Basic Information | |
---|---|
Family ID | F036135 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 170 |
Average Sequence Length | 40 residues |
Representative Sequence | EGISDLVMEIACGLHNLRVSCRHPFPTFDVLSLVSSG |
Number of Associated Samples | 106 |
Number of Associated Scaffolds | 170 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.18 % |
% of genes near scaffold ends (potentially truncated) | 97.65 % |
% of genes from short scaffolds (< 2000 bps) | 91.76 % |
Associated GOLD sequencing projects | 103 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.34 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (88.235 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.588 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.235 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.941 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.00% β-sheet: 0.00% Coil/Unstructured: 60.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 170 Family Scaffolds |
---|---|---|
PF02371 | Transposase_20 | 2.35 |
PF13610 | DDE_Tnp_IS240 | 1.76 |
PF13546 | DDE_5 | 1.76 |
PF01548 | DEDD_Tnp_IS110 | 1.18 |
PF13340 | DUF4096 | 1.18 |
PF13358 | DDE_3 | 1.18 |
PF13518 | HTH_28 | 1.18 |
PF04986 | Y2_Tnp | 1.18 |
PF01609 | DDE_Tnp_1 | 1.18 |
PF00496 | SBP_bac_5 | 1.18 |
PF04255 | DUF433 | 1.18 |
PF07589 | PEP-CTERM | 0.59 |
PF00528 | BPD_transp_1 | 0.59 |
PF02417 | Chromate_transp | 0.59 |
PF01680 | SOR_SNZ | 0.59 |
PF13613 | HTH_Tnp_4 | 0.59 |
PF00239 | Resolvase | 0.59 |
PF01381 | HTH_3 | 0.59 |
PF01161 | PBP | 0.59 |
PF14522 | Cytochrome_C7 | 0.59 |
PF13614 | AAA_31 | 0.59 |
PF10049 | DUF2283 | 0.59 |
PF13005 | zf-IS66 | 0.59 |
PF07505 | DUF5131 | 0.59 |
PF13495 | Phage_int_SAM_4 | 0.59 |
PF17210 | SdrD_B | 0.59 |
PF13751 | DDE_Tnp_1_6 | 0.59 |
PF12762 | DDE_Tnp_IS1595 | 0.59 |
PF01610 | DDE_Tnp_ISL3 | 0.59 |
PF13683 | rve_3 | 0.59 |
PF01553 | Acyltransferase | 0.59 |
PF08849 | BrxA | 0.59 |
PF01103 | Omp85 | 0.59 |
PF08240 | ADH_N | 0.59 |
PF09250 | Prim-Pol | 0.59 |
PF02899 | Phage_int_SAM_1 | 0.59 |
PF00920 | ILVD_EDD | 0.59 |
PF14224 | DUF4331 | 0.59 |
PF07693 | KAP_NTPase | 0.59 |
PF13586 | DDE_Tnp_1_2 | 0.59 |
PF00072 | Response_reg | 0.59 |
PF00106 | adh_short | 0.59 |
PF02604 | PhdYeFM_antitox | 0.59 |
PF08708 | PriCT_1 | 0.59 |
PF13432 | TPR_16 | 0.59 |
PF01943 | Polysacc_synt | 0.59 |
PF05016 | ParE_toxin | 0.59 |
PF11104 | PilM_2 | 0.59 |
PF00140 | Sigma70_r1_2 | 0.59 |
PF00078 | RVT_1 | 0.59 |
PF02384 | N6_Mtase | 0.59 |
PF05598 | DUF772 | 0.59 |
PF10370 | DUF2437 | 0.59 |
PF03050 | DDE_Tnp_IS66 | 0.59 |
PF03235 | DUF262 | 0.59 |
PF08483 | Obsolete Pfam Family | 0.59 |
PF07992 | Pyr_redox_2 | 0.59 |
PF06733 | DEAD_2 | 0.59 |
PF11381 | DUF3185 | 0.59 |
PF04754 | Transposase_31 | 0.59 |
PF04773 | FecR | 0.59 |
PF00230 | MIP | 0.59 |
PF07978 | NIPSNAP | 0.59 |
PF01717 | Meth_synt_2 | 0.59 |
PF01909 | NTP_transf_2 | 0.59 |
PF04280 | Tim44 | 0.59 |
PF02661 | Fic | 0.59 |
PF00589 | Phage_integrase | 0.59 |
COG ID | Name | Functional Category | % Frequency in 170 Family Scaffolds |
---|---|---|---|
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 3.53 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 1.18 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 1.18 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 1.18 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 1.18 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 1.18 |
COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 1.18 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 1.18 |
COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 1.18 |
COG1199 | Rad3-related DNA helicase DinG | Replication, recombination and repair [L] | 1.18 |
COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.59 |
COG0214 | Pyridoxal 5'-phosphate synthase subunit PdxS | Coenzyme transport and metabolism [H] | 0.59 |
COG5464 | Recombination-promoting DNA endonuclease RpnC/YadD | Replication, recombination and repair [L] | 0.59 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.59 |
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.59 |
COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.59 |
COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.59 |
COG4928 | Predicted P-loop ATPase, KAP-like | General function prediction only [R] | 0.59 |
COG4422 | Bacteriophage protein gp37 | Mobilome: prophages, transposons [X] | 0.59 |
COG4395 | Predicted lipid-binding transport protein, Tim44 family | Lipid transport and metabolism [I] | 0.59 |
COG2059 | Chromate transport protein ChrA | Inorganic ion transport and metabolism [P] | 0.59 |
COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.59 |
COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.59 |
COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.59 |
COG1479 | DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains | Defense mechanisms [V] | 0.59 |
COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 0.59 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.59 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.59 |
COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.59 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 88.82 % |
