NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F036121

Metagenome / Metatranscriptome Family F036121

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F036121
Family Type Metagenome / Metatranscriptome
Number of Sequences 170
Average Sequence Length 39 residues
Representative Sequence MLSPELSRKNNRLGLALFAIFVALFVGACVIALIYLQVD
Number of Associated Samples 125
Number of Associated Scaffolds 170

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 48.24 %
% of genes near scaffold ends (potentially truncated) 28.82 %
% of genes from short scaffolds (< 2000 bps) 87.65 %
Associated GOLD sequencing projects 114
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (57.647 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(15.882 % of family members)
Environment Ontology (ENVO) Unclassified
(34.706 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(45.882 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: Yes Secondary Structure distribution: α-helix: 52.24%    β-sheet: 0.00%    Coil/Unstructured: 47.76%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 170 Family Scaffolds
PF00459Inositol_P 46.47
PF01040UbiA 35.88
PF10128OpcA_G6PD_assem 5.29
PF00115COX1 1.76
PF02781G6PD_C 1.18
PF00291PALP 0.59
PF00676E1_dh 0.59
PF13677MotB_plug 0.59

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 170 Family Scaffolds
COG0364Glucose-6-phosphate 1-dehydrogenaseCarbohydrate transport and metabolism [G] 1.18
COG05672-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymesEnergy production and conversion [C] 0.59
COG1071TPP-dependent pyruvate or acetoin dehydrogenase subunit alphaEnergy production and conversion [C] 0.59


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms57.65 %
UnclassifiedrootN/A42.35 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2067725002|GPICC_F5MS3JC01AE74FAll Organisms → cellular organisms → Bacteria508Open in IMG/M
3300000890|JGI11643J12802_12031095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia807Open in IMG/M
3300000953|JGI11615J12901_10250713Not Available565Open in IMG/M
3300000956|JGI10216J12902_105009487All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300001991|JGI24743J22301_10134569Not Available547Open in IMG/M
3300003203|JGI25406J46586_10073239Not Available1069Open in IMG/M
3300003987|Ga0055471_10044724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1180Open in IMG/M
3300003996|Ga0055467_10172515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria656Open in IMG/M
3300004114|Ga0062593_100352841All Organisms → cellular organisms → Bacteria1287Open in IMG/M
3300004114|Ga0062593_100759272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria957Open in IMG/M
3300004114|Ga0062593_102808838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae556Open in IMG/M
3300004157|Ga0062590_102553578All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300004463|Ga0063356_102133326All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300004463|Ga0063356_104586140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae594Open in IMG/M
3300004463|Ga0063356_104752540Not Available584Open in IMG/M
3300004479|Ga0062595_100521088Not Available900Open in IMG/M
3300004479|Ga0062595_100617095Not Available849Open in IMG/M
3300005093|Ga0062594_101677529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria663Open in IMG/M
3300005093|Ga0062594_102841417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia539Open in IMG/M
3300005162|Ga0066814_10000465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2492Open in IMG/M
3300005327|Ga0070658_10092144All Organisms → cellular organisms → Bacteria2498Open in IMG/M
3300005332|Ga0066388_100458539All Organisms → cellular organisms → Bacteria1915Open in IMG/M
3300005338|Ga0068868_100800640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia850Open in IMG/M
3300005340|Ga0070689_100629028Not Available932Open in IMG/M
3300005356|Ga0070674_101777105Not Available559Open in IMG/M
3300005366|Ga0070659_100044061All Organisms → cellular organisms → Bacteria3492Open in IMG/M
3300005458|Ga0070681_10889197Not Available809Open in IMG/M
3300005466|Ga0070685_10803330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales694Open in IMG/M
3300005564|Ga0070664_100185508Not Available1851Open in IMG/M
3300005615|Ga0070702_100125625All Organisms → cellular organisms → Bacteria1612Open in IMG/M
