDSLKAFDALLD* |
Ga0066814_100866601 | 3300005162 | Soil | RASIERLEAEEPESAAAMHRWLATMLATRLTDAQRAFTALLD* |
Ga0066388_1008769202 | 3300005332 | Tropical Forest Soil | DVPSVIYRLRRGEIERLETDDPRAAAALHRWLATALATRLTDAQRLYSALLD* |
Ga0066388_1026128403 | 3300005332 | Tropical Forest Soil | EDIERLEREQPELAATLHRWLATQLAERLTDTLGVVDALLD* |
Ga0068868_1021095991 | 3300005338 | Miscanthus Rhizosphere | VVMRLGRASIERIEATEPALAAALHRWLATTLSERLTETQRAVMALFD* |
Ga0070691_109618772 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | SVVLTLSRASIQRLETEEPATAAALHRWLATTLAVRLTDAQRVYSALLD* |
Ga0070681_114895471 | 3300005458 | Corn Rhizosphere | RLSKTAIERMETDDPELAAALHRWLATTIAGRLGESLHAFDALFD* |
Ga0070697_1009046602 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | RSSIERMEAEEPEIAASLHRWLATMLAERLTDSQRAFSALLD* |
Ga0066698_106694641 | 3300005558 | Soil | ADVTAEVPSVVLRLRRASIERLEAEDPQAAAAVHRWLAAALATRLTDAQRVYSALLD* |
Ga0066699_101155401 | 3300005561 | Soil | IVLRLSRASIERMEAAEPELAAALHRWLARTLAERLTDTMRAFDALLD* |
Ga0066703_104882731 | 3300005568 | Soil | ALSRASIERLEAEEPVKAAALHRWLATTLAVRLTDAQRVYSALLD* |
Ga0068859_1008010082 | 3300005617 | Switchgrass Rhizosphere | RIEASEPALAAALHRWLATALSERLNDTLHAFDALMD* |
Ga0068861_1001735301 | 3300005719 | Switchgrass Rhizosphere | IESEDPALASAMHRWLGGVLSERLSDTLREFDALLD* |
Ga0068861_1005368412 | 3300005719 | Switchgrass Rhizosphere | ERIEASEPALAAALHRWLATALSERLNDTLHAFDALMD* |
Ga0068858_1006666322 | 3300005842 | Switchgrass Rhizosphere | RIEATEPALAAALHRWLATTLSERLTETQRAVMALFD* |
Ga0074049_127405811 | 3300006580 | Soil | RASIERMERSEPELAAALHRWLATTLSDRLTETQRAAMALFD* |
Ga0074048_113800791 | 3300006581 | Soil | RASIERLETEEPETAAALHRWLATTLAVRLTDADRAFSASLD* |
Ga0074057_113936701 | 3300006605 | Soil | ASIERMERSEPELAAALHRWLATTLSERLTETQRAAMALFD* |
Ga0075428_1012565912 | 3300006844 | Populus Rhizosphere | ERLEAEEPETAAMLHRWLATTLAERLTDTMGVVDALLD* |
Ga0075430_1007264792 | 3300006846 | Populus Rhizosphere | RMEADEPELAAAMHRWLARTLSERLTDTLREFDALLD* |
Ga0073934_100290954 | 3300006865 | Hot Spring Sediment | STDPELAAALHRWLATTLAQRLGETLRAVDALLD* |
Ga0073934_102566061 | 3300006865 | Hot Spring Sediment | LERIGSQDPELAATLHRWLATTLAERLGDTLRSVDALLD* |
Ga0079217_114008452 | 3300006876 | Agricultural Soil | SEDPNLAAALHRWLATTLAERLRGTLTVVDALLD* |
Ga0075429_1002152311 | 3300006880 | Populus Rhizosphere | SVVLRIGREAIARLEVEAPETAVMLHRWLATMLAERLTNSMRTIDVLLDR* |
Ga0075426_114277561 | 3300006903 | Populus Rhizosphere | VLRLRRASIERLEADDPQAAAAVHRWLATALATRLTDVQRVYSELLD* |
Ga0079219_108952071 | 3300006954 | Agricultural Soil | EAEEPALAVRLHRWLATTLAARVSDSIRTYEALLP* |