Unclassified | root | N/A | 11.18 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005295|Ga0065707_10044582 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 850 | Open in IMG/M |
3300005295|Ga0065707_10260274 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
3300005295|Ga0065707_11117936 | All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Mesoaciditogales → Mesoaciditogaceae → Mesoaciditoga → Mesoaciditoga lauensis | 512 | Open in IMG/M |
3300005332|Ga0066388_100542561 | All Organisms → cellular organisms → Bacteria | 1793 | Open in IMG/M |
3300005332|Ga0066388_100686164 | All Organisms → cellular organisms → Bacteria | 1633 | Open in IMG/M |
3300005332|Ga0066388_100857273 | Not Available | 1493 | Open in IMG/M |
3300005332|Ga0066388_100995306 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
3300005332|Ga0066388_101529038 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
3300005332|Ga0066388_102704857 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300005332|Ga0066388_106121465 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 607 | Open in IMG/M |
3300005332|Ga0066388_106199416 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 604 | Open in IMG/M |
3300005353|Ga0070669_101325133 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300005445|Ga0070708_100509206 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
3300005467|Ga0070706_101192861 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300005471|Ga0070698_100415216 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
3300005518|Ga0070699_100934656 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
3300005536|Ga0070697_100273932 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1447 | Open in IMG/M |
3300005561|Ga0066699_10562454 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300005713|Ga0066905_101202000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Crenotrichaceae → Crenothrix → Crenothrix polyspora | 678 | Open in IMG/M |
3300005713|Ga0066905_101417867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Herpetosiphonales → Herpetosiphonaceae → Herpetosiphon → Herpetosiphon aurantiacus → Herpetosiphon aurantiacus DSM 785 | 629 | Open in IMG/M |
3300005719|Ga0068861_102018528 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300005764|Ga0066903_101119751 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1453 | Open in IMG/M |
3300005764|Ga0066903_101991337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1115 | Open in IMG/M |
3300005764|Ga0066903_104060509 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300005764|Ga0066903_108664629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 517 | Open in IMG/M |
3300005887|Ga0075292_1072330 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300006049|Ga0075417_10562261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 577 | Open in IMG/M |
3300006844|Ga0075428_101574219 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 687 | Open in IMG/M |
3300006845|Ga0075421_102156372 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300006847|Ga0075431_100321777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1559 | Open in IMG/M |
3300006847|Ga0075431_100700513 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
3300006853|Ga0075420_100252942 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1531 | Open in IMG/M |
3300006880|Ga0075429_101495516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 587 | Open in IMG/M |
3300006969|Ga0075419_10346323 | Not Available | 1010 | Open in IMG/M |
3300006969|Ga0075419_10426446 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300006969|Ga0075419_11026682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 601 | Open in IMG/M |
3300006969|Ga0075419_11295001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 541 | Open in IMG/M |
3300007004|Ga0079218_12059279 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300007255|Ga0099791_10680258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 506 | Open in IMG/M |
3300007258|Ga0099793_10150875 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
3300009012|Ga0066710_101483492 | Not Available | 1047 | Open in IMG/M |
3300009089|Ga0099828_10228182 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1665 | Open in IMG/M |
3300009089|Ga0099828_10377295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1278 | Open in IMG/M |
3300009089|Ga0099828_10571945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1018 | Open in IMG/M |
3300009090|Ga0099827_10125424 | All Organisms → cellular organisms → Bacteria | 2073 | Open in IMG/M |
3300009090|Ga0099827_10385856 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
3300009100|Ga0075418_11905169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 647 | Open in IMG/M |
3300009137|Ga0066709_101162103 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
3300009147|Ga0114129_10144278 | All Organisms → cellular organisms → Bacteria | 3262 | Open in IMG/M |
3300009147|Ga0114129_13161511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 537 | Open in IMG/M |
3300009156|Ga0111538_10497359 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1546 | Open in IMG/M |
