Basic Information | |
---|---|
Family ID | F036121 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 170 |
Average Sequence Length | 39 residues |
Representative Sequence | MLSPELSRKNNRLGLALFAIFVALFVGACVIALIYLQVD |
Number of Associated Samples | 125 |
Number of Associated Scaffolds | 170 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 48.24 % |
% of genes near scaffold ends (potentially truncated) | 28.82 % |
% of genes from short scaffolds (< 2000 bps) | 87.65 % |
Associated GOLD sequencing projects | 114 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (57.647 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.882 % of family members) |
Environment Ontology (ENVO) | Unclassified (34.706 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.882 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 52.24% β-sheet: 0.00% Coil/Unstructured: 47.76% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 170 Family Scaffolds |
---|---|---|
PF00459 | Inositol_P | 46.47 |
PF01040 | UbiA | 35.88 |
PF10128 | OpcA_G6PD_assem | 5.29 |
PF00115 | COX1 | 1.76 |
PF02781 | G6PD_C | 1.18 |
PF00291 | PALP | 0.59 |
PF00676 | E1_dh | 0.59 |
PF13677 | MotB_plug | 0.59 |
COG ID | Name | Functional Category | % Frequency in 170 Family Scaffolds |
---|---|---|---|
COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 1.18 |
COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 0.59 |
COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 0.59 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 57.65 % |
Unclassified | root | N/A | 42.35 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2067725002|GPICC_F5MS3JC01AE74F | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300000890|JGI11643J12802_12031095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 807 | Open in IMG/M |
3300000953|JGI11615J12901_10250713 | Not Available | 565 | Open in IMG/M |
3300000956|JGI10216J12902_105009487 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300001991|JGI24743J22301_10134569 | Not Available | 547 | Open in IMG/M |
3300003203|JGI25406J46586_10073239 | Not Available | 1069 | Open in IMG/M |
3300003987|Ga0055471_10044724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1180 | Open in IMG/M |
3300003996|Ga0055467_10172515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 656 | Open in IMG/M |
3300004114|Ga0062593_100352841 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
3300004114|Ga0062593_100759272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 957 | Open in IMG/M |
3300004114|Ga0062593_102808838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 556 | Open in IMG/M |
3300004157|Ga0062590_102553578 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300004463|Ga0063356_102133326 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300004463|Ga0063356_104586140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 594 | Open in IMG/M |
3300004463|Ga0063356_104752540 | Not Available | 584 | Open in IMG/M |
3300004479|Ga0062595_100521088 | Not Available | 900 | Open in IMG/M |
3300004479|Ga0062595_100617095 | Not Available | 849 | Open in IMG/M |
3300005093|Ga0062594_101677529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 663 | Open in IMG/M |
3300005093|Ga0062594_102841417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 539 | Open in IMG/M |
3300005162|Ga0066814_10000465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2492 | Open in IMG/M |
3300005327|Ga0070658_10092144 | All Organisms → cellular organisms → Bacteria | 2498 | Open in IMG/M |
3300005332|Ga0066388_100458539 | All Organisms → cellular organisms → Bacteria | 1915 | Open in IMG/M |
3300005338|Ga0068868_100800640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 850 | Open in IMG/M |
3300005340|Ga0070689_100629028 | Not Available | 932 | Open in IMG/M |
3300005356|Ga0070674_101777105 | Not Available | 559 | Open in IMG/M |
3300005366|Ga0070659_100044061 | All Organisms → cellular organisms → Bacteria | 3492 | Open in IMG/M |
3300005458|Ga0070681_10889197 | Not Available | 809 | Open in IMG/M |
3300005466|Ga0070685_10803330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 694 | Open in IMG/M |
3300005564|Ga0070664_100185508 | Not Available | 1851 | Open in IMG/M |
3300005615|Ga0070702_100125625 | All Organisms → cellular organisms → Bacteria | 1612 | Open in IMG/M |
3300005718|Ga0068866_10323450 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
3300005719|Ga0068861_100886160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 844 | Open in IMG/M |
3300005719|Ga0068861_102367037 | Not Available | 534 | Open in IMG/M |
3300005840|Ga0068870_10191908 | Not Available | 1233 | Open in IMG/M |