Ga0105245_109695752 | 3300009098 | Miscanthus Rhizosphere | SIRRLEAEEPATAAALHRWLATTLAVRLTDAQRVYSALLD* |
Ga0075418_130829641 | 3300009100 | Populus Rhizosphere | VPSVVLRIGRESIERLEAEEPELAATLHRWLATQLAERLTDTMRTFDVLLD* |
Ga0114129_113141092 | 3300009147 | Populus Rhizosphere | ERLETEEPALAAALHRWLATTLAERLSDTRGALDALLD* |
Ga0114129_131980121 | 3300009147 | Populus Rhizosphere | CEVLRLSRASMERMERDEPELAVALHRRLAESLAERSRDAMRVFDELLG* |
Ga0111538_111093011 | 3300009156 | Populus Rhizosphere | VVLRIGRDSIERLEAEEPETAAMLHRWLATTLAERLTDTMGVVDALLD* |
Ga0105092_102238463 | 3300009157 | Freshwater Sediment | IERVEAADPALAAALHRWLATTLSERLGESLRAFDALFD* |
Ga0105104_108693212 | 3300009168 | Freshwater Sediment | VDEPELAAAVHRWLARTLSERLSDTLREFDALLD* |
Ga0105101_100337803 | 3300009171 | Freshwater Sediment | FSAGSIARMDADEPEVAAALHRWLATTLADRLNETLRAADALLD* |
Ga0129283_101817331 | 3300009537 | Beach Aquifer Porewater | IERMEAAEPELAAELHRWLAGTLAERLTDTQRAVEALFD* |
Ga0126307_107479623 | 3300009789 | Serpentine Soil | LRLGKGSIDRIEADDPQLAAALHRWLATTLAGRLGDSLRAFDALLD* |
Ga0105069_10379721 | 3300009800 | Groundwater Sand | LEAQDPLLAAALHRWLAGVLSERLSDTLREFDALLD* |
Ga0105089_10371782 | 3300009809 | Groundwater Sand | ESIERMEADDPELAAALHRWLAMTLAGRLGDSLKAFDALLD* |
Ga0105084_10167061 | 3300009811 | Groundwater Sand | RLDRASIARIEAEDPALASAMHRWLGGVLSERLSDTLREFDALLD* |
Ga0105084_10497612 | 3300009811 | Groundwater Sand | VVLRFSRESIARMEAEEPEVAAALHRWLATTLAERLNDNLRAVDALLD* |
Ga0105074_10384852 | 3300010029 | Groundwater Sand | GASIERMEAERPELAAALHRWLATTLAERLGETMRVFDALLD* |
Ga0126382_111986662 | 3300010047 | Tropical Forest Soil | ARIEAEAPELASALHRWLAWTLAERLGETLRTFDAMLD* |
Ga0134070_104286741 | 3300010301 | Grasslands Soil | SIERLEAEEPERAAALHRWLATTLAVRLTDAQRVYSALLD* |
Ga0134084_104538152 | 3300010322 | Grasslands Soil | RASIERLEAEEPERAAALHRWLATTLAVRLTDAQRVYSALLD* |
Ga0134122_130092942 | 3300010400 | Terrestrial Soil | ERIETTEPALAAALHRWLATTLSERLTETQRAVMALFD* |
Ga0134123_109509212 | 3300010403 | Terrestrial Soil | ERIEATEPALASALHRWLATTLSERLTDTQRAVMALFD* |
Ga0137383_104006613 | 3300012199 | Vadose Zone Soil | DVIAEVPSVVLALSRASIQRLEAEEPARAAALHRWLATTLAVRLTDAQRVYSALLD* |
Ga0137374_103978022 | 3300012204 | Vadose Zone Soil | SIARMEAEEPEVAAALHRWLATTLAERLNDTLRAVDALLD* |
Ga0137378_114929121 | 3300012210 | Vadose Zone Soil | MEAADPELAAALHRWLATTLAERLDDSLRAFEPLLD* |
Ga0137387_112693652 | 3300012349 | Vadose Zone Soil | SKASLERLQAEEPETAAALHRWLATTLAERLADSQRAFSALLD* |
Ga0137369_101197582 | 3300012355 | Vadose Zone Soil | EQLEADEPELAAALHRWLARTLAERLGDMSKGLDALLD* |