3300009156|Ga0111538_12400500 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300009169|Ga0105097_10740494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 558 | Open in IMG/M |
3300009553|Ga0105249_10491895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1271 | Open in IMG/M |
3300009553|Ga0105249_10650764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1111 | Open in IMG/M |
3300009553|Ga0105249_11716699 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 700 | Open in IMG/M |
3300009691|Ga0114944_1298090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 663 | Open in IMG/M |
3300009792|Ga0126374_10557186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 838 | Open in IMG/M |
3300009815|Ga0105070_1134480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 504 | Open in IMG/M |
3300009840|Ga0126313_11071988 | Not Available | 662 | Open in IMG/M |
3300010043|Ga0126380_10359232 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
3300010043|Ga0126380_10470943 | Not Available | 955 | Open in IMG/M |
3300010043|Ga0126380_10854871 | Not Available | 751 | Open in IMG/M |
3300010046|Ga0126384_12037501 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300010046|Ga0126384_12379791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 512 | Open in IMG/M |
3300010047|Ga0126382_10369443 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium | 1107 | Open in IMG/M |
3300010047|Ga0126382_10419640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1050 | Open in IMG/M |
3300010047|Ga0126382_11194281 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300010047|Ga0126382_11338742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Colwelliaceae → Thalassomonas | 650 | Open in IMG/M |
3300010047|Ga0126382_11519990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 617 | Open in IMG/M |
3300010047|Ga0126382_11628714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 600 | Open in IMG/M |
3300010047|Ga0126382_11861590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 568 | Open in IMG/M |
3300010145|Ga0126321_1301237 | All Organisms → cellular organisms → Bacteria | 2111 | Open in IMG/M |
3300010333|Ga0134080_10226343 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300010358|Ga0126370_11105161 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 731 | Open in IMG/M |
3300010359|Ga0126376_10542305 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
3300010360|Ga0126372_10033117 | All Organisms → cellular organisms → Bacteria | 3278 | Open in IMG/M |
3300010361|Ga0126378_12706221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 567 | Open in IMG/M |
3300010362|Ga0126377_13160632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 532 | Open in IMG/M |
3300010362|Ga0126377_13389915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 515 | Open in IMG/M |
3300010366|Ga0126379_11350954 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300010366|Ga0126379_11485686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 783 | Open in IMG/M |
3300010366|Ga0126379_11921745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 695 | Open in IMG/M |
3300010366|Ga0126379_13152849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 552 | Open in IMG/M |
3300011270|Ga0137391_10219296 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1652 | Open in IMG/M |
3300012094|Ga0136638_10041134 | All Organisms → cellular organisms → Bacteria | 1866 | Open in IMG/M |
3300012189|Ga0137388_11311198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 663 | Open in IMG/M |
3300012189|Ga0137388_11661832 | Not Available | 573 | Open in IMG/M |
3300012198|Ga0137364_10095701 | All Organisms → cellular organisms → Bacteria | 2082 | Open in IMG/M |
3300012204|Ga0137374_10293004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1339 | Open in IMG/M |
3300012205|Ga0137362_11269627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 621 | Open in IMG/M |
3300012206|Ga0137380_10532638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1032 | Open in IMG/M |
3300012210|Ga0137378_10865686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 816 | Open in IMG/M |
3300012210|Ga0137378_11784594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 519 | Open in IMG/M |
3300012211|Ga0137377_11126996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 714 | Open in IMG/M |
3300012211|Ga0137377_11904377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 512 | Open in IMG/M |
3300012212|Ga0150985_117347881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 855 | Open in IMG/M |
3300012349|Ga0137387_10587219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 808 | Open in IMG/M |
3300012349|Ga0137387_10596188 | Not Available | 801 | Open in IMG/M |
3300012351|Ga0137386_11273347 | Not Available | 511 | Open in IMG/M |
3300012353|Ga0137367_10212097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1400 | Open in IMG/M |
3300012357|Ga0137384_10199534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1674 | Open in IMG/M |
3300012357|Ga0137384_10412435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1114 | Open in IMG/M |
3300012357|Ga0137384_10586034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 911 | Open in IMG/M |