3300005718|Ga0068866_10323450All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300005719|Ga0068861_100886160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria844Open in IMG/M
3300005719|Ga0068861_102367037Not Available534Open in IMG/M
3300005840|Ga0068870_10191908Not Available1233Open in IMG/M
3300005841|Ga0068863_102555759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae520Open in IMG/M
3300005843|Ga0068860_100009521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria9647Open in IMG/M
3300005889|Ga0075290_1043101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales608Open in IMG/M
3300005937|Ga0081455_10018672All Organisms → cellular organisms → Bacteria6588Open in IMG/M
3300005937|Ga0081455_10727390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria630Open in IMG/M
3300006876|Ga0079217_10093011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1336Open in IMG/M
3300006969|Ga0075419_11217333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria556Open in IMG/M
3300009081|Ga0105098_10833589Not Available500Open in IMG/M
3300009098|Ga0105245_11126380Not Available831Open in IMG/M
3300009100|Ga0075418_10761584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1045Open in IMG/M
3300009147|Ga0114129_11742684Not Available759Open in IMG/M
3300009148|Ga0105243_10004407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria11133Open in IMG/M
3300009868|Ga0130016_10000594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria82780Open in IMG/M
3300009870|Ga0131092_10000148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria148150Open in IMG/M
3300009873|Ga0131077_10028303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8986Open in IMG/M
3300009873|Ga0131077_10065192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4818Open in IMG/M
3300009873|Ga0131077_10538323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1072Open in IMG/M
3300010362|Ga0126377_10284624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1623Open in IMG/M
3300010362|Ga0126377_11598287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae726Open in IMG/M
3300010371|Ga0134125_10584044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1235Open in IMG/M
3300011119|Ga0105246_10883882Not Available800Open in IMG/M
3300011412|Ga0137424_1129319All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300012483|Ga0157337_1041301Not Available510Open in IMG/M
3300012514|Ga0157330_1091626Not Available504Open in IMG/M
3300012882|Ga0157304_1053666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Luna cluster → Luna-1 subcluster → Aquiluna → Aquiluna borgnonia628Open in IMG/M
3300012898|Ga0157293_10034128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1045Open in IMG/M
3300012901|Ga0157288_10133270Not Available720Open in IMG/M
3300012943|Ga0164241_10070098Not Available2538Open in IMG/M
3300012943|Ga0164241_10144522Not Available1703Open in IMG/M
3300012943|Ga0164241_10292511All Organisms → cellular organisms → Bacteria1164Open in IMG/M
3300012943|Ga0164241_10540383Not Available841Open in IMG/M
3300012958|Ga0164299_10830388Not Available662Open in IMG/M
3300013104|Ga0157370_10340859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1382Open in IMG/M
3300013104|Ga0157370_11191426Not Available687Open in IMG/M
3300013306|Ga0163162_12533472Not Available590Open in IMG/M
3300013306|Ga0163162_12814534Not Available560Open in IMG/M
3300014259|Ga0075311_1142790Not Available543Open in IMG/M
3300014270|Ga0075325_1038941Not Available972Open in IMG/M
3300014270|Ga0075325_1054221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria857Open in IMG/M
3300014300|Ga0075321_1041957Not Available787Open in IMG/M
3300014311|Ga0075322_1086730All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300014497|Ga0182008_10675631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia587Open in IMG/M
3300014497|Ga0182008_10814530Not Available543Open in IMG/M
3300014968|Ga0157379_10058185All Organisms → cellular organisms → Bacteria3455Open in IMG/M
3300014969|Ga0157376_10042351All Organisms → cellular organisms → Bacteria3732Open in IMG/M
3300015371|Ga0132258_10258272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4263Open in IMG/M
3300015371|Ga0132258_11892171All Organisms → cellular organisms → Bacteria1502Open in IMG/M
3300015371|Ga0132258_12455121Not Available1305Open in IMG/M
3300017965|Ga0190266_10032592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1674Open in IMG/M