3300005841|Ga0068863_102555759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 520 | Open in IMG/M |
3300005843|Ga0068860_100009521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9647 | Open in IMG/M |
3300005889|Ga0075290_1043101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 608 | Open in IMG/M |
3300005937|Ga0081455_10018672 | All Organisms → cellular organisms → Bacteria | 6588 | Open in IMG/M |
3300005937|Ga0081455_10727390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 630 | Open in IMG/M |
3300006876|Ga0079217_10093011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1336 | Open in IMG/M |
3300006969|Ga0075419_11217333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 556 | Open in IMG/M |
3300009081|Ga0105098_10833589 | Not Available | 500 | Open in IMG/M |
3300009098|Ga0105245_11126380 | Not Available | 831 | Open in IMG/M |
3300009100|Ga0075418_10761584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1045 | Open in IMG/M |
3300009147|Ga0114129_11742684 | Not Available | 759 | Open in IMG/M |
3300009148|Ga0105243_10004407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11133 | Open in IMG/M |
3300009868|Ga0130016_10000594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 82780 | Open in IMG/M |
3300009870|Ga0131092_10000148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 148150 | Open in IMG/M |
3300009873|Ga0131077_10028303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8986 | Open in IMG/M |
3300009873|Ga0131077_10065192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4818 | Open in IMG/M |
3300009873|Ga0131077_10538323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1072 | Open in IMG/M |
3300010362|Ga0126377_10284624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1623 | Open in IMG/M |
3300010362|Ga0126377_11598287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 726 | Open in IMG/M |
3300010371|Ga0134125_10584044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1235 | Open in IMG/M |
3300011119|Ga0105246_10883882 | Not Available | 800 | Open in IMG/M |
3300011412|Ga0137424_1129319 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300012483|Ga0157337_1041301 | Not Available | 510 | Open in IMG/M |
3300012514|Ga0157330_1091626 | Not Available | 504 | Open in IMG/M |
3300012882|Ga0157304_1053666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Luna cluster → Luna-1 subcluster → Aquiluna → Aquiluna borgnonia | 628 | Open in IMG/M |
3300012898|Ga0157293_10034128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1045 | Open in IMG/M |
3300012901|Ga0157288_10133270 | Not Available | 720 | Open in IMG/M |
3300012943|Ga0164241_10070098 | Not Available | 2538 | Open in IMG/M |
3300012943|Ga0164241_10144522 | Not Available | 1703 | Open in IMG/M |
3300012943|Ga0164241_10292511 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
3300012943|Ga0164241_10540383 | Not Available | 841 | Open in IMG/M |
3300012958|Ga0164299_10830388 | Not Available | 662 | Open in IMG/M |
3300013104|Ga0157370_10340859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1382 | Open in IMG/M |
3300013104|Ga0157370_11191426 | Not Available | 687 | Open in IMG/M |
3300013306|Ga0163162_12533472 | Not Available | 590 | Open in IMG/M |
3300013306|Ga0163162_12814534 | Not Available | 560 | Open in IMG/M |
3300014259|Ga0075311_1142790 | Not Available | 543 | Open in IMG/M |
3300014270|Ga0075325_1038941 | Not Available | 972 | Open in IMG/M |
3300014270|Ga0075325_1054221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 857 | Open in IMG/M |
3300014300|Ga0075321_1041957 | Not Available | 787 | Open in IMG/M |
3300014311|Ga0075322_1086730 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300014497|Ga0182008_10675631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 587 | Open in IMG/M |
3300014497|Ga0182008_10814530 | Not Available | 543 | Open in IMG/M |
3300014968|Ga0157379_10058185 | All Organisms → cellular organisms → Bacteria | 3455 | Open in IMG/M |
3300014969|Ga0157376_10042351 | All Organisms → cellular organisms → Bacteria | 3732 | Open in IMG/M |
3300015371|Ga0132258_10258272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4263 | Open in IMG/M |
3300015371|Ga0132258_11892171 | All Organisms → cellular organisms → Bacteria | 1502 | Open in IMG/M |
3300015371|Ga0132258_12455121 | Not Available | 1305 | Open in IMG/M |
3300017965|Ga0190266_10032592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1674 | Open in IMG/M |
3300017965|Ga0190266_10849615 | Not Available | 592 | Open in IMG/M |
3300017965|Ga0190266_10948955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 570 | Open in IMG/M |
