Metagenome Family F036064

Basic Information
Family ID	F036064
Family Type	Metagenome
Number of Sequences	170
Average Sequence Length	42 residues
Representative Sequence	MEPGFPMADDPDMHEELIEDFDDAAMAIVDITSAQDVINKVFD
Number of Associated Samples	67
Number of Associated Scaffolds	169

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	56.80 %
% of genes near scaffold ends (potentially truncated)	13.53 %
% of genes from short scaffolds (< 2000 bps)	99.41 %
Associated GOLD sequencing projects	67
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.36

Most Common Taxonomy
Group	Unclassified (86.471 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (97.647 % of family members)
Environment Ontology (ENVO)	Unclassified (97.647 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (97.647 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 38.03% β-sheet: 0.00% Coil/Unstructured: 61.97%
Feature Viewer

Powered by Feature Viewer

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.47 %
All Organisms	root	All Organisms	13.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.47 %
cellular organisms	root	All Organisms → cellular organisms	13.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.47 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	13.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.47 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	13.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.47 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	13.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.47 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	13.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.47 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	13.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.47 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	11.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.47 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	11.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.47 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	11.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.47 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	11.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.47 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	11.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.47 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	9.41 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	2.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.47 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	9.41 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	2.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.47 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	9.41 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	2.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.47 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	9.41 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	2.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.47 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	9.41 %
malvids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids	2.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.47 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	7.65 %
Malvales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales	2.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.47 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	7.06 %
Malvaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae	2.35 %
Arundinoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.47 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	7.06 %
Malvoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae	2.35 %
Arundineae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.47 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	7.06 %