3300012359|Ga0137385_10123817 | All Organisms → cellular organisms → Bacteria | 2281 | Open in IMG/M |
3300012359|Ga0137385_10603408 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 922 | Open in IMG/M |
3300012361|Ga0137360_10165790 | All Organisms → cellular organisms → Bacteria | 1765 | Open in IMG/M |
3300012362|Ga0137361_10924548 | Not Available | 790 | Open in IMG/M |
3300012363|Ga0137390_11600822 | Not Available | 589 | Open in IMG/M |
3300012363|Ga0137390_11693725 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 567 | Open in IMG/M |
3300012469|Ga0150984_122293960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 867 | Open in IMG/M |
3300012682|Ga0136611_10061563 | All Organisms → cellular organisms → Bacteria | 2671 | Open in IMG/M |
3300012685|Ga0137397_11156330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 560 | Open in IMG/M |
3300012944|Ga0137410_12068344 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300012971|Ga0126369_10036418 | All Organisms → cellular organisms → Bacteria | 4094 | Open in IMG/M |
3300012971|Ga0126369_10109893 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2516 | Open in IMG/M |
3300012971|Ga0126369_10742697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1061 | Open in IMG/M |
3300012971|Ga0126369_11622386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter bradus | 736 | Open in IMG/M |
3300012971|Ga0126369_12219997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
3300012971|Ga0126369_13034888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 550 | Open in IMG/M |
3300013306|Ga0163162_10364012 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
3300013306|Ga0163162_10647821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1180 | Open in IMG/M |
3300016387|Ga0182040_11542759 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300016445|Ga0182038_12180542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 502 | Open in IMG/M |
3300018063|Ga0184637_10059577 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2334 | Open in IMG/M |
3300018063|Ga0184637_10283269 | Not Available | 1006 | Open in IMG/M |
3300018063|Ga0184637_10660452 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300018076|Ga0184609_10217380 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
3300018089|Ga0187774_11275375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 531 | Open in IMG/M |
3300019249|Ga0184648_1312853 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300019249|Ga0184648_1435068 | Not Available | 522 | Open in IMG/M |
3300020003|Ga0193739_1115775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 668 | Open in IMG/M |
3300025157|Ga0209399_10072436 | Not Available | 1407 | Open in IMG/M |
3300025157|Ga0209399_10429726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 510 | Open in IMG/M |
3300025922|Ga0207646_10102758 | All Organisms → cellular organisms → Bacteria | 2563 | Open in IMG/M |
3300025972|Ga0207668_10388064 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
3300025972|Ga0207668_11985277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 524 | Open in IMG/M |
3300027577|Ga0209874_1118571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 618 | Open in IMG/M |
3300027750|Ga0209461_10105917 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300027873|Ga0209814_10206326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Okeania → unclassified Okeania → Okeania sp. SIO3B3 | 849 | Open in IMG/M |
3300027882|Ga0209590_10733561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 631 | Open in IMG/M |
3300027882|Ga0209590_11069660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 500 | Open in IMG/M |
3300027907|Ga0207428_11155767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 540 | Open in IMG/M |
3300030523|Ga0272436_1033339 | All Organisms → cellular organisms → Eukaryota | 3009 | Open in IMG/M |
3300030523|Ga0272436_1074457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 1374 | Open in IMG/M |
3300031093|Ga0308197_10071347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 958 | Open in IMG/M |
3300031544|Ga0318534_10404303 | Not Available | 784 | Open in IMG/M |
3300031562|Ga0310886_10006289 | All Organisms → cellular organisms → Bacteria | 4104 | Open in IMG/M |
3300031572|Ga0318515_10528945 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 629 | Open in IMG/M |
3300031731|Ga0307405_10119008 | Not Available | 1804 | Open in IMG/M |
3300031858|Ga0310892_10480934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 824 | Open in IMG/M |
3300031910|Ga0306923_10477173 | All Organisms → cellular organisms → Bacteria | 1412 | Open in IMG/M |
3300031910|Ga0306923_10521164 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
3300031912|Ga0306921_10640920 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
3300031912|Ga0306921_11049169 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 917 | Open in IMG/M |
3300031912|Ga0306921_11767762 | Not Available | 666 | Open in IMG/M |
3300031944|Ga0310884_10034311 | Not Available | 2170 | Open in IMG/M |
3300031944|Ga0310884_10847309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 561 | Open in IMG/M |