3300018432|Ga0190275_10045529 | All Organisms → cellular organisms → Bacteria | 3632 | Open in IMG/M |
3300018466|Ga0190268_10789466 | Not Available | 717 | Open in IMG/M |
3300018469|Ga0190270_11307621 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300018481|Ga0190271_10172495 | All Organisms → cellular organisms → Bacteria | 2118 | Open in IMG/M |
3300018481|Ga0190271_10857234 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
3300018481|Ga0190271_11410728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 815 | Open in IMG/M |
3300018481|Ga0190271_13859116 | Not Available | 501 | Open in IMG/M |
3300019356|Ga0173481_10003457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4096 | Open in IMG/M |
3300019356|Ga0173481_10041648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1536 | Open in IMG/M |
3300019356|Ga0173481_10091234 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
3300019356|Ga0173481_10329704 | Not Available | 721 | Open in IMG/M |
3300019361|Ga0173482_10017287 | Not Available | 1988 | Open in IMG/M |
3300019362|Ga0173479_10001394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5217 | Open in IMG/M |
3300020070|Ga0206356_10244160 | Not Available | 785 | Open in IMG/M |
3300020070|Ga0206356_11620842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 990 | Open in IMG/M |
3300020082|Ga0206353_11880256 | Not Available | 593 | Open in IMG/M |
3300022213|Ga0224500_10227197 | Not Available | 683 | Open in IMG/M |
3300023057|Ga0247797_1023395 | Not Available | 808 | Open in IMG/M |
3300023064|Ga0247801_1026150 | Not Available | 813 | Open in IMG/M |
3300023072|Ga0247799_1004879 | Not Available | 1872 | Open in IMG/M |
3300023168|Ga0247748_1080208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 522 | Open in IMG/M |
3300023266|Ga0247789_1012535 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
3300023266|Ga0247789_1030048 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
3300024055|Ga0247794_10059843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1063 | Open in IMG/M |
3300025552|Ga0210142_1002934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3204 | Open in IMG/M |
3300025559|Ga0210087_1034008 | Not Available | 1030 | Open in IMG/M |
3300025796|Ga0210113_1012571 | All Organisms → cellular organisms → Bacteria | 1775 | Open in IMG/M |
3300025885|Ga0207653_10065241 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1236 | Open in IMG/M |
3300025900|Ga0207710_10137806 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
3300025911|Ga0207654_10596783 | Not Available | 788 | Open in IMG/M |
3300025917|Ga0207660_10855160 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300025919|Ga0207657_10671926 | Not Available | 806 | Open in IMG/M |
3300025923|Ga0207681_11172534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 645 | Open in IMG/M |
3300025926|Ga0207659_10688787 | Not Available | 875 | Open in IMG/M |
3300025930|Ga0207701_10973077 | Not Available | 708 | Open in IMG/M |
3300025934|Ga0207686_11833853 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300025935|Ga0207709_10158824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1574 | Open in IMG/M |
3300025944|Ga0207661_10498257 | Not Available | 1113 | Open in IMG/M |
3300025945|Ga0207679_10554797 | Not Available | 1031 | Open in IMG/M |
3300025981|Ga0207640_10343026 | Not Available | 1197 | Open in IMG/M |
3300025981|Ga0207640_10500535 | Not Available | 1012 | Open in IMG/M |
3300025986|Ga0207658_10186581 | All Organisms → cellular organisms → Bacteria | 1721 | Open in IMG/M |
3300026003|Ga0208284_1017965 | Not Available | 580 | Open in IMG/M |
3300026023|Ga0207677_11604824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 602 | Open in IMG/M |
3300026051|Ga0208911_1000961 | All Organisms → cellular organisms → Bacteria | 2464 | Open in IMG/M |
3300026088|Ga0207641_12443108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 521 | Open in IMG/M |
3300026118|Ga0207675_100232595 | All Organisms → cellular organisms → Bacteria | 1778 | Open in IMG/M |
3300026118|Ga0207675_100378290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1392 | Open in IMG/M |
3300026121|Ga0207683_10787716 | Not Available | 882 | Open in IMG/M |
3300026960|Ga0207582_1024648 | Not Available | 571 | Open in IMG/M |
3300027675|Ga0209077_1069626 | Not Available | 965 | Open in IMG/M |
3300027743|Ga0209593_10150925 | Not Available | 834 | Open in IMG/M |
3300028379|Ga0268266_11306878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 701 | Open in IMG/M |
3300028379|Ga0268266_12314454 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300028381|Ga0268264_10032919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4254 | Open in IMG/M |