Gossypium	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium	2.35 %
Arundo	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.47 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	7.06 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	2.35 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.47 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	7.06 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	2.35 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.47 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	7.06 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	2.35 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.47 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	7.06 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	2.35 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.59 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300009148\|Ga0105243_13030934	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	509	Open in IMG/M
3300011119\|Ga0105246_12306769	Not Available	526	Open in IMG/M
3300013297\|Ga0157378_11989650	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	631	Open in IMG/M
3300015267\|Ga0182122_1060456	Not Available	529	Open in IMG/M
3300015268\|Ga0182154_1013831	Not Available	791	Open in IMG/M
3300015268\|Ga0182154_1038196	Not Available	606	Open in IMG/M
3300015268\|Ga0182154_1057134	Not Available	541	Open in IMG/M
3300015269\|Ga0182113_1021490	Not Available	783	Open in IMG/M
3300015269\|Ga0182113_1047672	Not Available	625	Open in IMG/M
3300015269\|Ga0182113_1054721	Not Available	600	Open in IMG/M
3300015269\|Ga0182113_1057259	Not Available	592	Open in IMG/M
3300015269\|Ga0182113_1098054	Not Available	501	Open in IMG/M
3300015274\|Ga0182188_1002820	Not Available	1135	Open in IMG/M
3300015274\|Ga0182188_1005798	Not Available	927	Open in IMG/M
3300015275\|Ga0182172_1012765	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	824	Open in IMG/M
3300015275\|Ga0182172_1050246	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	571	Open in IMG/M
3300015276\|Ga0182170_1032481	Not Available	646	Open in IMG/M
3300015276\|Ga0182170_1037221	Not Available	622	Open in IMG/M
3300015276\|Ga0182170_1062009	Not Available	538	Open in IMG/M
3300015276\|Ga0182170_1075186	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	507	Open in IMG/M
3300015277\|Ga0182128_1056073	Not Available	558	Open in IMG/M
3300015277\|Ga0182128_1061849	Not Available	542	Open in IMG/M
3300015277\|Ga0182128_1067626	Not Available	528	Open in IMG/M
3300015279\|Ga0182174_1015328	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	817	Open in IMG/M
3300015279\|Ga0182174_1054054	Not Available	579	Open in IMG/M
3300015279\|Ga0182174_1057169	Not Available	569	Open in IMG/M
3300015282\|Ga0182124_1016137	Not Available	790	Open in IMG/M
3300015282\|Ga0182124_1037543	Not Available	631	Open in IMG/M
3300015282\|Ga0182124_1063521	Not Available	543	Open in IMG/M
3300015283\|Ga0182156_1018568	Not Available	785	Open in IMG/M
3300015283\|Ga0182156_1036760	Not Available	649	Open in IMG/M
3300015283\|Ga0182156_1045133	Not Available	613	Open in IMG/M
3300015283\|Ga0182156_1074516	Not Available	529	Open in IMG/M
3300015283\|Ga0182156_1077672	Not Available	522	Open in IMG/M
3300015285\|Ga0182186_1021532	Not Available	742	Open in IMG/M
3300015287\|Ga0182171_1055020	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	580	Open in IMG/M
3300015287\|Ga0182171_1060806	Not Available	563	Open in IMG/M
3300015288\|Ga0182173_1031374	Not Available	673	Open in IMG/M
3300015289\|Ga0182138_1017237	Not Available	799	Open in IMG/M
3300015289\|Ga0182138_1082250	Not Available	515	Open in IMG/M
3300015291\|Ga0182125_1043935	Not Available	632	Open in IMG/M
3300015291\|Ga0182125_1062006	Not Available	572	Open in IMG/M
3300015292\|Ga0182141_1034545	Not Available	675	Open in IMG/M
3300015292\|Ga0182141_1050452	Not Available	606	Open in IMG/M