Ga0137369_101630291 | 3300012355 | Vadose Zone Soil | SIERMEAEEPQLAAALHRWFARTLAERPTDRMRALDSLLD* |
Ga0137369_106296771 | 3300012355 | Vadose Zone Soil | SIEQLEADEPELAAALHRWLARTLAERLGDMSKGLDALLD* |
Ga0137369_107586451 | 3300012355 | Vadose Zone Soil | SVVLRIGRESIERLEAEEPELAAALHRWLATTLAERLTDTLGVVDALLD* |
Ga0137361_115958761 | 3300012362 | Vadose Zone Soil | AISRASIERLEAEEPARAAALHRWLATTLAVRLTDAQRVYSALLD* |
Ga0134043_10806293 | 3300012392 | Grasslands Soil | SRDSIKRLEVEDSARAAALHRWLATTLAVRLTDAQRVYSALLD* |
Ga0137410_111548491 | 3300012944 | Vadose Zone Soil | LTRASIERMERSEPELAAELHRWLATTVSERLTDTLRAFDALLD* |
Ga0164298_102859223 | 3300012955 | Soil | VVLTLSRAAIQRLEAEEPATAASLHRWLATTLAVRLTDAQRVYSALLD* |
Ga0164303_103516383 | 3300012957 | Soil | QRLEAEEPATAAALHRWLATTLAVRLTDAQRVDSALLE* |
Ga0164309_107998271 | 3300012984 | Soil | QRLEAEEPATAAALHRWLATTLAVRLTDAQRVYSALLD* |
Ga0164308_109102611 | 3300012985 | Soil | IAEVPSVVLTLSRASIQRLEAEEPATAAALHRWLATTLAVRLTDAQRVYSALLD* |
Ga0164304_107747622 | 3300012986 | Soil | EAEEPATAAALHRWLATTLAVRLTDAQRVYSALLD* |
Ga0120111_11141771 | 3300013764 | Permafrost | LGLSRASIERLEAEEPETAAALHRWLATMLAERLTDSQRAFSALLD* |
Ga0120123_10618763 | 3300013770 | Permafrost | AISRASIQRLEAEEPARAAALHRWLATTLAVRLTDAQRVYSALLD* |
Ga0120158_100519264 | 3300013772 | Permafrost | RLEADEPETAAALHRWLATTLAVRLTDSQRAFRALLD* |
Ga0120158_104485262 | 3300013772 | Permafrost | AEEPATAAALHRWLASTLAVRLIDLERAYSALLD* |
Ga0134078_101987381 | 3300014157 | Grasslands Soil | SRASIERLEAEEPERAAALHRWLATTLAVRLTDAQRVYSALLD* |
Ga0075309_11100082 | 3300014268 | Natural And Restored Wetlands | ARIEAEDPEAAAALHRWLAGTLAERLDDTMRGFDALID* |
Ga0075327_10192141 | 3300014272 | Natural And Restored Wetlands | EIDRLEAEEPALAVSLHRWFATTLAHRLTDRMRAFDTLLD* |
Ga0075341_10062272 | 3300014298 | Natural And Restored Wetlands | EAEQPELAAEFHRWLATALADRLSDTMRTFDALVDQT* |
Ga0075353_11025012 | 3300014321 | Natural And Restored Wetlands | RPPRSTSERVGSEEPELAAALHRWLAGMLAERLTDTQRAVDALID* |
Ga0075352_11517041 | 3300014324 | Natural And Restored Wetlands | PSMVLRLRRSAIERLEAEEPEEAAALHRWVAGTLAERLTDTQRAVDALFD* |
Ga0157380_114551481 | 3300014326 | Switchgrass Rhizosphere | TAIERMETDDPELAAALHRWLAATIAGRLGESLLAFDALFD* |
Ga0134072_103374621 | 3300015357 | Grasslands Soil | ADVPSVVLALSRDSIKRLEVEDSARAAALHRWLATTLAVRLTDAQRVYSALLD* |
Ga0132257_1004745742 | 3300015373 | Arabidopsis Rhizosphere | ERIEAAEPELAAQLHRWLAWTLADRLGDTMRTFDAMLD* |
Ga0134074_12308852 | 3300017657 | Grasslands Soil | RAALVRMEAEDPRLAAALHRRLAVTLAARVTDSLRVFDELMD |
Ga0190266_112957362 | 3300017965 | Soil | LDRASIDRLEAQDPELAAALHRWLAGVLSERLSDTLREFDALLD |