3300028381|Ga0268264_10851269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 913 | Open in IMG/M |
3300028587|Ga0247828_10051174 | Not Available | 1789 | Open in IMG/M |
3300028587|Ga0247828_10409211 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300028589|Ga0247818_10607202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 753 | Open in IMG/M |
3300028592|Ga0247822_10668037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 837 | Open in IMG/M |
3300028592|Ga0247822_11694784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Luna cluster → Luna-1 subcluster → Aquiluna → Aquiluna borgnonia | 538 | Open in IMG/M |
3300028592|Ga0247822_11863160 | Not Available | 514 | Open in IMG/M |
3300028592|Ga0247822_11964820 | Not Available | 502 | Open in IMG/M |
3300028802|Ga0307503_10440620 | Not Available | 689 | Open in IMG/M |
3300028812|Ga0247825_10671391 | Not Available | 744 | Open in IMG/M |
3300028812|Ga0247825_10914613 | Not Available | 636 | Open in IMG/M |
3300028812|Ga0247825_11386747 | Not Available | 515 | Open in IMG/M |
3300030336|Ga0247826_10133498 | All Organisms → cellular organisms → Bacteria | 1608 | Open in IMG/M |
3300030336|Ga0247826_11208707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Intrasporangium → Intrasporangium chromatireducens → Intrasporangium chromatireducens Q5-1 | 606 | Open in IMG/M |
3300031455|Ga0307505_10217020 | Not Available | 885 | Open in IMG/M |
3300031548|Ga0307408_100354047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1247 | Open in IMG/M |
3300031740|Ga0307468_101510157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Luna cluster → Luna-1 subcluster → Aquiluna → Aquiluna borgnonia | 623 | Open in IMG/M |
3300031847|Ga0310907_10059871 | All Organisms → cellular organisms → Bacteria | 1513 | Open in IMG/M |
3300031847|Ga0310907_10651927 | Not Available | 578 | Open in IMG/M |
3300031938|Ga0308175_100381263 | Not Available | 1467 | Open in IMG/M |
3300031940|Ga0310901_10218219 | Not Available | 768 | Open in IMG/M |
3300031944|Ga0310884_10068119 | All Organisms → cellular organisms → Bacteria | 1655 | Open in IMG/M |
3300031996|Ga0308176_11309160 | Not Available | 770 | Open in IMG/M |
3300032003|Ga0310897_10042432 | All Organisms → cellular organisms → Bacteria | 1601 | Open in IMG/M |
3300032122|Ga0310895_10113556 | Not Available | 1123 | Open in IMG/M |
3300032122|Ga0310895_10668884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Luna cluster → Luna-1 subcluster → Aquiluna → Aquiluna borgnonia | 538 | Open in IMG/M |
3300033550|Ga0247829_11296613 | Not Available | 603 | Open in IMG/M |
3300033551|Ga0247830_10187808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1535 | Open in IMG/M |
3300033551|Ga0247830_10553703 | Not Available | 908 | Open in IMG/M |
3300033551|Ga0247830_10748942 | Not Available | 777 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 14.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.29% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.12% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 3.53% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.94% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.94% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.35% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.35% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.35% |
Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 2.35% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.76% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.76% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.76% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.76% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.76% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.76% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.76% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.18% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.18% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.18% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.18% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.18% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.18% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.18% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.18% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.18% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.59% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.59% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.59% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.59% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.59% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.59% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.59% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.59% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.59% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.59% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.59% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.59% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.59% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.59% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.59% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.59% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2067725002 