3300017965|Ga0190266_10849615Not Available592Open in IMG/M
3300017965|Ga0190266_10948955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia570Open in IMG/M
3300018432|Ga0190275_10045529All Organisms → cellular organisms → Bacteria3632Open in IMG/M
3300018466|Ga0190268_10789466Not Available717Open in IMG/M
3300018469|Ga0190270_11307621All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300018481|Ga0190271_10172495All Organisms → cellular organisms → Bacteria2118Open in IMG/M
3300018481|Ga0190271_10857234All Organisms → cellular organisms → Bacteria1033Open in IMG/M
3300018481|Ga0190271_11410728All Organisms → cellular organisms → Bacteria → Terrabacteria group815Open in IMG/M
3300018481|Ga0190271_13859116Not Available501Open in IMG/M
3300019356|Ga0173481_10003457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4096Open in IMG/M
3300019356|Ga0173481_10041648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1536Open in IMG/M
3300019356|Ga0173481_10091234All Organisms → cellular organisms → Bacteria1150Open in IMG/M
3300019356|Ga0173481_10329704Not Available721Open in IMG/M
3300019361|Ga0173482_10017287Not Available1988Open in IMG/M
3300019362|Ga0173479_10001394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5217Open in IMG/M
3300020070|Ga0206356_10244160Not Available785Open in IMG/M
3300020070|Ga0206356_11620842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria990Open in IMG/M
3300020082|Ga0206353_11880256Not Available593Open in IMG/M
3300022213|Ga0224500_10227197Not Available683Open in IMG/M
3300023057|Ga0247797_1023395Not Available808Open in IMG/M
3300023064|Ga0247801_1026150Not Available813Open in IMG/M
3300023072|Ga0247799_1004879Not Available1872Open in IMG/M
3300023168|Ga0247748_1080208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia522Open in IMG/M
3300023266|Ga0247789_1012535All Organisms → cellular organisms → Bacteria1352Open in IMG/M
3300023266|Ga0247789_1030048All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300024055|Ga0247794_10059843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1063Open in IMG/M
3300025552|Ga0210142_1002934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3204Open in IMG/M
3300025559|Ga0210087_1034008Not Available1030Open in IMG/M
3300025796|Ga0210113_1012571All Organisms → cellular organisms → Bacteria1775Open in IMG/M
3300025885|Ga0207653_10065241All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1236Open in IMG/M
3300025900|Ga0207710_10137806All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300025911|Ga0207654_10596783Not Available788Open in IMG/M
3300025917|Ga0207660_10855160All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300025919|Ga0207657_10671926Not Available806Open in IMG/M
3300025923|Ga0207681_11172534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria645Open in IMG/M
3300025926|Ga0207659_10688787Not Available875Open in IMG/M
3300025930|Ga0207701_10973077Not Available708Open in IMG/M
3300025934|Ga0207686_11833853All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300025935|Ga0207709_10158824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1574Open in IMG/M
3300025944|Ga0207661_10498257Not Available1113Open in IMG/M
3300025945|Ga0207679_10554797Not Available1031Open in IMG/M
3300025981|Ga0207640_10343026Not Available1197Open in IMG/M
3300025981|Ga0207640_10500535Not Available1012Open in IMG/M
3300025986|Ga0207658_10186581All Organisms → cellular organisms → Bacteria1721Open in IMG/M
3300026003|Ga0208284_1017965Not Available580Open in IMG/M
3300026023|Ga0207677_11604824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae602Open in IMG/M
3300026051|Ga0208911_1000961All Organisms → cellular organisms → Bacteria2464Open in IMG/M
3300026088|Ga0207641_12443108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae521Open in IMG/M
3300026118|Ga0207675_100232595All Organisms → cellular organisms → Bacteria1778Open in IMG/M
3300026118|Ga0207675_100378290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1392Open in IMG/M
3300026121|Ga0207683_10787716Not Available882Open in IMG/M
3300026960|Ga0207582_1024648Not Available571Open in IMG/M
3300027675|Ga0209077_1069626Not Available965Open in IMG/M
3300027743|Ga0209593_10150925Not Available834Open in IMG/M
3300028379|Ga0268266_11306878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria701Open in IMG/M