3300031947|Ga0310909_10482602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1040 | Open in IMG/M |
3300031995|Ga0307409_101224962 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300032159|Ga0268251_10402364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 593 | Open in IMG/M |
3300032164|Ga0315283_11040795 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
3300032180|Ga0307471_103895278 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 528 | Open in IMG/M |
3300032261|Ga0306920_101257908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1067 | Open in IMG/M |
3300032261|Ga0306920_103106340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 624 | Open in IMG/M |
3300032261|Ga0306920_104367999 | Not Available | 507 | Open in IMG/M |
3300032397|Ga0315287_10975361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 988 | Open in IMG/M |
3300033760|Ga0314870_005155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 940 | Open in IMG/M |
3300034678|Ga0314803_134894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 513 | Open in IMG/M |
3300034680|Ga0370541_001968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1598 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.59% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 17.06% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.59% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.24% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.88% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.94% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.35% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 1.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.76% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.76% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.76% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.76% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.18% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.18% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.18% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.18% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.18% |
Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 1.18% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.18% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.18% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.59% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.59% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.59% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.59% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.59% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.59% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.59% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.59% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.59% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.59% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.59% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.59% |
Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.59% |
Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.59% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005887 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009691 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012094 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ858 (22.06) | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012682 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ223 (23.06) | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
3300025157 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300030523 | Rock endolithic microbial communities from Victoria Land, Antarctica - Richard Nunatak white sandstone | Environmental | Open in IMG/M |
3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300033760 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_C | Environmental | Open in IMG/M |
3300034678 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034680 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0065707_100445821 | 3300005295 | Switchgrass Rhizosphere | DVLRLTTTGIADLVMEIACGLHNLRVSCRHPLPLFDLMSFCSDA* |
Ga0065707_102602743 | 3300005295 | Switchgrass Rhizosphere | KDVLRLTKEGISDRVMEIACGLHNLRLTCRHPLLAFDLLSFCGSI* |
Ga0065707_111179361 | 3300005295 | Switchgrass Rhizosphere | LRLTKTGIADMVMEIACGLHNLRVSCRHPLPTFDVLSLINSS* |
Ga0066388_1005425612 | 3300005332 | Tropical Forest Soil | LTTEGISDVVMEIACGLHNLRVSYRHPLLVLDLLSWVNST* |
Ga0066388_1006861643 | 3300005332 | Tropical Forest Soil | LRLTKAGMSDMVMEIACGLHNLRVSCRHPLPTFDVRSLISAG* |
Ga0066388_1008572732 | 3300005332 | Tropical Forest Soil | TTEGISDRVMEIACGLHNRRVSCRHPLPAFEVRSLVNSG* |
Ga0066388_1009953061 | 3300005332 | Tropical Forest Soil | VLRLTKEGISDRVMEIACGLHNLRVACRHPLPAFDLLSFCGSI* |
Ga0066388_1015290381 | 3300005332 | Tropical Forest Soil | KDVLRLTKTGISDMVMEIACGLHNLRVSCRHPLPTFDVLSLVNSS* |
Ga0066388_1027048571 | 3300005332 | Tropical Forest Soil | VKDVLRLTKGGISDMVMEIACGLHNLRVSCRHPLPTFDVLSLLNSS* |
Ga0066388_1061214652 | 3300005332 | Tropical Forest Soil | LRLTTTGIADLVMEIACGLHNLRVSCRHPLPAFDLMSFWSDA* |
Ga0066388_1061994161 | 3300005332 | Tropical Forest Soil | RLTTAGMSDLVMEIACGLHNLRVSCRHPLPTFDVRSLINFG* |