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005889 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009868 | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant | Engineered | Open in IMG/M |
3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Host-Associated | Open in IMG/M |
3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014259 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1 | Environmental | Open in IMG/M |
3300014270 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 | Environmental | Open in IMG/M |
3300014300 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1 | Environmental | Open in IMG/M |
3300014311 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 | Environmental | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300023057 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6 | Environmental | Open in IMG/M |
3300023064 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6 | Environmental | Open in IMG/M |
3300023072 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6 | Environmental | Open in IMG/M |
3300023168 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S064-202C-5 | Environmental | Open in IMG/M |
3300023266 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4 | Environmental | Open in IMG/M |
3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
3300025552 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025559 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025796 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026003 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 (SPAdes) | Environmental | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026051 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026960 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A5-10 (SPAdes) | Environmental | Open in IMG/M |
3300027675 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPICC_00759070 | 2067725002 | Soil | MLSPELSRRNNRFGLLLFAIFVALFVGACLIALLYLQVD |
JGI11643J12802_120310952 | 3300000890 | Soil | MLSPELARKNNRLGLALAAIFVALFVGACIVALVYLQVD* |
JGI11615J12901_102507131 | 3300000953 | Soil | MLSPELSRKNNRLGLALFAMFVALFVGACVIALVYLQVD* |
JGI10216J12902_1050094872 | 3300000956 | Soil | MLSPELERRNNRLGLALFALFVVLFAGACVIALIYLQVD* |
JGI24743J22301_101345691 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTPELSRKNNRLGLALAAIFVALFVGACIVALVYLQVDXA |
JGI25406J46586_100732391 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MLTPELERRNVRLGLALFALVLAIFVGAVLIALLYLQVD* |
Ga0055471_100447242 | 3300003987 | Natural And Restored Wetlands | MLSPELSRKNNRYGLVLAALFVALFVGACLVALLYLQVD* |
Ga0055467_101725152 | 3300003996 | Natural And Restored Wetlands | MLSPELSRKNNRFGLLLFAIFVALFVGACLIALLYLQVD* |
Ga0062593_1003528412 | 3300004114 | Soil | MLSPELSRKNNRFGLVLGALFVAIFIGACVIALLYLQVD* |
Ga0062593_1007592722 | 3300004114 | Soil | MLSPELSRKNNRLGLALFAIFVALFVGACVIALIYLQID* |
Ga0062593_1028088382 | 3300004114 | Soil | MLTPELTRRNNRLGLVLAALFVAIFVGACLIAIVYLQVD* |
Ga0062590_1025535782 | 3300004157 | Soil | MLTPELTRRNNRLGLVLGALFVAIFIGACLIALLYLQVD* |
Ga0063356_1021333262 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MLTPELERKNMRLGLWLLAVFVVIFVGACLIAVLYLQVD* |
Ga0063356_1045861402 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MISPELARKNNRFGLALFALFVAIFVGACLIALLYLQVD* |
Ga0063356_1047525401 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MLTPELARKNNRLGLALFAIFVALFVGACVIAVIYLQVD* |
Ga0062595_1005210881 | 3300004479 | Soil | MLSPELSRKNNRFGLALAAIFVALFVGACVIALVYLQVD* |
Ga0062595_1006170952 | 3300004479 | Soil | MLSPELQRKNNRLGLALFALFVVLFVGACVIAVLYLQVD* |
Ga0062594_1016775292 | 3300005093 | Soil | MLTPELERKNNRLGLALFALFVVLFAGACVIALIYLQVD* |
Ga0062594_1028414171 | 3300005093 | Soil | RPVGAVGALMLSPELSRKNNRFGLVLGALFVAIFIGACVIALLYLQVD* |
Ga0066814_100004653 | 3300005162 | Soil | MLSPELSRKNNRLGLALFAIFVALFVGACVIALIYLQVD* |
Ga0070658_100921442 | 3300005327 | Corn Rhizosphere | MLTPELSRKNNRLGLALAAIFVALFVGACIVALVYLQVD* |
Ga0066388_1004585393 | 3300005332 | Tropical Forest Soil | MLSPELSRKNNRFGLLLLAIFVALFVGACVIALLYLQVD* |