3300028379|Ga0268266_12314454All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300028381|Ga0268264_10032919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4254Open in IMG/M
3300028381|Ga0268264_10851269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria913Open in IMG/M
3300028587|Ga0247828_10051174Not Available1789Open in IMG/M
3300028587|Ga0247828_10409211All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300028589|Ga0247818_10607202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria753Open in IMG/M
3300028592|Ga0247822_10668037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria837Open in IMG/M
3300028592|Ga0247822_11694784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Luna cluster → Luna-1 subcluster → Aquiluna → Aquiluna borgnonia538Open in IMG/M
3300028592|Ga0247822_11863160Not Available514Open in IMG/M
3300028592|Ga0247822_11964820Not Available502Open in IMG/M
3300028802|Ga0307503_10440620Not Available689Open in IMG/M
3300028812|Ga0247825_10671391Not Available744Open in IMG/M
3300028812|Ga0247825_10914613Not Available636Open in IMG/M
3300028812|Ga0247825_11386747Not Available515Open in IMG/M
3300030336|Ga0247826_10133498All Organisms → cellular organisms → Bacteria1608Open in IMG/M
3300030336|Ga0247826_11208707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Intrasporangium → Intrasporangium chromatireducens → Intrasporangium chromatireducens Q5-1606Open in IMG/M
3300031455|Ga0307505_10217020Not Available885Open in IMG/M
3300031548|Ga0307408_100354047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1247Open in IMG/M
3300031740|Ga0307468_101510157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Luna cluster → Luna-1 subcluster → Aquiluna → Aquiluna borgnonia623Open in IMG/M
3300031847|Ga0310907_10059871All Organisms → cellular organisms → Bacteria1513Open in IMG/M
3300031847|Ga0310907_10651927Not Available578Open in IMG/M
3300031938|Ga0308175_100381263Not Available1467Open in IMG/M
3300031940|Ga0310901_10218219Not Available768Open in IMG/M
3300031944|Ga0310884_10068119All Organisms → cellular organisms → Bacteria1655Open in IMG/M
3300031996|Ga0308176_11309160Not Available770Open in IMG/M
3300032003|Ga0310897_10042432All Organisms → cellular organisms → Bacteria1601Open in IMG/M
3300032122|Ga0310895_10113556Not Available1123Open in IMG/M
3300032122|Ga0310895_10668884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Luna cluster → Luna-1 subcluster → Aquiluna → Aquiluna borgnonia538Open in IMG/M
3300033550|Ga0247829_11296613Not Available603Open in IMG/M
3300033551|Ga0247830_10187808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1535Open in IMG/M
3300033551|Ga0247830_10553703Not Available908Open in IMG/M
3300033551|Ga0247830_10748942Not Available777Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil15.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil14.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.29%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere5.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.12%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands3.53%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.35%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.35%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.35%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater2.35%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.76%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.76%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.76%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.76%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.76%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.76%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.76%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.18%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.18%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.18%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.18%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.18%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.18%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.18%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.18%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.18%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.59%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.59%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.59%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.59%