Ga0070669_1013251331 | 3300005353 | Switchgrass Rhizosphere | DVLRLTKAGISDLIMEIACGLHNLRASCRHPLPAFDVLSLISSE* |
Ga0070708_1005092061 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | TKRGVSDLVMAIACGLPNLRVSYRHPLPTFDVLSLLNSG* |
Ga0070706_1011928613 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LRLTKEGLSDLVMEIACGLHNLRVSCRHPFPTCDVLSLISSG* |
Ga0070698_1004152161 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | DVLRLTTEGMADQVTKIACGLPNLRVSSRHPVAAFTLLSLASSG* |
Ga0070699_1009346561 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | TTPGISDVVREIACGLHNLRVSSRHLLPTFDVWNWLSSA* |
Ga0070697_1002739321 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VLRLTTPGISDVVMEIACGLHNLRVSCRHPLPMFDVRNWLSSA* |
Ga0066699_105624541 | 3300005561 | Soil | LRLTQEGMSDMVMEIACGLHNLRVSCRHPLPAFALLGLISTG* |
Ga0066905_1012020001 | 3300005713 | Tropical Forest Soil | GIADLVMEIACGLHNLRVSCRHPLPLFDLMSFCSDA* |
Ga0066905_1014178672 | 3300005713 | Tropical Forest Soil | SDVVMEIACGLHNLRVSYRHPLLVLDLLSWVNST* |
Ga0068861_1020185281 | 3300005719 | Switchgrass Rhizosphere | LTTAGISDLVMEIACGLHNLRVSCRHPFPAFDVLSLLGSG* |
Ga0066903_1011197512 | 3300005764 | Tropical Forest Soil | VKDVLRLTTAGMSDLVMEIACGLHNLRVSCRHPLPTFAVRSLINFG* |
Ga0066903_1019913372 | 3300005764 | Tropical Forest Soil | LTTKGIADVVMEIACGLHNLRVSCRHPLPTLDLLSWVNSR* |
Ga0066903_1040605093 | 3300005764 | Tropical Forest Soil | SDLVMEIACGLHNLRVSCRHPLPTFDVRSLINFG* |
Ga0066903_1086646291 | 3300005764 | Tropical Forest Soil | SDMVMEIACGLHNLRVSCRHPLPTFDVWSLLNSG* |
Ga0075292_10723302 | 3300005887 | Rice Paddy Soil | RLTKEGVSDLVMEIACGLHNLRVSCRHPLPVFDVLRLVDTS* |
Ga0075417_105622612 | 3300006049 | Populus Rhizosphere | SDMVMEIACGLHNLRVSCRHPLPTFDVRSLISSG* |
Ga0075428_1015742194 | 3300006844 | Populus Rhizosphere | VTDVLRLTTEGISDLVMEIACGLHNLRVSCRHPFPAFDGLSLLGSG* |
Ga0075421_1021563722 | 3300006845 | Populus Rhizosphere | RLTKGGISDMVMEIACGLHNLRVSCRHPLPTFDVLSLLNSS* |
Ga0075431_1003217772 | 3300006847 | Populus Rhizosphere | TEGISDLVMEIACGLHNLRVSCRHPFPAFDVLSLLGSASTR* |
Ga0075431_1007005131 | 3300006847 | Populus Rhizosphere | ADLVMEMACGLHNLRVSCRHPFPTFDVLSLLSSG* |
Ga0075420_1002529421 | 3300006853 | Populus Rhizosphere | ISDVVMEIACGLHNLRVSCRQPLPALDLLNWVNST* |
Ga0075429_1014955161 | 3300006880 | Populus Rhizosphere | EGISDRVMEIACGLHNLRVSCRHPLPAFDLLGFFGST* |
Ga0075419_103463233 | 3300006969 | Populus Rhizosphere | VLRLTTTGIADLVMEIACGLHHLRVSCRHPLPAFDLMSFWSDA* |
Ga0075419_104264462 | 3300006969 | Populus Rhizosphere | LTTKGISDVVMEIACGLHNLRVSCRQPLPALDLLNWVNST* |
Ga0075419_110266822 | 3300006969 | Populus Rhizosphere | EGISDLVMEIACGLPNLRVSCRHPFPAFDVLSLLGSG* |
Ga0075419_112950011 | 3300006969 | Populus Rhizosphere | ISDMVMEIACGLHNLRVSCRHPLPTFDVRSLISSG* |
Ga0079218_120592792 | 3300007004 | Agricultural Soil | LTKTGISDMVMEIACGLQNLRVSCRHPLPTFDVLSLVNSS* |
Ga0099791_106802582 | 3300007255 | Vadose Zone Soil | ISDLVMEIACGLHNLRVSCRHPFPTFDVLSLVSSG* |
Ga0099793_101508752 | 3300007258 | Vadose Zone Soil | ISDLVMEIACGLHNLRVSCRHPFPAFDVLSLCGSG* |
Ga0066710_1014834922 | 3300009012 | Grasslands Soil | LRLTTDGMSDLVMEIACGLHNLRVSCRHPLPIFDVLSLISSG |
Ga0099828_102281823 | 3300009089 | Vadose Zone Soil | FRLTKAGIADLVMEIACGLHNLRVSCRHPLPAFDVMSLVSSG* |
Ga0099828_103772953 | 3300009089 | Vadose Zone Soil | FRLTTAGIAALVMEIACGLHHLRVSCRHPFPAFDVLSLLGSG* |
Ga0099828_105719451 | 3300009089 | Vadose Zone Soil | DVLRLTTEGLSDLVMEIACGLHNLRVSCRHPFPTFDVLSLASSG* |
Ga0099827_101254244 | 3300009090 | Vadose Zone Soil | ADLVMEIACGLHNLRVSCRHPFPTFDVLSLVSYG* |
Ga0099827_103858562 | 3300009090 | Vadose Zone Soil | SDLVMEIACGLHNLRVSCRHPFPTCDVLSLVSSG* |
Ga0075418_119051691 | 3300009100 | Populus Rhizosphere | DGSADLVMEVACGLHNFRVSCRHPLPTFDVLSLVSSG* |
Ga0066709_1011621032 | 3300009137 | Grasslands Soil | MVKEVLRLTTDGMSDLVMEIACGLHNLRVSCRHPLPIFDVLSLISSG* |
Ga0114129_101442781 | 3300009147 | Populus Rhizosphere | DVLRLTKEGISDRVMEIACGLHNLRVSCRHPLPAFDLLSFCGSI* |
Ga0114129_131615112 | 3300009147 | Populus Rhizosphere | ISDRVMEIACGLHNLRVSCRRPLPTFDVLSLLSSG* |
Ga0111538_104973591 | 3300009156 | Populus Rhizosphere | TTKGISDVVMEIACGLHNLRVSCRQPLPALDLLNWVNST* |
Ga0111538_124005002 | 3300009156 | Populus Rhizosphere | LRLTTEGTSDLVMEIACGLHNLRVSCRHPFPAFDVLSLLSSG* |
Ga0105097_107404943 | 3300009169 | Freshwater Sediment | VKDVLRLTKKGISDVVMEIACGLHNLRVDCRHPLPEFDLRKLT* |
Ga0105249_104918951 | 3300009553 | Switchgrass Rhizosphere | TDVLRLTTAGISDLVMEIACGLHNLRVSCRHPFPAFDVLRLLGSG* |
Ga0105249_106507641 | 3300009553 | Switchgrass Rhizosphere | GISDLVMEIACGLHNLRVSCRHPFPAFDVLSLLGSG* |
Ga0105249_117166991 | 3300009553 | Switchgrass Rhizosphere | ISDMVMEIACGLHNLRVSCRHPLPAFDVLSLINSS* |
Ga0114944_12980901 | 3300009691 | Thermal Springs | MSDLVMEIACGLHNLRVSCRHPFPIFEVLSLISSG* |
Ga0126374_105571862 | 3300009792 | Tropical Forest Soil | VKDVLRLTKEGISDRVMEIACGLHNLRVSCRHPLPAFDLLSLCGSI* |
Ga0105070_11344801 | 3300009815 | Groundwater Sand | ISDLVMEIACGLHNLRVSCRHPLPAFDLLSWVSSG* |
Ga0126313_110719883 | 3300009840 | Serpentine Soil | TEGISDRVMEIACGLHNFRISCRHPLPAFDLLSFFGST* |
Ga0126380_103592322 | 3300010043 | Tropical Forest Soil | SDMVMEIACGLHNVRVSCQHPLPTFDVWSLLNSG* |
Ga0126380_104709432 | 3300010043 | Tropical Forest Soil | LRLTNNGISDMVMEIACGLHNLRVSCRHPLPTFDVRSLLNST* |