3300015295\|Ga0182175_1059000	Not Available	588	Open in IMG/M
3300015295\|Ga0182175_1098075	Not Available	503	Open in IMG/M
3300015298\|Ga0182106_1015478	Not Available	877	Open in IMG/M
3300015298\|Ga0182106_1026713	Not Available	749	Open in IMG/M
3300015298\|Ga0182106_1065016	Not Available	580	Open in IMG/M
3300015299\|Ga0182107_1060913	Not Available	594	Open in IMG/M
3300015300\|Ga0182108_1025308	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	771	Open in IMG/M
3300015300\|Ga0182108_1079082	Not Available	552	Open in IMG/M
3300015302\|Ga0182143_1041765	Not Available	663	Open in IMG/M
3300015302\|Ga0182143_1043659	Not Available	654	Open in IMG/M
3300015303\|Ga0182123_1021206	Not Available	776	Open in IMG/M
3300015303\|Ga0182123_1048834	Not Available	617	Open in IMG/M
3300015304\|Ga0182112_1022060	Not Available	796	Open in IMG/M
3300015304\|Ga0182112_1089258	Not Available	530	Open in IMG/M
3300015305\|Ga0182158_1034804	Not Available	696	Open in IMG/M
3300015305\|Ga0182158_1050436	Not Available	627	Open in IMG/M
3300015305\|Ga0182158_1074202	Not Available	559	Open in IMG/M
3300015305\|Ga0182158_1081496	Not Available	543	Open in IMG/M
3300015305\|Ga0182158_1090505	Not Available	526	Open in IMG/M
3300015305\|Ga0182158_1101101	Not Available	508	Open in IMG/M
3300015307\|Ga0182144_1020295	Not Available	823	Open in IMG/M
3300015307\|Ga0182144_1025084	Not Available	776	Open in IMG/M
3300015307\|Ga0182144_1052027	Not Available	629	Open in IMG/M
3300015307\|Ga0182144_1072114	Not Available	571	Open in IMG/M
3300015307\|Ga0182144_1072752	Not Available	570	Open in IMG/M
3300015308\|Ga0182142_1036271	Not Available	712	Open in IMG/M
3300015308\|Ga0182142_1099781	Not Available	526	Open in IMG/M
3300015314\|Ga0182140_1051955	Not Available	644	Open in IMG/M
3300015321\|Ga0182127_1025860	Not Available	811	Open in IMG/M
3300015321\|Ga0182127_1058553	Not Available	638	Open in IMG/M
3300015321\|Ga0182127_1077359	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	586	Open in IMG/M
3300015321\|Ga0182127_1087868	Not Available	563	Open in IMG/M
3300015321\|Ga0182127_1102369	Not Available	536	Open in IMG/M
3300015322\|Ga0182110_1047943	Not Available	675	Open in IMG/M
3300015323\|Ga0182129_1040133	Not Available	691	Open in IMG/M
3300015323\|Ga0182129_1043707	Not Available	674	Open in IMG/M
3300015323\|Ga0182129_1044278	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	672	Open in IMG/M
3300015323\|Ga0182129_1100657	Not Available	526	Open in IMG/M
3300015341\|Ga0182187_1063184	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	756	Open in IMG/M
3300015341\|Ga0182187_1083962	Not Available	686	Open in IMG/M
3300015342\|Ga0182109_1130128	Not Available	618	Open in IMG/M
3300015343\|Ga0182155_1110327	Not Available	654	Open in IMG/M
3300015343\|Ga0182155_1145193	Not Available	592	Open in IMG/M
3300015344\|Ga0182189_1079398	Not Available	744	Open in IMG/M
3300015344\|Ga0182189_1086654	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	721	Open in IMG/M
3300015344\|Ga0182189_1210017	Not Available	520	Open in IMG/M
3300015344\|Ga0182189_1212752	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	517	Open in IMG/M
3300015344\|Ga0182189_1218157	Not Available	512	Open in IMG/M
3300015345\|Ga0182111_1088453	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	741	Open in IMG/M
3300015345\|Ga0182111_1139151	Not Available	626	Open in IMG/M
3300015346\|Ga0182139_1090435	Not Available	736	Open in IMG/M
3300015346\|Ga0182139_1179985	Not Available	568	Open in IMG/M
3300015346\|Ga0182139_1219923	Not Available	525	Open in IMG/M
3300015347\|Ga0182177_1085129	Not Available	755	Open in IMG/M
3300015347\|Ga0182177_1137421	Not Available	632	Open in IMG/M
3300015347\|Ga0182177_1162941	Not Available	592	Open in IMG/M
3300015347\|Ga0182177_1189371	Not Available	559	Open in IMG/M
3300015347\|Ga0182177_1214337	Not Available	533	Open in IMG/M