Ga0068868_1008006402 | 3300005338 | Miscanthus Rhizosphere | PVGAVGALMLSPELSRKNNRFGLVLGALFVAIFIGACVIALLYLQVD* |
Ga0070689_1006290282 | 3300005340 | Switchgrass Rhizosphere | MLSPELSRKNNRFGLALAAIFVALFVGACIIALVYLQVD* |
Ga0070674_1017771052 | 3300005356 | Miscanthus Rhizosphere | MLTPELERKNMRLGLALLAVFVLIFVGACLIALLYLQVD* |
Ga0070659_1000440614 | 3300005366 | Corn Rhizosphere | MLSPELSRKNNRFGLVLGALFVAIFIGACLIALLYLQVD* |
Ga0070681_108891971 | 3300005458 | Corn Rhizosphere | MISPELARKNNRFGLALLALFVAIFVGACLIALLYLQVD* |
Ga0070685_108033302 | 3300005466 | Switchgrass Rhizosphere | MLSPELSRKNNRLGLALFAVFVALFVGACVIALIYLQVD* |
Ga0070664_1001855082 | 3300005564 | Corn Rhizosphere | MLSPEVSRKNNRFGLALAAIFVALFVGACVIALVYLQVD* |
Ga0070702_1001256253 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSPELSRRNNRLGLALFAVFVALFVGACVIALIYLQVD* |
Ga0068866_103234502 | 3300005718 | Miscanthus Rhizosphere | MLTPELERRNNRLGLALFALFVVLFAGACVIALIYLQVD* |
Ga0068861_1008861602 | 3300005719 | Switchgrass Rhizosphere | MLTPEVERKNMRLGLALFAVFVLIFVGACLIALLYLQVD* |
Ga0068861_1023670371 | 3300005719 | Switchgrass Rhizosphere | PELSRKNNRLGLALAAIFVALFVGACIVALVYLQVD* |
Ga0068870_101919083 | 3300005840 | Miscanthus Rhizosphere | MLSPELSRRNNRFGLLLFAIFVALFVGACLIALLYLQVD* |
Ga0068863_1025557591 | 3300005841 | Switchgrass Rhizosphere | RPPRPLMLSPELSRRNNRFGLLLFAIFVALFVGACLIALLYLQVD* |
Ga0068860_1000095218 | 3300005843 | Switchgrass Rhizosphere | MLSPELSRKNNRFGLALAAILVALFVGACVIALVYLQVD* |
Ga0075290_10431012 | 3300005889 | Rice Paddy Soil | MLTPELTRKNNRLGLVLGALFVAIFIGACLIALLYLQVD* |
Ga0081455_100186722 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MLSPELARKNNRFGLLLFAVFVALFVGACLIALLYLQVD* |
Ga0081455_107273902 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MLSPELSRKNNRFGLVLLAIFVALFVGACVIALLYLQVD* |
Ga0079217_100930112 | 3300006876 | Agricultural Soil | VLSPELERRNNRLGLALFALFVVLFVGACVIALIYLQVD* |
Ga0075419_112173332 | 3300006969 | Populus Rhizosphere | MLTPEVERKNMRLGLVLFAVFVLIFVGACLIALLYLQVD* |
Ga0105098_108335892 | 3300009081 | Freshwater Sediment | VLSPELQRKNMRLGLALFAIFVVLFVGSCVIGLIYLQVD* |
Ga0105245_111263801 | 3300009098 | Miscanthus Rhizosphere | MLTPELTRRNNRLGLVLAALFVAIFVGACLIAIVYL |
Ga0075418_107615842 | 3300009100 | Populus Rhizosphere | MLSPELQRRNNRLGLALFALFVVLFVGACVIAVLYLQVD* |
Ga0114129_117426841 | 3300009147 | Populus Rhizosphere | MLSPELSRKNNRLGLALAAIFVACFVGACIVALV* |
Ga0105243_1000440710 | 3300009148 | Miscanthus Rhizosphere | MLSPEVSRKNNRFGLALAAIFVALFVGACIIALVYLQVD* |
Ga0130016_100005944 | 3300009868 | Wastewater | MLSPELSRKNNRFGLALFALFVALFVGACVIALVYLQVD* |
Ga0131092_1000014857 | 3300009870 | Activated Sludge | MLSPELARKNNRLGVALFAIFVAIFIGACVIALIYLQVD* |
Ga0131077_100283038 | 3300009873 | Wastewater | MLSPELSRKNNRLGLALLAVFVVLFVGACVIALVYLQVD* |
Ga0131077_100651924 | 3300009873 | Wastewater | MLSPELSRKNNRFGLVLFAVFVALFVGACLIALIYLQVD* |
Ga0131077_105383232 | 3300009873 | Wastewater | MLSPELSRKNNRFGLALFAIFVALFVGACVIALIYLQVD* |
Ga0126377_102846242 | 3300010362 | Tropical Forest Soil | MLSPELSRRNNRLGLALFAVFVALFVGACLIALLYLQVD* |
Ga0126377_115982872 | 3300010362 | Tropical Forest Soil | MQSPELSHRNNRFGLALFAVVVALFVGACLIAILYLQVD* |
Ga0134125_105840442 | 3300010371 | Terrestrial Soil | MLSPELSRKNNRFGLVLGALFVAIFIGACVVALLYLQVD* |
Ga0105246_108838822 | 3300011119 | Miscanthus Rhizosphere | GLAMLSPELSRKNNRLGLALFAIFVALFVGACVIALIYLQVD* |
Ga0137424_11293191 | 3300011412 | Soil | VSTPELERKNNRLGLALFALFVVLFVGACAVALIYLQVD* |
Ga0157337_10413012 | 3300012483 | Arabidopsis Rhizosphere | MLTPELARKNNRLGLALFAIFVALFVGACVIAVIY |
Ga0157330_10916262 | 3300012514 | Soil | MHSPELSRKNNRFGLVLGALFVAIFIGACVIALLYLQVD* |
Ga0157304_10536662 | 3300012882 | Soil | MLSPELSRKNNRLGLALFAIFVALFVGACVIAVIYLQVD* |
Ga0157293_100341282 | 3300012898 | Soil | MLTPELSRKNNRLGLALFAIFVALFVGACVIAVIYLQVD* |
Ga0157288_101332702 | 3300012901 | Soil | RKNNRLGLALAAIFVALFVGACIVALVYLQVDSA* |
Ga0164241_100700984 | 3300012943 | Soil | MLTPELTRRNNRLGLVLGALFVAIFVGACLVALLYLQVD* |
Ga0164241_101445222 | 3300012943 | Soil | MLSPELSRKNNRYGLVLAALFVVLFVGACLIALLYLQVD* |
Ga0164241_102925112 | 3300012943 | Soil | MISPELARKNNRFGLALAALFVAIFVGACLIALLYLQVD* |
Ga0164241_105403832 | 3300012943 | Soil | MLSPELTRKNNRLGLALAAIFVALFVGACVVALVYLQVD* |
Ga0164299_108303881 | 3300012958 | Soil | RSPGGLAMVSPELSRKNNGLGLALFAIFVALFVGACVIALIYLQVD* |
Ga0157370_103408591 | 3300013104 | Corn Rhizosphere | PELTRRNNRLGLVLAALFVAIFVGACLIAIVYLQVD* |
Ga0157370_111914262 | 3300013104 | Corn Rhizosphere | MLSPELSRKNNRFGLALAAIFVALFVGACVLALVYLQVD* |
Ga0163162_125334722 | 3300013306 | Switchgrass Rhizosphere | MLTPELSRKHNRLGLALAAIFVALFVGACIVALVYLQVD* |
Ga0163162_128145341 | 3300013306 | Switchgrass Rhizosphere | PAGGVAMLTPELSRKHNRLGLALAAIFVALFVGACVIAVIYLQVD* |