Ga0126380_108548713 | 3300010043 | Tropical Forest Soil | ISDMVMEIACGLHNLRVSCRHPLLTFDVLSLINSS* |
Ga0126384_120375012 | 3300010046 | Tropical Forest Soil | MVTDVLRLTAEGLSTLVLEMACGLHNLRVHCRHPFPAFDVLSLLGSG* |
Ga0126384_123797911 | 3300010046 | Tropical Forest Soil | IVKDVLRLTKTGISDMVMEIACGLHNLRVSCRHPLPTFDVLSLVNSS* |
Ga0126382_103694432 | 3300010047 | Tropical Forest Soil | RLTTEGISDRVMEIACGLHHLRVACRHPLPAFDVLSFCGSI* |
Ga0126382_104196401 | 3300010047 | Tropical Forest Soil | KTGISDMVMEIACGLHNLRVSCRHPLPTFDVLSLGNSS* |
Ga0126382_111942811 | 3300010047 | Tropical Forest Soil | DVLRLTKTGISDMVMEIACGLHNLRVSCRHPLPTFDVLSLVNSS* |
Ga0126382_113387421 | 3300010047 | Tropical Forest Soil | DVLRLTKTGISDMVMEIACGLHNLRVSCRHPLPTFDVLSLGNSS* |
Ga0126382_115199901 | 3300010047 | Tropical Forest Soil | VKDVLRLTTVDIADWVMESAWGWHHRRVSCRHPLPAFDGRSFMRSG* |
Ga0126382_116287142 | 3300010047 | Tropical Forest Soil | VLRLTKTGIADMVMEIACGLQNLRVSCRHPLPTFDVLSLVNSS* |
Ga0126382_118615901 | 3300010047 | Tropical Forest Soil | TGISDMVMEIACGLHNLRVSCRHPLPTFDVLSLGNSS* |
Ga0126321_13012373 | 3300010145 | Soil | VVRWTTQGISAVVLEMAGGWHHLRVSCRHPLPALDVLSWV |
Ga0134080_102263432 | 3300010333 | Grasslands Soil | VKDILRLTTEGISDQVMEIACGLHNLRVSFRHPLPAFDLLSLISPG* |
Ga0126370_111051611 | 3300010358 | Tropical Forest Soil | TKGIADVVMEIACGLHNLRVFCRHPLPTLDLLSWVNST* |
Ga0126376_105423051 | 3300010359 | Tropical Forest Soil | MVTDVLRLTAEGLSTLVLEMACGLHNLRVHCRHPFPAFDV |
Ga0126372_100331171 | 3300010360 | Tropical Forest Soil | KDVLRLTKTGISDMVMEIACGLHNLRVSCRHPLPTFDVWSLLNSG* |
Ga0126378_127062211 | 3300010361 | Tropical Forest Soil | CRIVKDVLRLTTEGISDRVMEMACGVHNLRVACRHPLPAFDLLSFCGSI* |
Ga0126377_131606322 | 3300010362 | Tropical Forest Soil | SDRVMEIACGLHNLRVSCRHPLPVFDLLSLLSFA* |
Ga0126377_133899152 | 3300010362 | Tropical Forest Soil | STLVLEMACGLHNLRVHCRHPFPAFDVLSLLGSG* |
Ga0126379_113509542 | 3300010366 | Tropical Forest Soil | LTKEGISDRVMEIACGLHNLRVTCRHPLPAFDLLSFCGSI* |
Ga0126379_114856861 | 3300010366 | Tropical Forest Soil | SDMVMEIACGLHNLRVSCRHPLPTFDVLSLLNSS* |
Ga0126379_119217451 | 3300010366 | Tropical Forest Soil | VLRLTKEGISDRVMEIACGLHNLRVSCRHPLPAFDLLSFFGGT* |
Ga0126379_131528491 | 3300010366 | Tropical Forest Soil | DVLRLTTEGISDLVMEIACGLHNLRVSCRHPFPAFDVLSLLGSG* |
Ga0137391_102192961 | 3300011270 | Vadose Zone Soil | LRLTKAGMADLVMEIACGLHNLRVRCRHPLPTFDVLSLINSG* |
Ga0136638_100411343 | 3300012094 | Polar Desert Sand | ISDRVMVLACGLHNLRVSSRHPQSAFDLLNLVGSG* |
Ga0137388_113111982 | 3300012189 | Vadose Zone Soil | RLTTEAIADQVMEIACGLHNLRVSSRHPLPVFDLLSLGGSG* |
Ga0137388_116618322 | 3300012189 | Vadose Zone Soil | KEVLRLTTEGIADVVMEIACGLHNLRVSCRHPLPSFDVLSLLSSG* |
Ga0137364_100957014 | 3300012198 | Vadose Zone Soil | RLTKEGISDRVMEIACGLHNLRVSCRHPLPAFDLLSFCGNGHWFRFV* |
Ga0137374_102930043 | 3300012204 | Vadose Zone Soil | ADLVMERACGVHNLRVSCRHPFPAFDVVRLLGSG* |
Ga0137362_112696272 | 3300012205 | Vadose Zone Soil | VLRLTTEGISDLVMEIACGLHNLRVSCRHPFPTFDVLSLISPG* |
Ga0137380_105326381 | 3300012206 | Vadose Zone Soil | VKDVLRLTTSGISDMVMEIACGLPNLRVSCRHPLPTVDVLSLINSG* |
Ga0137378_108656862 | 3300012210 | Vadose Zone Soil | VLRLTTDGMADLVMEIACGLHNLRVSCRHPLATFDVLSLLRSG* |
Ga0137378_117845941 | 3300012210 | Vadose Zone Soil | SDLVMEIACGLHNLRVSCRHPFPTFDVLSLLSSG* |
Ga0137377_111269962 | 3300012211 | Vadose Zone Soil | VWRLTKAGMADLVMEIACGWHNLRVRCRHPLPTFDVLSLINPG* |
Ga0137377_119043771 | 3300012211 | Vadose Zone Soil | VWRLTKAGMADLVMEIACGWHNLRVRCRHPLPTFDVLSLINSG* |
Ga0150985_1173478812 | 3300012212 | Avena Fatua Rhizosphere | SDMVMEIACGLHNLRVSCRHPLPTFDVLSLINSS* |
Ga0137387_105872192 | 3300012349 | Vadose Zone Soil | GMAAMVMESACGLPNLRVSCRHLLPTFDVLSLINSG* |
Ga0137387_105961883 | 3300012349 | Vadose Zone Soil | VQDVLRLPTDGMADLVMEIACGLHNLRVSCRHALPTFDVLSLVSSG* |
Ga0137386_112733471 | 3300012351 | Vadose Zone Soil | RWRMVKYDLHLTKAGMSDLVMEISCGLHNPRVSCRHPFPTCDVLSLVSSG* |
Ga0137367_102120973 | 3300012353 | Vadose Zone Soil | IADLVMERACGVHNLRVSCRHPFPAFDVVRLLGSG* |
Ga0137384_101995341 | 3300012357 | Vadose Zone Soil | MSDLVMEIACGLHNLRVSCRHPFPTCDVLSLVSSG* |
Ga0137384_104124351 | 3300012357 | Vadose Zone Soil | DVLRLTKAGISDLVMEIACGLHNLRVSCRHPLPAFDLLSLVSSG* |
Ga0137384_105860343 | 3300012357 | Vadose Zone Soil | ISDLVMEIACGLHNLRVRCRHPFPAFDVLSLLSSG* |
Ga0137385_101238173 | 3300012359 | Vadose Zone Soil | LRLTKTGISDMVMEIACGLHNLRVSCRHPLPTFDVLSLVNSS* |
Ga0137385_106034083 | 3300012359 | Vadose Zone Soil | SDLVMEIACGLHNLRVSCRHPLPAFDLLSLVSSG* |
Ga0137360_101657901 | 3300012361 | Vadose Zone Soil | EGISDLVMEIACGLHNLRVSCRHPFPTFDVLSLVSSG* |
Ga0137361_109245481 | 3300012362 | Vadose Zone Soil | DVLRLTTEGISDLVMEIACGLHNLRVSCRHPFPTFDVLSLVSSG* |
Ga0137390_116008222 | 3300012363 | Vadose Zone Soil | SDLVMEIACGLHNLRVSCRHPLPTFDVLSLIHSG* |
Ga0137390_116937251 | 3300012363 | Vadose Zone Soil | ISDLVMEIACGLHNLRVSCRHPLPTFDVLSLIHSG* |
Ga0150984_1222939601 | 3300012469 | Avena Fatua Rhizosphere | ISDMVMEIACGLHNLRVSCRHPLPTFDVLSLINSS* |
Ga0136611_100615631 | 3300012682 | Polar Desert Sand | SDRVMEIACGLHNLRVSSRHPQPAFDLLNLVGAC* |
Ga0137397_111563301 | 3300012685 | Vadose Zone Soil | TEGISDLVMEIACGLHNLRVSCRHPFPAFDVLSLRGSG* |
Ga0137410_120683441 | 3300012944 | Vadose Zone Soil | SGCIGIVKDVLRLNTDGISDLVMEIACGLHNLRVSCRHPFPTFDVRSLLGSG* |