3300015347\|Ga0182177_1233974	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	515	Open in IMG/M
3300015351\|Ga0182161_1076814	Not Available	819	Open in IMG/M
3300015351\|Ga0182161_1163696	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	612	Open in IMG/M
3300015351\|Ga0182161_1241561	Not Available	523	Open in IMG/M
3300015355\|Ga0182159_1082418	Not Available	927	Open in IMG/M
3300015355\|Ga0182159_1168715	Not Available	691	Open in IMG/M
3300015355\|Ga0182159_1209731	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	630	Open in IMG/M
3300015355\|Ga0182159_1225340	Not Available	611	Open in IMG/M
3300015355\|Ga0182159_1288066	Not Available	548	Open in IMG/M
3300015355\|Ga0182159_1334722	Not Available	513	Open in IMG/M
3300015361\|Ga0182145_1031828	Not Available	909	Open in IMG/M
3300015361\|Ga0182145_1042480	Not Available	831	Open in IMG/M
3300015361\|Ga0182145_1048806	Not Available	795	Open in IMG/M
3300015361\|Ga0182145_1107819	Not Available	613	Open in IMG/M
3300015361\|Ga0182145_1165726	Not Available	530	Open in IMG/M
3300017404\|Ga0182203_1163714	Not Available	502	Open in IMG/M
3300017407\|Ga0182220_1012501	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	903	Open in IMG/M
3300017407\|Ga0182220_1049272	Not Available	628	Open in IMG/M
3300017407\|Ga0182220_1095273	Not Available	522	Open in IMG/M
3300017409\|Ga0182204_1035621	Not Available	724	Open in IMG/M
3300017409\|Ga0182204_1039820	Not Available	700	Open in IMG/M
3300017409\|Ga0182204_1107314	Not Available	520	Open in IMG/M
3300017410\|Ga0182207_1021895	Not Available	983	Open in IMG/M
3300017410\|Ga0182207_1127623	Not Available	562	Open in IMG/M
3300017411\|Ga0182208_1033812	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	756	Open in IMG/M
3300017411\|Ga0182208_1108535	Not Available	532	Open in IMG/M
3300017413\|Ga0182222_1025754	Not Available	728	Open in IMG/M
3300017413\|Ga0182222_1075155	Not Available	553	Open in IMG/M
3300017415\|Ga0182202_1104456	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	553	Open in IMG/M
3300017420\|Ga0182228_1046803	Not Available	732	Open in IMG/M
3300017424\|Ga0182219_1071073	Not Available	621	Open in IMG/M
3300017425\|Ga0182224_1052642	Not Available	722	Open in IMG/M
3300017425\|Ga0182224_1092309	Not Available	608	Open in IMG/M
3300017425\|Ga0182224_1116205	Not Available	565	Open in IMG/M
3300017427\|Ga0182190_1093144	Not Available	613	Open in IMG/M
3300017430\|Ga0182192_1045841	Not Available	794	Open in IMG/M
3300017430\|Ga0182192_1121658	Not Available	569	Open in IMG/M
3300017433\|Ga0182206_1064861	Not Available	670	Open in IMG/M
3300017433\|Ga0182206_1102478	Not Available	579	Open in IMG/M
3300017433\|Ga0182206_1122154	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	548	Open in IMG/M
3300017436\|Ga0182209_1066086	Not Available	686	Open in IMG/M
3300017436\|Ga0182209_1066086	Not Available	686	Open in IMG/M
3300017436\|Ga0182209_1125580	Not Available	560	Open in IMG/M
3300017436\|Ga0182209_1131771	Not Available	551	Open in IMG/M
3300017436\|Ga0182209_1140646	Not Available	539	Open in IMG/M
3300017436\|Ga0182209_1171840	Not Available	503	Open in IMG/M
3300017438\|Ga0182191_1078233	Not Available	669	Open in IMG/M
3300017438\|Ga0182191_1113990	Not Available	591	Open in IMG/M
3300017438\|Ga0182191_1126364	Not Available	571	Open in IMG/M
3300017442\|Ga0182221_1023860	Not Available	912	Open in IMG/M
3300017442\|Ga0182221_1052325	Not Available	724	Open in IMG/M
3300017442\|Ga0182221_1146633	Not Available	527	Open in IMG/M
3300017443\|Ga0182193_1125677	Not Available	589	Open in IMG/M
3300017682\|Ga0182229_1079646	Not Available	568	Open in IMG/M
3300017683\|Ga0182218_1116476	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	549	Open in IMG/M
3300017684\|Ga0182225_1097202	Not Available	569	Open in IMG/M
3300017684\|Ga0182225_1115077	Not Available	540	Open in IMG/M
3300017685\|Ga0182227_1061893	Not Available	680	Open in IMG/M