Ga0184604_102118321 | 3300018000 | Groundwater Sediment | IARLEAEEPELAAALHRWLATTLAERLTDTMRTFDVLLD |
Ga0184634_105561802 | 3300018031 | Groundwater Sediment | MEAAEPELAAHVHRWLGRTLAERLSDTLRAFDALLD |
Ga0184637_106300082 | 3300018063 | Groundwater Sediment | ESEEPELAAAVHRWLARTLSERLSDTLREFDALLD |
Ga0184612_101104272 | 3300018078 | Groundwater Sediment | EADDPELAAALHRWLARTLAERLDDTLKGFNALLD |
Ga0184612_104355752 | 3300018078 | Groundwater Sediment | LRGVTIRRMEADEPELAAAVHRWLARTLSERLSDTLREFDALLD |
Ga0184625_101864551 | 3300018081 | Groundwater Sediment | IERMESEDPELAAALHRWLAGILSDRLRDTLREFDALLD |
Ga0184639_105432562 | 3300018082 | Groundwater Sediment | VVLRLSGEAIERMEASEPELAAHVHRWLATTLSERLSDTVRAFDALLD |
Ga0190272_113971471 | 3300018429 | Soil | ISRESIARLEAEEPELAGALHRWLATTLAERLTDTMRTFDVLLD |
Ga0190272_131971662 | 3300018429 | Soil | LTRGSIERMEAAEPRLAAAVHRWLARTLAERLGDSLKAFDALID |
Ga0190269_115622171 | 3300018465 | Soil | DSIDRLEADEPEVAAALHRWFATTLAQRLAGTTQAFDTLLD |
Ga0190268_103047622 | 3300018466 | Soil | VVAETRSVVLRISRGSIERLEAEEPELAAALHRWLATTLAERLTDTMRTFDVLLD |
Ga0190270_103066292 | 3300018469 | Soil | EADEPELAAAVHRWLARTLSERLSDTLREFDALLD |
Ga0190270_106735092 | 3300018469 | Soil | GLTRAALERLEIEEPDAAAALHRWLATTLSVRLTDSQRAYLTLLD |
Ga0190270_112100872 | 3300018469 | Soil | IERLEAEEPELAAALHRWLATQLAERLTDTMRTFDVLLD |
Ga0190271_114199052 | 3300018481 | Soil | ASIERLEAEEPELAAALHRWLATTLAERLSDTLRSFDALLD |
Ga0184643_11596172 | 3300019255 | Groundwater Sediment | EVPSVVLALSRASIERLEAEEPARAAALHRWLATTLAVRLTDAQRVYSALLD |
Ga0184642_11206112 | 3300019279 | Groundwater Sediment | EAQEPELAATLHRWLATTLAERLTDTMRTFDVLLD |
Ga0190264_112731872 | 3300019377 | Soil | ERLEAEEPELAAALHRWLARTLAERLTDTMRTFDVLLD |
Ga0193745_11103332 | 3300020059 | Soil | IERMEATEPELAAALHRWLATTLSERLTDTQRAVMALFD |
Ga0196963_103899572 | 3300020215 | Soil | GRMQAEDPALAAAVHRGLASTLAERLGDTLKLFDALAD |
Ga0210382_1000163311 | 3300021080 | Groundwater Sediment | ERLEAEEPELAATLHRWLATTLAERLSDARGVLDALLD |
Ga0210379_103466392 | 3300021081 | Groundwater Sediment | MEADEPELAAAVHRWLARTLSERLTDTLREFDALLD |
Ga0210379_103743592 | 3300021081 | Groundwater Sediment | ERVEAADPALAAALHRWLATTLSERLGESLRAFDALFD |
Ga0224510_104514172 | 3300022309 | Sediment | SISRLEAEQPELAAEFHRWLATALADRLSDTMRTFDALVDQT |
Ga0222622_104457701 | 3300022756 | Groundwater Sediment | DVIAELPSVVLTLSRASIQRLEAEEPATAAALHRWLATTLAVRLTDAQRVYSALLD |
Ga0209520_100803432 | 3300025319 | Soil | LRLRRPAIERLESEEPELAAALHRWLAGTLAERLTDTQRAVEALFD |
Ga0207687_113314491 | 3300025927 | Miscanthus Rhizosphere | SIRRLEAEEPATAAALHRWLATTLAVRLTDAQRVYSALLD |