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.59%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.59%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.59%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.59%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.59%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.59%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.59%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.59%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.59%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.59%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.59%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.59%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2067725002Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001991Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2Host-AssociatedOpen in IMG/M
3300003203Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300003996Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005162Soil and rhizosphere microbial communities from Laval, Canada - mgLABEnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005889Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009868Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plantEngineeredOpen in IMG/M
3300009870Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plantEngineeredOpen in IMG/M
3300009873Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plantEngineeredOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011412Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2EnvironmentalOpen in IMG/M
3300012483Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610Host-AssociatedOpen in IMG/M
3300012514Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510EnvironmentalOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014259Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1EnvironmentalOpen in IMG/M
3300014270Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1EnvironmentalOpen in IMG/M
3300014300Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1EnvironmentalOpen in IMG/M
3300014311Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1EnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022213Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300023057Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6EnvironmentalOpen in IMG/M
3300023064Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6EnvironmentalOpen in IMG/M
3300023072Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6EnvironmentalOpen in IMG/M
3300023168Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S064-202C-5EnvironmentalOpen in IMG/M
3300023266Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025552Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025559Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025796Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026003Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026051Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026960Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A5-10 (SPAdes)EnvironmentalOpen in IMG/M
3300027675Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027743Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPICC_007590702067725002SoilMLSPELSRRNNRFGLLLFAIFVALFVGACLIALLYLQVD
JGI11643J12802_1203109523300000890SoilMLSPELARKNNRLGLALAAIFVALFVGACIVALVYLQVD*
JGI11615J12901_1025071313300000953SoilMLSPELSRKNNRLGLALFAMFVALFVGACVIALVYLQVD*
JGI10216J12902_10500948723300000956SoilMLSPELERRNNRLGLALFALFVVLFAGACVIALIYLQVD*
JGI24743J22301_1013456913300001991Corn, Switchgrass And Miscanthus RhizosphereMLTPELSRKNNRLGLALAAIFVALFVGACIVALVYLQVDXA
JGI25406J46586_1007323913300003203Tabebuia Heterophylla RhizosphereMLTPELERRNVRLGLALFALVLAIFVGAVLIALLYLQVD*
Ga0055471_1004472423300003987Natural And Restored WetlandsMLSPELSRKNNRYGLVLAALFVALFVGACLVALLYLQVD*
Ga0055467_1017251523300003996Natural And Restored WetlandsMLSPELSRKNNRFGLLLFAIFVALFVGACLIALLYLQVD*
Ga0062593_10035284123300004114SoilMLSPELSRKNNRFGLVLGALFVAIFIGACVIALLYLQVD*
Ga0062593_10075927223300004114SoilMLSPELSRKNNRLGLALFAIFVALFVGACVIALIYLQID*
Ga0062593_10280883823300004114SoilMLTPELTRRNNRLGLVLAALFVAIFVGACLIAIVYLQVD*
Ga0062590_10255357823300004157SoilMLTPELTRRNNRLGLVLGALFVAIFIGACLIALLYLQVD*
Ga0063356_10213332623300004463Arabidopsis Thaliana RhizosphereMLTPELERKNMRLGLWLLAVFVVIFVGACLIAVLYLQVD*
Ga0063356_10458614023300004463Arabidopsis Thaliana RhizosphereMISPELARKNNRFGLALFALFVAIFVGACLIALLYLQVD*