Ga0075311_11427901 | 3300014259 | Natural And Restored Wetlands | VLTPELARRNNRLGLALFAIFLLLFVGACVIALVYLQVD* |
Ga0075325_10389412 | 3300014270 | Natural And Restored Wetlands | VLTPELARRNNRLGLALFAIFVAIFVGACVIALLYLQVD* |
Ga0075325_10542212 | 3300014270 | Natural And Restored Wetlands | MLTPELARRNNRLGLALFAIFVAIFVGACVIALLYLQVD* |
Ga0075321_10419571 | 3300014300 | Natural And Restored Wetlands | MASPELARRNNRLGLVLFAVFVAMFVGACVIALVYLQVD* |
Ga0075322_10867302 | 3300014311 | Natural And Restored Wetlands | MVSPELARRNNRLGLVLFAVFVAMFVGACVIALVYLQVD* |
Ga0182008_106756312 | 3300014497 | Rhizosphere | MLSPELSRRNTRFGLLLFGIFLALFVGACLIALLYLQVD* |
Ga0182008_108145301 | 3300014497 | Rhizosphere | LSRKNNRLGLALAAIFVALFVGACIVALVYLQVD* |
Ga0157379_100581854 | 3300014968 | Switchgrass Rhizosphere | MLSPALSRKNNRFGLLLFAIFVALFVGACVIALVYLQVD* |
Ga0157376_100423514 | 3300014969 | Miscanthus Rhizosphere | MLPPELSRKNNRFGLALAAIFVALFVGACVIALVYLQVD* |
Ga0132258_102582722 | 3300015371 | Arabidopsis Rhizosphere | VLSPELSRKNNRLGLALFAMFVALFLGACVIALIYLQVD* |
Ga0132258_118921712 | 3300015371 | Arabidopsis Rhizosphere | MLSPELSRKNNRLGLALFAIFVALFVGACVVALIYLQVD* |
Ga0132258_124551213 | 3300015371 | Arabidopsis Rhizosphere | MLSPELARKNNRLGLVLLAIFVAIFVGACVVALVYLQVD* |
Ga0190266_100325923 | 3300017965 | Soil | MLSPELQRKNNRLGLALFALFVVLFVGACVIAVLYLQVD |
Ga0190266_108496151 | 3300017965 | Soil | VSTPELERKNNRLGLALFALFVVLFVGACAIAVIY |
Ga0190266_109489551 | 3300017965 | Soil | VSTPELERKNNRLGLALFALFVVLFVGACAIAVIYLQVD |
Ga0190275_100455293 | 3300018432 | Soil | MLTPELERRNMRLGLALLAVFVVLFVGSCLVALIYLQVD |
Ga0190268_107894662 | 3300018466 | Soil | MLTPEVERKNMRLGLALFAVFVLIFVGACLIALLYLQVD |
Ga0190270_113076212 | 3300018469 | Soil | MLTPELERKNNRLGLALFALFLVLFVGACAIAVIYLQVD |
Ga0190271_101724952 | 3300018481 | Soil | MLTPEVERKNMRLGLALFAVFVLIFLGACLIALLYLQVD |
Ga0190271_108572342 | 3300018481 | Soil | MLSPELERRNNRLGLALFALFVVLFVGACVIALIYLQVD |
Ga0190271_114107282 | 3300018481 | Soil | VLSPELERRNNRLGLALFALFVVLFVGACVIALIYLQVD |
Ga0190271_138591162 | 3300018481 | Soil | MLTPELERKNNRLGLALFALFVVLFVGACVIAVIYLQVD |
Ga0173481_100034573 | 3300019356 | Soil | MLTPELARKNNRLGLALFAIFVALFVGACVIAVIYLQVD |
Ga0173481_100416483 | 3300019356 | Soil | MLSPELSRKNNRLGLALFAIFVALFVGACVIALIYLQID |
Ga0173481_100912342 | 3300019356 | Soil | MLSPELQRKNNRLGLALFALFIVLFVGACVIAVLYLQVD |
Ga0173481_103297042 | 3300019356 | Soil | PELSRKNNRFGLLLLALFVALFVGACLVAVLYLQVD |
Ga0173482_100172873 | 3300019361 | Soil | MLSPELARKNNRLGLALAAIFVALFVGACIVALVYLQVD |
Ga0173479_100013943 | 3300019362 | Soil | MLTPELSRKNNRLGLALAAIFVALFVGACIVALVYLQVD |
Ga0206356_102441602 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSPELSRKNNRLGLALFAIFVALFVGACVIALIYL |
Ga0206356_116208422 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTPELTRRNNRLGLVLAALFVAIFVGACLIAIVYLQVD |
Ga0206353_118802561 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSPELSRKINRFGLALFAIFVALFVGACVIALIYLQVD |
Ga0224500_102271972 | 3300022213 | Sediment | MLSPDLARRNTRLGWALFALFVALFVGTCLIALVYLQLD |
Ga0247797_10233951 | 3300023057 | Soil | MLTPELARKNNRLGLALFAIFVALFVGACVIAVIYL |
Ga0247801_10261502 | 3300023064 | Soil | MLTPELARKNNRLGLALFAIFVALFVGACVIAVIYLQV |
Ga0247799_10048793 | 3300023072 | Soil | MLTPELSRKNNRLGLALFAIFVALFVGACVIAVIYLQVD |
Ga0247748_10802082 | 3300023168 | Soil | MLSPELSRKNNRLGLALFAIFVALFVGACVIAVIYLQVD |
Ga0247789_10125352 | 3300023266 | Soil | MLSPELSRKNNRFGLVLGALFVAIFIGACVIALLYLQVD |
Ga0247789_10300482 | 3300023266 | Soil | MLSPELSRKNNRFGLLLFAIFVALFVGACLIALLYLQVD |
Ga0247794_100598432 | 3300024055 | Soil | MLSPELSRKNNRLGLALAAIFVALFVGACIVALVYLQVD |
Ga0210142_10029343 | 3300025552 | Natural And Restored Wetlands | MVSPELARRNNRLGLVLFAVFVAMFVGACVIALVYLQVD |
Ga0210087_10340083 | 3300025559 | Natural And Restored Wetlands | VLTPELARRNNRLGLALFAIFLLLFVGACVIALVYLQVD |
Ga0210113_10125712 | 3300025796 | Natural And Restored Wetlands | VLTPELAHRNNRLGLALFAIFLLLFVGACVIALVYLQVD |
Ga0207653_100652411 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSPELSRRNNRLGLALFAIFVALFVGACVIALIYLQVD |
Ga0207710_101378062 | 3300025900 | Switchgrass Rhizosphere | MLSPELSRKNNRLGLALFAIFVALFVGACVIALIYLQVD |
Ga0207654_105967831 | 3300025911 | Corn Rhizosphere | MLSPELSRKNNRLGLALFAIFVALFVGACVIALIYLQV |
Ga0207660_108551602 | 3300025917 | Corn Rhizosphere | MLTPELTRRNNRLGLVLGALFVAIFIGACLIALLYLQVD |
Ga0207657_106719261 | 3300025919 | Corn Rhizosphere | ELARKNNRLGLALFAIFVALFVGACVIAVIYLQVD |
Ga0207681_111725342 | 3300025923 | Switchgrass Rhizosphere | MDPELSRKNNRFGLALAAIFVALFVGACVIALVYLQVD |
Ga0207659_106887871 | 3300025926 | Miscanthus Rhizosphere | ELSRKNNRFGLVLGALFVAIFIGACVIALLYLQVD |