Ga0207668_105207381 | 3300025972 | Switchgrass Rhizosphere | RLDRASIARIESEDPALASAMHRWLGGVLSERLSDTLREFDALLD |
Ga0208419_10316531 | 3300026032 | Natural And Restored Wetlands | IEAEDPEAAAALHRWLAGTLAERLDDTMRGFDALID |
Ga0208293_10145332 | 3300026050 | Natural And Restored Wetlands | VNLGRRRRVVVETPSVVLRLSEASIERLEADEPETAAALHRWLASTLAVRLTAADRAYSASMD |
Ga0207676_100221631 | 3300026095 | Switchgrass Rhizosphere | AIERMETDDPELAAALHRWLAATIAGRLGESLLAFDALFD |
Ga0208914_10299221 | 3300026102 | Natural And Restored Wetlands | PSMVLRLRRSAIERLEAEEPEEAAALHRWVAGTLAERLTDTQRAVDALFD |
Ga0209807_13369791 | 3300026530 | Soil | LALSRASIERLEAEEPVKAAALHRWLATTLAVRLTDAQRVYSALLD |
Ga0209161_103478151 | 3300026548 | Soil | ASIEQMEAAEPELAAALHRWLAETLAERLSDASRAFDALLD |
Ga0209474_100783993 | 3300026550 | Soil | LRLSRESIERMEAEEPEVAAALHRWLATTLAERLNDTQRAFDALLE |
Ga0209861_10176803 | 3300027332 | Groundwater Sand | ESIERVEAADPALAAALHRWLATTLSERLGESLRAFDALFD |
Ga0207981_10511972 | 3300027560 | Soil | VAETPSVVLRFSRASIERLERAEPALAAALHRWLATTLSERLTDTQRAAMVLFD |
Ga0207428_107903511 | 3300027907 | Populus Rhizosphere | SIERLEAEEPETAAMLHRWLATTLAERLTDTMGVVDALLD |
Ga0207428_109612491 | 3300027907 | Populus Rhizosphere | RMETDDPELAAALHRWLATTIAGRLGESLLAFDALFD |
Ga0209078_11135133 | 3300027955 | Freshwater Sediment | ARMDADEPEVAAALHRWLATTLADRLNETLRAADALLD |
(restricted) Ga0233417_104316481 | 3300028043 | Sediment | EQMEVARPELAAELHRWLATTLSERLTETLRAYDALLD |
Ga0268264_108960301 | 3300028381 | Switchgrass Rhizosphere | IERMEAEDPELAAALHRWLATTLAGRLSESLKAFDALFD |
Ga0307311_102739881 | 3300028716 | Soil | ESIERLEAEEPELAATLHRWLATTLAERLSDTRGALDALLD |
Ga0307319_103183631 | 3300028722 | Soil | LEAQEPELAAALHRWLATQLAERLTDTLEAVDALLD |
Ga0307323_102602791 | 3300028787 | Soil | DRASIDRIEAEDPALASAMHRWLAGVLSERLSDTLREFDALLD |
Ga0307290_102470922 | 3300028791 | Soil | QIEAEEPELAAALHRWLAGILSERLRDTLREFDALLD |
Ga0307290_103619401 | 3300028791 | Soil | LRLSRAAIARLETEEPELAAALHRWLATTMALRLTDRMRALDALLD |
Ga0307299_100826051 | 3300028793 | Soil | LEAEEPELAATLHRWLATTLAERLSDARGVLDALLD |
Ga0307299_101193061 | 3300028793 | Soil | RRLEAEEPATAAALHRWLATTLAVRLTDAQRVYSALLD |
Ga0307294_102266172 | 3300028810 | Soil | IDRIEAEDPALASAMHRWLAGVLSERLSDTLREFDALLD |
Ga0307292_100039221 | 3300028811 | Soil | IARIEAEDPALASAMHRWLAGVLSERLSDTLREFDALLD |
Ga0307292_100680682 | 3300028811 | Soil | SIDRIEAEDPALASAMHRWLAGVLSERLSDTLREFDALLD |
Ga0307296_100194646 | 3300028819 | Soil | IAEVPSVVLTLSRASIQRLETEEPATAAALHRWLATTLAVRLTDAQRVYSALLD |
Ga0307310_102063923 | 3300028824 | Soil | ASIQRLEAEEPATAAALHRWLATTLAVRLTDAQRVYSALLD |