Ga0063356_10475254013300004463Arabidopsis Thaliana RhizosphereMLTPELARKNNRLGLALFAIFVALFVGACVIAVIYLQVD*
Ga0062595_10052108813300004479SoilMLSPELSRKNNRFGLALAAIFVALFVGACVIALVYLQVD*
Ga0062595_10061709523300004479SoilMLSPELQRKNNRLGLALFALFVVLFVGACVIAVLYLQVD*
Ga0062594_10167752923300005093SoilMLTPELERKNNRLGLALFALFVVLFAGACVIALIYLQVD*
Ga0062594_10284141713300005093SoilRPVGAVGALMLSPELSRKNNRFGLVLGALFVAIFIGACVIALLYLQVD*
Ga0066814_1000046533300005162SoilMLSPELSRKNNRLGLALFAIFVALFVGACVIALIYLQVD*
Ga0070658_1009214423300005327Corn RhizosphereMLTPELSRKNNRLGLALAAIFVALFVGACIVALVYLQVD*
Ga0066388_10045853933300005332Tropical Forest SoilMLSPELSRKNNRFGLLLLAIFVALFVGACVIALLYLQVD*
Ga0068868_10080064023300005338Miscanthus RhizospherePVGAVGALMLSPELSRKNNRFGLVLGALFVAIFIGACVIALLYLQVD*
Ga0070689_10062902823300005340Switchgrass RhizosphereMLSPELSRKNNRFGLALAAIFVALFVGACIIALVYLQVD*
Ga0070674_10177710523300005356Miscanthus RhizosphereMLTPELERKNMRLGLALLAVFVLIFVGACLIALLYLQVD*
Ga0070659_10004406143300005366Corn RhizosphereMLSPELSRKNNRFGLVLGALFVAIFIGACLIALLYLQVD*
Ga0070681_1088919713300005458Corn RhizosphereMISPELARKNNRFGLALLALFVAIFVGACLIALLYLQVD*
Ga0070685_1080333023300005466Switchgrass RhizosphereMLSPELSRKNNRLGLALFAVFVALFVGACVIALIYLQVD*
Ga0070664_10018550823300005564Corn RhizosphereMLSPEVSRKNNRFGLALAAIFVALFVGACVIALVYLQVD*
Ga0070702_10012562533300005615Corn, Switchgrass And Miscanthus RhizosphereMLSPELSRRNNRLGLALFAVFVALFVGACVIALIYLQVD*
Ga0068866_1032345023300005718Miscanthus RhizosphereMLTPELERRNNRLGLALFALFVVLFAGACVIALIYLQVD*
Ga0068861_10088616023300005719Switchgrass RhizosphereMLTPEVERKNMRLGLALFAVFVLIFVGACLIALLYLQVD*
Ga0068861_10236703713300005719Switchgrass RhizospherePELSRKNNRLGLALAAIFVALFVGACIVALVYLQVD*
Ga0068870_1019190833300005840Miscanthus RhizosphereMLSPELSRRNNRFGLLLFAIFVALFVGACLIALLYLQVD*
Ga0068863_10255575913300005841Switchgrass RhizosphereRPPRPLMLSPELSRRNNRFGLLLFAIFVALFVGACLIALLYLQVD*
Ga0068860_10000952183300005843Switchgrass RhizosphereMLSPELSRKNNRFGLALAAILVALFVGACVIALVYLQVD*
Ga0075290_104310123300005889Rice Paddy SoilMLTPELTRKNNRLGLVLGALFVAIFIGACLIALLYLQVD*
Ga0081455_1001867223300005937Tabebuia Heterophylla RhizosphereMLSPELARKNNRFGLLLFAVFVALFVGACLIALLYLQVD*
Ga0081455_1072739023300005937Tabebuia Heterophylla RhizosphereMLSPELSRKNNRFGLVLLAIFVALFVGACVIALLYLQVD*
Ga0079217_1009301123300006876Agricultural SoilVLSPELERRNNRLGLALFALFVVLFVGACVIALIYLQVD*
Ga0075419_1121733323300006969Populus RhizosphereMLTPEVERKNMRLGLVLFAVFVLIFVGACLIALLYLQVD*
Ga0105098_1083358923300009081Freshwater SedimentVLSPELQRKNMRLGLALFAIFVVLFVGSCVIGLIYLQVD*
Ga0105245_1112638013300009098Miscanthus RhizosphereMLTPELTRRNNRLGLVLAALFVAIFVGACLIAIVYL
Ga0075418_1076158423300009100Populus RhizosphereMLSPELQRRNNRLGLALFALFVVLFVGACVIAVLYLQVD*
Ga0114129_1174268413300009147Populus RhizosphereMLSPELSRKNNRLGLALAAIFVACFVGACIVALV*
Ga0105243_10004407103300009148Miscanthus RhizosphereMLSPEVSRKNNRFGLALAAIFVALFVGACIIALVYLQVD*
Ga0130016_1000059443300009868WastewaterMLSPELSRKNNRFGLALFALFVALFVGACVIALVYLQVD*
Ga0131092_10000148573300009870Activated SludgeMLSPELARKNNRLGVALFAIFVAIFIGACVIALIYLQVD*
Ga0131077_1002830383300009873WastewaterMLSPELSRKNNRLGLALLAVFVVLFVGACVIALVYLQVD*
Ga0131077_1006519243300009873WastewaterMLSPELSRKNNRFGLVLFAVFVALFVGACLIALIYLQVD*
Ga0131077_1053832323300009873WastewaterMLSPELSRKNNRFGLALFAIFVALFVGACVIALIYLQVD*
Ga0126377_1028462423300010362Tropical Forest SoilMLSPELSRRNNRLGLALFAVFVALFVGACLIALLYLQVD*
Ga0126377_1159828723300010362Tropical Forest SoilMQSPELSHRNNRFGLALFAVVVALFVGACLIAILYLQVD*
Ga0134125_1058404423300010371Terrestrial SoilMLSPELSRKNNRFGLVLGALFVAIFIGACVVALLYLQVD*
Ga0105246_1088388223300011119Miscanthus RhizosphereGLAMLSPELSRKNNRLGLALFAIFVALFVGACVIALIYLQVD*
Ga0137424_112931913300011412SoilVSTPELERKNNRLGLALFALFVVLFVGACAVALIYLQVD*
Ga0157337_104130123300012483Arabidopsis RhizosphereMLTPELARKNNRLGLALFAIFVALFVGACVIAVIY
Ga0157330_109162623300012514SoilMHSPELSRKNNRFGLVLGALFVAIFIGACVIALLYLQVD*
Ga0157304_105366623300012882SoilMLSPELSRKNNRLGLALFAIFVALFVGACVIAVIYLQVD*
Ga0157293_1003412823300012898SoilMLTPELSRKNNRLGLALFAIFVALFVGACVIAVIYLQVD*
Ga0157288_1013327023300012901SoilRKNNRLGLALAAIFVALFVGACIVALVYLQVDSA*
Ga0164241_1007009843300012943SoilMLTPELTRRNNRLGLVLGALFVAIFVGACLVALLYLQVD*
Ga0164241_1014452223300012943SoilMLSPELSRKNNRYGLVLAALFVVLFVGACLIALLYLQVD*
Ga0164241_1029251123300012943SoilMISPELARKNNRFGLALAALFVAIFVGACLIALLYLQVD*