Ga0207701_109730772 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSPELSRRNNRLGLALFAIFVALFVGACVVALIYLQVD |
Ga0207686_118338532 | 3300025934 | Miscanthus Rhizosphere | RPAGGVAMLTPELSRKNNRLGLALAAIFVALFVGACIVALVYLQVD |
Ga0207709_101588241 | 3300025935 | Miscanthus Rhizosphere | RPARPLMLTPELTRRNNRLGLVLGALFVAIFIGACLIALLYLQVD |
Ga0207661_104982571 | 3300025944 | Corn Rhizosphere | MLSPALSRKNNRFGLLLFAIFVALFVGACLIALLYLQVD |
Ga0207679_105547971 | 3300025945 | Corn Rhizosphere | RRDRPLGALMLSPELSRKNNRFGLLLFAIFVALFVGACLIALLYLQVD |
Ga0207640_103430262 | 3300025981 | Corn Rhizosphere | MLTPELSRKNNRLGLALAAIFVALFVGACIVALVYLQVDGA |
Ga0207640_105005353 | 3300025981 | Corn Rhizosphere | GAVGALMLSPELSRKNNRFGLVLGALFVAIFIGACVIALLYLQVD |
Ga0207658_101865811 | 3300025986 | Switchgrass Rhizosphere | MLSPELSRKNNRLGLALFAIFVALFVGACVIALIY |
Ga0208284_10179652 | 3300026003 | Rice Paddy Soil | MVSPELARRNNRLGLVLFAVFVAMFVGACVIALVYL |
Ga0207677_116048241 | 3300026023 | Miscanthus Rhizosphere | PVGAVGALMLSPELSRKNNRFGLVLGALFVAIFIGACVIALLYLQVD |
Ga0208911_10009612 | 3300026051 | Natural And Restored Wetlands | VLTPELARRNNRLGLALFAIFVAIFVGACVIALLYLQVD |
Ga0207641_124431081 | 3300026088 | Switchgrass Rhizosphere | RPPRPLMLSPELSRRNNRFGLLLFAIFVALFVGACLIALLYLQVD |
Ga0207675_1002325952 | 3300026118 | Switchgrass Rhizosphere | MLSPELSRKNNRFGLVLGALFVAIFIGACLIALLYLQVD |
Ga0207675_1003782903 | 3300026118 | Switchgrass Rhizosphere | PELSRKNNRFGLVLGALFVAIFIGACVIALLYLQVD |
Ga0207683_107877161 | 3300026121 | Miscanthus Rhizosphere | AMLTPELERKNNRLGLALFALFVVLFAGACVIALIYLQVD |
Ga0207582_10246482 | 3300026960 | Soil | MLTPELSRKNNRLGLALAAIFVALFVGACVIAVIYLQVD |
Ga0209077_10696262 | 3300027675 | Freshwater Sediment | VLSPELQRKNMRLGLALFAIFVVLFVGSCVIGLIYLQVD |
Ga0209593_101509252 | 3300027743 | Freshwater Sediment | VLSPELQRKNMRLGLALFAIFVVLFVGSCVIGLIYL |
Ga0268266_113068782 | 3300028379 | Switchgrass Rhizosphere | MLSPELSRKNNRFGLALAAIFVALFVGACVIALVYLQVD |
Ga0268266_123144542 | 3300028379 | Switchgrass Rhizosphere | MLTPELTRRNNRLGLVLGALFVAIFIGACLIALLYLQAD |
Ga0268264_100329194 | 3300028381 | Switchgrass Rhizosphere | MLSPELSRKNNRFGLALAAILVALFVGACVIALVYLQVD |
Ga0268264_108512692 | 3300028381 | Switchgrass Rhizosphere | MLSPELSRKNNRLGLALFAIFVALFVGACIVALVYLQVD |
Ga0247828_100511742 | 3300028587 | Soil | MISPELARKNNRFGLALFALFVAIFVGACLIALLYLQVD |
Ga0247828_104092112 | 3300028587 | Soil | VSTPELARRNNRLGLALFALFVVLFAGACAIALIYLQVD |
Ga0247818_106072022 | 3300028589 | Soil | MLSPELSRKNNRFGLLLFALFVALFVGACLVAVLYLQVD |
Ga0247822_106680372 | 3300028592 | Soil | MLTPELERKNNRLGLALFALFVVLFAGACVIALIYLQVD |
Ga0247822_116947842 | 3300028592 | Soil | PELARRNNRLGLALFALFVVLFAGACAIALIYLQVD |
Ga0247822_118631602 | 3300028592 | Soil | MISPELARKNNRFGLALFALFVAIFVGACLIALLYLLVD |
Ga0247822_119648202 | 3300028592 | Soil | VTSPELERKNNILGLALFALFVVLFVGACAIALIYLQV |
Ga0307503_104406202 | 3300028802 | Soil | MLSPELSRKNNRFGLALAAIFVALFVGACIIALVYLQVD |
Ga0247825_106713912 | 3300028812 | Soil | VSTPELARKNNRLGLALFALFVVLFAGACAIALIYLQVD |
Ga0247825_109146132 | 3300028812 | Soil | MLPPELSRKNNRFGLALAAIFVALFVGACVIALVYLQVD |
Ga0247825_113867472 | 3300028812 | Soil | MLTPELERKNNRLGLALFALFLVLFAGACVIAVIYLQVD |
Ga0247826_101334982 | 3300030336 | Soil | MLTPEVERRNMRLGLALFAVFVLIFVGACLIALLYLQVD |
Ga0247826_112087072 | 3300030336 | Soil | VSPELSRRNNRFGLLLFAIFVALFVGACLIALLYLQVD |
Ga0307505_102170202 | 3300031455 | Soil | MLSPELSRKNNRLGLALFAIFVALFVGACVVALIYLQVD |
Ga0307408_1003540472 | 3300031548 | Rhizosphere | MLSPELARKNNRLGLALGAIFVALFVGACIVALVYLQVD |
Ga0307468_1015101572 | 3300031740 | Hardwood Forest Soil | MLSPELQRKNHRLGLALFALFVVLFVGACVIAVLYLQVD |
Ga0310907_100598711 | 3300031847 | Soil | MLSPELSRKNNRFGLVLGALFVAIFIGACVIALLYLQ |
Ga0310907_106519272 | 3300031847 | Soil | MLSPELSRKNNRFGLLLFAIFVALFVGACLIALLYL |
Ga0308175_1003812632 | 3300031938 | Soil | MPSPELSRKNNRFGLVLAGLFVALFIGACLVAILYLQVD |
Ga0310901_102182191 | 3300031940 | Soil | GALMLSPELSRKNNRFGLVLGALFVAIFIGACVIALLYLQVD |
Ga0310884_100681192 | 3300031944 | Soil | MLSPELSRKNNRLGLALFAIFVALFVGACVIALIYLPVD |
Ga0308176_113091601 | 3300031996 | Soil | RPPRPLMLSPELSRRNNRLGLLLFGIFVALFVGACLIALLYLQVD |
Ga0310897_100424322 | 3300032003 | Soil | MPTPELERKNNRLGLALFALFVVLFAGACVIALIYLQVD |
Ga0310895_101135561 | 3300032122 | Soil | MLSPELQRRNNRLGLALFALFVVLFVGACVIAVLYLQVD |
Ga0310895_106688842 | 3300032122 | Soil | RPGGDVAMLTPELERKNNRLGLALFALFVVLFAGACVIALIYLQVD |
Ga0247829_112966132 | 3300033550 | Soil | GDVAMLTPELERKNNRLGLALFALFVVLFAGACVIALIYLQVD |
Ga0247830_101878081 | 3300033551 | Soil | RPVGAVGALMLSPELSRKNNRFGLVLGALFVAIFIGACVIALLYLQVD |
Ga0247830_105537031 | 3300033551 | Soil | LSPELSRKNNRFGLLLFAIFVALFVGACLIALLYLQVD |
Ga0247830_107489421 | 3300033551 | Soil | MLSPELSRKNNRFGLLLFALFVALFVGACLVAVLY |
⦗Top⦘ |