Ga0307310_102311422 | 3300028824 | Soil | LEAEEPEAAAAMHRWLATTLAVRLTDSQRAYSALLD |
Ga0307312_103118883 | 3300028828 | Soil | LTLSRDSIQRLEAEEPATAAALHRWLATALAVRLTDAQRVYSALLD |
Ga0307314_100627953 | 3300028872 | Soil | LEAEEPATAAALHRWLATTLAVRLTDAQRVYSALLD |
Ga0307289_100166036 | 3300028875 | Soil | EVPSVVLTLSRASIQRLEAEEPATAAALHRWLATTLAVRLTDAQRVYSALLD |
Ga0307278_100395443 | 3300028878 | Soil | EQLEADEPELAAALHRWLARTLAERLGDTLKGFDALLD |
Ga0307278_101051171 | 3300028878 | Soil | ERLEAEEPATAAALHRWLAVTLAVRLTDAQRVYSALLD |
Ga0307278_103890171 | 3300028878 | Soil | IVVLRFSRESIARMETEEPEVAAAMHRWLATTLAERLHETLRAVDALLD |
Ga0307308_106129731 | 3300028884 | Soil | TPSVVLRLSRASLERLEAEEPETAAALHRWLATTLAHRLTDSQRAFSALLD |
Ga0299907_100248991 | 3300030006 | Soil | VIERLEAEEPELAAALHRWLATTLAERLTDSMRSFDMLLD |
Ga0299907_101432001 | 3300030006 | Soil | VVLRIGRESIERLEAEEPELAAALHRWLATTLAERLTDTRGAVDALLD |
Ga0299907_103293632 | 3300030006 | Soil | IRRMEADEPELAAAVHRWLARTLSERLTDTLREFDALLD |
Ga0299907_106276142 | 3300030006 | Soil | EQIARMEAEDPDVAARLHRWLAGTLADRLGDTMRTFDALLD |
Ga0308178_10697281 | 3300030990 | Soil | ADVIAEVPSVVLTLSRASIQRLETEEPATAAALHRWLATTLAVRLTDAQRVYSALLD |
Ga0299914_116043752 | 3300031228 | Soil | VPSVALRIGRESIERLEAEEPELAAALHRWLATTLAERLTDTMRTFDVLLD |
Ga0299913_100332541 | 3300031229 | Soil | SIRRLEAEQPELAAEFHRWLATALADRLSDTMRTFDALVDQT |
Ga0299913_118248252 | 3300031229 | Soil | RCSREQIERMEAEDPDVAAGLHRWLAGTIAYRLGDTMRTFDVLLD |
Ga0247727_100652907 | 3300031576 | Biofilm | IERLEAEEPELAAALHRWLATTLAERLTDTLGVVDALLE |
Ga0307405_111666421 | 3300031731 | Rhizosphere | EAGEPELAAALHRWFATTLAQRLTGATQAFDTLLD |
Ga0310907_107860521 | 3300031847 | Soil | ETPSVVMQLGRASIERIEATEPALAAALHRWLATTLSERLTETQRAVMALFD |
Ga0310904_103403891 | 3300031854 | Soil | RIEAEDPELAGALHRWLAGILSERLRDTLREFDALLE |
Ga0214473_119350782 | 3300031949 | Soil | EAEEPEMAAALHRWLARTLAERLSDTMKAFDALFD |
Ga0310899_103836081 | 3300032017 | Soil | CVVLGLSRSSIERLEAEEPETAAALHRWLATTLAVRLTDADRAYSASMD |
Ga0315273_116492961 | 3300032516 | Sediment | PSVVLVLSRDSLEHLEAEEPETAAALHRWLATTLSERLTDADRSISSLLD |
Ga0316622_1006635252 | 3300033416 | Soil | MEAEEPEVATALHRWLATTLADRLNETLRAADALLD |
Ga0247830_100225004 | 3300033551 | Soil | RRLETEQPEVAAEFHRWLATALADRLSDTMRTFDALVDQT |
Ga0247830_100493541 | 3300033551 | Soil | ERIAGLEATDPETAAALHRWLAGTLAGRLQDTMRTFDALID |
Ga0364931_0019726_1764_1889 | 3300034176 | Sediment | ASIEQIEAEEPDLAAALHRWLAGILSERLRDTLREFDALLD |
Ga0370495_0141587_4_114 | 3300034257 | Untreated Peat Soil | METAEPALAAALHRWLATTLSERLTDTQRAVGTLLD |
⦗Top⦘ |