Ga0164241_1054038323300012943SoilMLSPELTRKNNRLGLALAAIFVALFVGACVVALVYLQVD*
Ga0164299_1083038813300012958SoilRSPGGLAMVSPELSRKNNGLGLALFAIFVALFVGACVIALIYLQVD*
Ga0157370_1034085913300013104Corn RhizospherePELTRRNNRLGLVLAALFVAIFVGACLIAIVYLQVD*
Ga0157370_1119142623300013104Corn RhizosphereMLSPELSRKNNRFGLALAAIFVALFVGACVLALVYLQVD*
Ga0163162_1253347223300013306Switchgrass RhizosphereMLTPELSRKHNRLGLALAAIFVALFVGACIVALVYLQVD*
Ga0163162_1281453413300013306Switchgrass RhizospherePAGGVAMLTPELSRKHNRLGLALAAIFVALFVGACVIAVIYLQVD*
Ga0075311_114279013300014259Natural And Restored WetlandsVLTPELARRNNRLGLALFAIFLLLFVGACVIALVYLQVD*
Ga0075325_103894123300014270Natural And Restored WetlandsVLTPELARRNNRLGLALFAIFVAIFVGACVIALLYLQVD*
Ga0075325_105422123300014270Natural And Restored WetlandsMLTPELARRNNRLGLALFAIFVAIFVGACVIALLYLQVD*
Ga0075321_104195713300014300Natural And Restored WetlandsMASPELARRNNRLGLVLFAVFVAMFVGACVIALVYLQVD*
Ga0075322_108673023300014311Natural And Restored WetlandsMVSPELARRNNRLGLVLFAVFVAMFVGACVIALVYLQVD*
Ga0182008_1067563123300014497RhizosphereMLSPELSRRNTRFGLLLFGIFLALFVGACLIALLYLQVD*
Ga0182008_1081453013300014497RhizosphereLSRKNNRLGLALAAIFVALFVGACIVALVYLQVD*
Ga0157379_1005818543300014968Switchgrass RhizosphereMLSPALSRKNNRFGLLLFAIFVALFVGACVIALVYLQVD*
Ga0157376_1004235143300014969Miscanthus RhizosphereMLPPELSRKNNRFGLALAAIFVALFVGACVIALVYLQVD*
Ga0132258_1025827223300015371Arabidopsis RhizosphereVLSPELSRKNNRLGLALFAMFVALFLGACVIALIYLQVD*
Ga0132258_1189217123300015371Arabidopsis RhizosphereMLSPELSRKNNRLGLALFAIFVALFVGACVVALIYLQVD*
Ga0132258_1245512133300015371Arabidopsis RhizosphereMLSPELARKNNRLGLVLLAIFVAIFVGACVVALVYLQVD*
Ga0190266_1003259233300017965SoilMLSPELQRKNNRLGLALFALFVVLFVGACVIAVLYLQVD
Ga0190266_1084961513300017965SoilVSTPELERKNNRLGLALFALFVVLFVGACAIAVIY
Ga0190266_1094895513300017965SoilVSTPELERKNNRLGLALFALFVVLFVGACAIAVIYLQVD
Ga0190275_1004552933300018432SoilMLTPELERRNMRLGLALLAVFVVLFVGSCLVALIYLQVD
Ga0190268_1078946623300018466SoilMLTPEVERKNMRLGLALFAVFVLIFVGACLIALLYLQVD
Ga0190270_1130762123300018469SoilMLTPELERKNNRLGLALFALFLVLFVGACAIAVIYLQVD
Ga0190271_1017249523300018481SoilMLTPEVERKNMRLGLALFAVFVLIFLGACLIALLYLQVD
Ga0190271_1085723423300018481SoilMLSPELERRNNRLGLALFALFVVLFVGACVIALIYLQVD
Ga0190271_1141072823300018481SoilVLSPELERRNNRLGLALFALFVVLFVGACVIALIYLQVD
Ga0190271_1385911623300018481SoilMLTPELERKNNRLGLALFALFVVLFVGACVIAVIYLQVD
Ga0173481_1000345733300019356SoilMLTPELARKNNRLGLALFAIFVALFVGACVIAVIYLQVD
Ga0173481_1004164833300019356SoilMLSPELSRKNNRLGLALFAIFVALFVGACVIALIYLQID
Ga0173481_1009123423300019356SoilMLSPELQRKNNRLGLALFALFIVLFVGACVIAVLYLQVD
Ga0173481_1032970423300019356SoilPELSRKNNRFGLLLLALFVALFVGACLVAVLYLQVD
Ga0173482_1001728733300019361SoilMLSPELARKNNRLGLALAAIFVALFVGACIVALVYLQVD
Ga0173479_1000139433300019362SoilMLTPELSRKNNRLGLALAAIFVALFVGACIVALVYLQVD
Ga0206356_1024416023300020070Corn, Switchgrass And Miscanthus RhizosphereMLSPELSRKNNRLGLALFAIFVALFVGACVIALIYL
Ga0206356_1162084223300020070Corn, Switchgrass And Miscanthus RhizosphereMLTPELTRRNNRLGLVLAALFVAIFVGACLIAIVYLQVD
Ga0206353_1188025613300020082Corn, Switchgrass And Miscanthus RhizosphereMLSPELSRKINRFGLALFAIFVALFVGACVIALIYLQVD
Ga0224500_1022719723300022213SedimentMLSPDLARRNTRLGWALFALFVALFVGTCLIALVYLQLD
Ga0247797_102339513300023057SoilMLTPELARKNNRLGLALFAIFVALFVGACVIAVIYL
Ga0247801_102615023300023064SoilMLTPELARKNNRLGLALFAIFVALFVGACVIAVIYLQV
Ga0247799_100487933300023072SoilMLTPELSRKNNRLGLALFAIFVALFVGACVIAVIYLQVD
Ga0247748_108020823300023168SoilMLSPELSRKNNRLGLALFAIFVALFVGACVIAVIYLQVD
Ga0247789_101253523300023266SoilMLSPELSRKNNRFGLVLGALFVAIFIGACVIALLYLQVD
Ga0247789_103004823300023266SoilMLSPELSRKNNRFGLLLFAIFVALFVGACLIALLYLQVD
Ga0247794_1005984323300024055SoilMLSPELSRKNNRLGLALAAIFVALFVGACIVALVYLQVD
Ga0210142_100293433300025552Natural And Restored WetlandsMVSPELARRNNRLGLVLFAVFVAMFVGACVIALVYLQVD
Ga0210087_103400833300025559Natural And Restored WetlandsVLTPELARRNNRLGLALFAIFLLLFVGACVIALVYLQVD
Ga0210113_101257123300025796Natural And Restored WetlandsVLTPELAHRNNRLGLALFAIFLLLFVGACVIALVYLQVD
Ga0207653_1006524113300025885Corn, Switchgrass And Miscanthus RhizosphereMLSPELSRRNNRLGLALFAIFVALFVGACVIALIYLQVD
Ga0207710_1013780623300025900Switchgrass RhizosphereMLSPELSRKNNRLGLALFAIFVALFVGACVIALIYLQVD
Ga0207654_1059678313300025911Corn RhizosphereMLSPELSRKNNRLGLALFAIFVALFVGACVIALIYLQV
Ga0207660_1085516023300025917Corn RhizosphereMLTPELTRRNNRLGLVLGALFVAIFIGACLIALLYLQVD
Ga0207657_1067192613300025919Corn RhizosphereELARKNNRLGLALFAIFVALFVGACVIAVIYLQVD