Ga0126369_100364181 | 3300012971 | Tropical Forest Soil | ISDMVMEIACGLHNVRVSCRHPLPTFDVWGLLNSG* |
Ga0126369_101098931 | 3300012971 | Tropical Forest Soil | ISDMVMEIACGLHNLRVSCRHPLPTFDVLSLLNSS* |
Ga0126369_107426972 | 3300012971 | Tropical Forest Soil | SDMVMEIACGLHNVRVSCRHPLPTFDVWSLLNSG* |
Ga0126369_116223862 | 3300012971 | Tropical Forest Soil | SDMVMEIACGLHNVRVSCRHPLPTFDVWGLLNSG* |
Ga0126369_122199971 | 3300012971 | Tropical Forest Soil | TKEGISDCVMEVACGLHNLRVSFRKPIQDFDLLSVFSPG* |
Ga0126369_130348881 | 3300012971 | Tropical Forest Soil | ECVSDLAMEIACGLHELRVSCRHPFPTFDVLSVLSSG* |
Ga0163162_103640124 | 3300013306 | Switchgrass Rhizosphere | TDVLRLTTAGISDLVMEIACGLHNLRVSCRHPFPAFDVLSLLGSG* |
Ga0163162_106478213 | 3300013306 | Switchgrass Rhizosphere | LTTAGISDLVMEIACGLHNLRVSCRHPFPAFDVLRLLGSG* |
Ga0182040_115427591 | 3300016387 | Soil | TAGMSDMVMEIACGLHNLRVSCRHPLPTFDVLSLLHSS |
Ga0182038_121805421 | 3300016445 | Soil | LTTAGISDLVMEIACGLHNLRVSCRHPFPAFDVLGLLGSG |
Ga0184637_100595771 | 3300018063 | Groundwater Sediment | KDVLRLTTDDISDLVMQIACGLHNLRVSCRHPLPTFDVLSLLSPG |
Ga0184637_102832691 | 3300018063 | Groundwater Sediment | GISDVVMEIACGLHNLRVSCRHPLPAFDVLSLVNAI |
Ga0184637_106604522 | 3300018063 | Groundwater Sediment | TDGISDLVMEIACGLHNLRVSCRHSLPTFDVLSLLSSG |
Ga0184609_102173801 | 3300018076 | Groundwater Sediment | VKDVLRLTTEGISDLVMEIACGLHNLRISCRHPLSAFDVRSLLSSA |
Ga0187774_112753751 | 3300018089 | Tropical Peatland | RLTKAGISDRVMEIACGLHNLRVSCRHPLPTLDLLSLAGSS |
Ga0184648_13128532 | 3300019249 | Groundwater Sediment | LRLTTKGISDVVMEIACGLPNLRVSCRHPLPAFDLLSFFGST |
Ga0184648_14350682 | 3300019249 | Groundwater Sediment | VKDVLRLTTEGISDLVMEIACGLHNFRVRCRHPFLTFDVLSLVSSG |
Ga0193739_11157752 | 3300020003 | Soil | IVKDVFRLTIEGMSDLVMEIACGLQNLRVSCRHPLPAFDVLSLVNGT |
Ga0209399_100724363 | 3300025157 | Thermal Springs | IVKDVLRLTTEGISDLVMEIACGLHNLRVSCRHPFPAFDVLSLLGSG |
Ga0209399_104297262 | 3300025157 | Thermal Springs | NSLPEIALRLTTEGLSDRVMEIACGLHNLRVSCRHPFPAFDVLSLLGSG |
Ga0207646_101027586 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | GISDVVMAIACGLHNLRVSCRHPLPMFDVRNWLSSA |
Ga0207668_103880643 | 3300025972 | Switchgrass Rhizosphere | IADMVMEIACGLHNLRVSCRHPLPTFDVLSLISSG |
Ga0207668_119852771 | 3300025972 | Switchgrass Rhizosphere | GISDLVMEIACGLHNLRVSCRHPFPAFDVLSLLGSG |
Ga0209874_11185711 | 3300027577 | Groundwater Sand | KDVLRLTTEGIADLVMEIACGLHNLRVSCRHPFPAFDVLSLLSPG |
Ga0209461_101059172 | 3300027750 | Agave | GVSDLVMEIACGLHNLRVSCRYPLPTFDVLSLISSG |
Ga0209814_102063261 | 3300027873 | Populus Rhizosphere | VKDVLRLTKEGISDRVMEIACGLHNLRVSCRHPLPAFDLLSFCGSI |
Ga0209590_107335612 | 3300027882 | Vadose Zone Soil | TTDGMSDLVMEIACGLHNLRVSCRHPLPIFDVLSLISSG |
Ga0209590_110696603 | 3300027882 | Vadose Zone Soil | IVKEVLRLTTEGISDLVMEIACDLHNLRVSCRHPLPTFDLVDLVISA |
Ga0207428_111557672 | 3300027907 | Populus Rhizosphere | RLTTKGISDVVMEIACGLHNLRVSCRQPLPALDLLNWVNST |
Ga0272436_10333394 | 3300030523 | Rock | ISDQVMEIACGLHNLRVSCRHPFTTLDVRDFVCPA |
Ga0272436_10744571 | 3300030523 | Rock | GISDQVMEIACGLHNLRVSCRHPFTTLDVRDFVCPA |
Ga0308197_100713471 | 3300031093 | Soil | ISDLVMEIACGLHNFRVSCRHPFPTFDVLSLISAG |
Ga0318534_104043031 | 3300031544 | Soil | VLRLTTDGISDLVMESACGLHNLRVSCRHPLLTFDLLCLLSSG |
Ga0310886_100062891 | 3300031562 | Soil | GISDRVMEIACGLHNLRVSCRHPLPVFDLLNLMGFA |
Ga0318515_105289451 | 3300031572 | Soil | VFRLTTAGMSDMVMEIACGLHNLRVSCRHPLPTFDVLSLLNSS |
Ga0307405_101190081 | 3300031731 | Rhizosphere | GISDVVMEIACGLHNLRVSCRHPLPALDLRSWVNSI |
Ga0310892_104809342 | 3300031858 | Soil | LRLTKAGMSDLVMEIACGLHNLRVSCRHPFPTFDVRSLLSSG |
Ga0306923_104771731 | 3300031910 | Soil | SSDLVMEIACGLHNLRVSCRHPFPTFDVLSLLSSG |
Ga0306923_105211643 | 3300031910 | Soil | ISDLVMEIACGLHNLRVSCRHPFPAFDVLSLLGSG |
Ga0306921_106409201 | 3300031912 | Soil | GMSDMVMEIACGLHNLRVSCRHPLPTFDVLSLLNSS |
Ga0306921_110491692 | 3300031912 | Soil | LTKTGISDMVMEIACGLHNLRVSCRHPLPTFDVLSLVNSS |
Ga0306921_117677621 | 3300031912 | Soil | GVSDMVMEIACGLHNLRVSCRHPFPPFDVRRLLNSS |
Ga0310884_100343112 | 3300031944 | Soil | VKDVLRLTKTGISDMVMEIACGLHNLRVSCRHPLPTFDVLSLFNSS |
Ga0310884_108473092 | 3300031944 | Soil | RLTTAGISDMVMEIACGLHNLRVSCRHPLPPFDVRSLLNSGYIR |
Ga0310909_104826022 | 3300031947 | Soil | RLTKAGMSDLVMEIACGLHNLRVSCRHPFPAFDVLSLLSSG |
Ga0307409_1012249621 | 3300031995 | Rhizosphere | ISDVVMEIACGLHNLRVSCRHPLPALDLLSWVNST |
Ga0268251_104023641 | 3300032159 | Agave | RQVKDVLRLTTEGISDRVMELACGLHNLRVSCRHPLPAFDVRSLMSSG |
Ga0315283_110407951 | 3300032164 | Sediment | ISDLVMEIACGLHNLRVSCRHPLPDFDLRNLLDPAYSR |
Ga0307471_1038952781 | 3300032180 | Hardwood Forest Soil | GISDRVMEIACGLHNLRVSCRHPLPAFDVLSFCGSI |
Ga0306920_1012579081 | 3300032261 | Soil | MSDLVMEIACGLHNLRVSCRHPFPTCDVLSLVSSG |
Ga0306920_1031063401 | 3300032261 | Soil | KEVWRLTKEGVSDLVMEVACGLHNLRVSCRHPWPMFDVLSLVDTG |
Ga0306920_1043679992 | 3300032261 | Soil | TKGGISDMIMEIACGLHNLRVSCRHPLPTFDVLSLLNSS |
Ga0315287_109753611 | 3300032397 | Sediment | TKEGISDLVLAIACGLPNLRVACRHPLPDFDLRYLLDPAYYR |
Ga0314870_005155_1_111 | 3300033760 | Peatland | GISDLVMEIACGLHNLRVSCRRPLPTFDLLSFDDSS |
Ga0314803_134894_316_459 | 3300034678 | Soil | MVKDVLRLTTEGISDRVMEIACGLHNLRVACRHPLPAFDLLSFFGSI |
Ga0370541_001968_1491_1598 | 3300034680 | Soil | TSDVVMEIACALHNLRVSIRHPLPTFDLLNFVSHA |
⦗Top⦘ |