Ga0207681_1117253423300025923Switchgrass RhizosphereMDPELSRKNNRFGLALAAIFVALFVGACVIALVYLQVD
Ga0207659_1068878713300025926Miscanthus RhizosphereELSRKNNRFGLVLGALFVAIFIGACVIALLYLQVD
Ga0207701_1097307723300025930Corn, Switchgrass And Miscanthus RhizosphereMLSPELSRRNNRLGLALFAIFVALFVGACVVALIYLQVD
Ga0207686_1183385323300025934Miscanthus RhizosphereRPAGGVAMLTPELSRKNNRLGLALAAIFVALFVGACIVALVYLQVD
Ga0207709_1015882413300025935Miscanthus RhizosphereRPARPLMLTPELTRRNNRLGLVLGALFVAIFIGACLIALLYLQVD
Ga0207661_1049825713300025944Corn RhizosphereMLSPALSRKNNRFGLLLFAIFVALFVGACLIALLYLQVD
Ga0207679_1055479713300025945Corn RhizosphereRRDRPLGALMLSPELSRKNNRFGLLLFAIFVALFVGACLIALLYLQVD
Ga0207640_1034302623300025981Corn RhizosphereMLTPELSRKNNRLGLALAAIFVALFVGACIVALVYLQVDGA
Ga0207640_1050053533300025981Corn RhizosphereGAVGALMLSPELSRKNNRFGLVLGALFVAIFIGACVIALLYLQVD
Ga0207658_1018658113300025986Switchgrass RhizosphereMLSPELSRKNNRLGLALFAIFVALFVGACVIALIY
Ga0208284_101796523300026003Rice Paddy SoilMVSPELARRNNRLGLVLFAVFVAMFVGACVIALVYL
Ga0207677_1160482413300026023Miscanthus RhizospherePVGAVGALMLSPELSRKNNRFGLVLGALFVAIFIGACVIALLYLQVD
Ga0208911_100096123300026051Natural And Restored WetlandsVLTPELARRNNRLGLALFAIFVAIFVGACVIALLYLQVD
Ga0207641_1244310813300026088Switchgrass RhizosphereRPPRPLMLSPELSRRNNRFGLLLFAIFVALFVGACLIALLYLQVD
Ga0207675_10023259523300026118Switchgrass RhizosphereMLSPELSRKNNRFGLVLGALFVAIFIGACLIALLYLQVD
Ga0207675_10037829033300026118Switchgrass RhizospherePELSRKNNRFGLVLGALFVAIFIGACVIALLYLQVD
Ga0207683_1078771613300026121Miscanthus RhizosphereAMLTPELERKNNRLGLALFALFVVLFAGACVIALIYLQVD
Ga0207582_102464823300026960SoilMLTPELSRKNNRLGLALAAIFVALFVGACVIAVIYLQVD
Ga0209077_106962623300027675Freshwater SedimentVLSPELQRKNMRLGLALFAIFVVLFVGSCVIGLIYLQVD
Ga0209593_1015092523300027743Freshwater SedimentVLSPELQRKNMRLGLALFAIFVVLFVGSCVIGLIYL
Ga0268266_1130687823300028379Switchgrass RhizosphereMLSPELSRKNNRFGLALAAIFVALFVGACVIALVYLQVD
Ga0268266_1231445423300028379Switchgrass RhizosphereMLTPELTRRNNRLGLVLGALFVAIFIGACLIALLYLQAD
Ga0268264_1003291943300028381Switchgrass RhizosphereMLSPELSRKNNRFGLALAAILVALFVGACVIALVYLQVD
Ga0268264_1085126923300028381Switchgrass RhizosphereMLSPELSRKNNRLGLALFAIFVALFVGACIVALVYLQVD
Ga0247828_1005117423300028587SoilMISPELARKNNRFGLALFALFVAIFVGACLIALLYLQVD
Ga0247828_1040921123300028587SoilVSTPELARRNNRLGLALFALFVVLFAGACAIALIYLQVD
Ga0247818_1060720223300028589SoilMLSPELSRKNNRFGLLLFALFVALFVGACLVAVLYLQVD
Ga0247822_1066803723300028592SoilMLTPELERKNNRLGLALFALFVVLFAGACVIALIYLQVD
Ga0247822_1169478423300028592SoilPELARRNNRLGLALFALFVVLFAGACAIALIYLQVD
Ga0247822_1186316023300028592SoilMISPELARKNNRFGLALFALFVAIFVGACLIALLYLLVD
Ga0247822_1196482023300028592SoilVTSPELERKNNILGLALFALFVVLFVGACAIALIYLQV
Ga0307503_1044062023300028802SoilMLSPELSRKNNRFGLALAAIFVALFVGACIIALVYLQVD
Ga0247825_1067139123300028812SoilVSTPELARKNNRLGLALFALFVVLFAGACAIALIYLQVD
Ga0247825_1091461323300028812SoilMLPPELSRKNNRFGLALAAIFVALFVGACVIALVYLQVD
Ga0247825_1138674723300028812SoilMLTPELERKNNRLGLALFALFLVLFAGACVIAVIYLQVD
Ga0247826_1013349823300030336SoilMLTPEVERRNMRLGLALFAVFVLIFVGACLIALLYLQVD
Ga0247826_1120870723300030336SoilVSPELSRRNNRFGLLLFAIFVALFVGACLIALLYLQVD
Ga0307505_1021702023300031455SoilMLSPELSRKNNRLGLALFAIFVALFVGACVVALIYLQVD
Ga0307408_10035404723300031548RhizosphereMLSPELARKNNRLGLALGAIFVALFVGACIVALVYLQVD
Ga0307468_10151015723300031740Hardwood Forest SoilMLSPELQRKNHRLGLALFALFVVLFVGACVIAVLYLQVD
Ga0310907_1005987113300031847SoilMLSPELSRKNNRFGLVLGALFVAIFIGACVIALLYLQ
Ga0310907_1065192723300031847SoilMLSPELSRKNNRFGLLLFAIFVALFVGACLIALLYL
Ga0308175_10038126323300031938SoilMPSPELSRKNNRFGLVLAGLFVALFIGACLVAILYLQVD
Ga0310901_1021821913300031940SoilGALMLSPELSRKNNRFGLVLGALFVAIFIGACVIALLYLQVD
Ga0310884_1006811923300031944SoilMLSPELSRKNNRLGLALFAIFVALFVGACVIALIYLPVD
Ga0308176_1130916013300031996SoilRPPRPLMLSPELSRRNNRLGLLLFGIFVALFVGACLIALLYLQVD
Ga0310897_1004243223300032003SoilMPTPELERKNNRLGLALFALFVVLFAGACVIALIYLQVD
Ga0310895_1011355613300032122SoilMLSPELQRRNNRLGLALFALFVVLFVGACVIAVLYLQVD
Ga0310895_1066888423300032122SoilRPGGDVAMLTPELERKNNRLGLALFALFVVLFAGACVIALIYLQVD
Ga0247829_1129661323300033550SoilGDVAMLTPELERKNNRLGLALFALFVVLFAGACVIALIYLQVD
Ga0247830_1018780813300033551SoilRPVGAVGALMLSPELSRKNNRFGLVLGALFVAIFIGACVIALLYLQVD
Ga0247830_1055370313300033551SoilLSPELSRKNNRFGLLLFAIFVALFVGACLIALLYLQVD
Ga0247830_1074894213300033551SoilMLSPELSRKNNRFGLLLFALFVALFVGACLVAVLY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.