3300017685\|Ga0182227_1083177	Not Available	605	Open in IMG/M
3300017685\|Ga0182227_1114937	Not Available	536	Open in IMG/M
3300017685\|Ga0182227_1116890	Not Available	532	Open in IMG/M
3300017685\|Ga0182227_1133683	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	506	Open in IMG/M
3300017686\|Ga0182205_1162678	Not Available	511	Open in IMG/M
3300017690\|Ga0182223_1043979	Not Available	670	Open in IMG/M
3300017690\|Ga0182223_1047218	Not Available	657	Open in IMG/M
3300017690\|Ga0182223_1078135	Not Available	573	Open in IMG/M
3300026089\|Ga0207648_12276849	Not Available	502	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	97.65%
Rhizosphere	Host-Associated → Plants → Rhizosphere	1.76%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.59%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	97.65%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.76%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.59%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	97.65%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.76%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.59%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	97.65%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.18%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.59%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.59%

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0105243_130309342	3300009148	Miscanthus Rhizosphere	HNLRTMELGFPMADDPNMHKELIEDFDDATVTIVDITLAQDVVNKVFD*
Ga0105246_123067692	3300011119	Miscanthus Rhizosphere	MELGFSMANDLDMHEDLLEGFDDAAAAIVDTTSAQDVINKVFY*
Ga0157378_119896502	3300013297	Miscanthus Rhizosphere	MEPGFPMADDPNMHKELIEDFDDAVAAIMDITPAQDVVNKVFD*
Ga0182122_10604561	3300015267	Miscanthus Phyllosphere	MEPGFPMVDDPNMHKELIKDFDDDATAIVDITLGQDIVNKVFD*
Ga0182154_10138312	3300015268	Miscanthus Phyllosphere	MELGFPMADDPDMHKDLIEDFDDDVAAIVDITPAQDVVNKVFN*
Ga0182154_10381961	3300015268	Miscanthus Phyllosphere	MEPGFPMADDPNMHEDLIEDFDDAAAAIMDITSAQEVINKVF*
Ga0182154_10571342	3300015268	Miscanthus Phyllosphere	MELGFPMADDPDMHEELIEDFDDAAAAIMDITSTQDVINKVFD*
Ga0182113_10214902	3300015269	Miscanthus Phyllosphere	MEPGFPMADDLNMHKELIEDFDDDAAAIVDITPAQDVVNKVFD*
Ga0182113_10476721	3300015269	Miscanthus Phyllosphere	MEPGFSMADDPDMHKELIEDFDDAATAIVDITSTQDVINKVFY*
Ga0182113_10547212	3300015269	Miscanthus Phyllosphere	MELSFPMADDPDMHEELIEDFDNAITVIVDITPAQDVVNNLFD*
Ga0182113_10572591	3300015269	Miscanthus Phyllosphere	MELGFPMADDPDMHKELIEDFDDDVAATVDITPAQDVVNKVFD*
Ga0182113_10980542	3300015269	Miscanthus Phyllosphere	MELGFPMPDDLEMHKELIKDFDDAAAAIVDITSAQDVINKVFD*
Ga0182188_10028201	3300015274	Miscanthus Phyllosphere	MGLGFPMTDDPDMHEELIEDFDDAAAAIMDITSAQDVINKIFD*
Ga0182188_10057981	3300015274	Miscanthus Phyllosphere	TGHDLRTMEPGFPMANDLDMHKELIEDFNDAAVAIVDITPSQDVVNKVFD*
Ga0182172_10127652	3300015275	Miscanthus Phyllosphere	MEPGFPMADDPDMHKELIEDCDDAATAIVDITPAQDVVNKVFD*
Ga0182172_10502462	3300015275	Miscanthus Phyllosphere	MESGFLMADDPDMHEDLIEDFGDAADAIVDIISAQDVINNVFD*
Ga0182170_10324812	3300015276	Miscanthus Phyllosphere	MADDLDMHKELIEDFDDDVAAIADITPAQDIVNKVFG*
Ga0182170_10372211	3300015276	Miscanthus Phyllosphere	MQPGFPMADDLDMHEDLIEDFDDATAAIVDITSAQDVINKVFD*
Ga0182170_10620091	3300015276	Miscanthus Phyllosphere	MEPGLPMTDDPDMHKELIEDFDDDVAATVDITPAQDVVNKVFD*
Ga0182170_10751862	3300015276	Miscanthus Phyllosphere	ELRTMEPGFPMVNDLDMHEGWIEDFDDAAAAIMDTTSAQDVINKVFD*
Ga0182128_10560731	3300015277	Miscanthus Phyllosphere	MEPGFSMANDPNMHADLIEDFEDAAAAIMDITSAQDVINRVFD*
Ga0182128_10618491	3300015277	Miscanthus Phyllosphere	MKPGFPMADDPNMHKELIKDFNDATAAIVDITPAQDVVNKVFD*
Ga0182128_10676261	3300015277	Miscanthus Phyllosphere	MEPGFPMADDPDMHEDLIKDFDDAAATIVDITSAQDIINKVFD*
Ga0182174_10153282	3300015279	Miscanthus Phyllosphere	MADDPDMHQELIEDFDDATAAIVDITPAQDVVNKVFD*
Ga0182174_10540541	3300015279	Miscanthus Phyllosphere	MEPGFPMVDDPDMHEELIEDFDDAAVAIVDITSTQDVINKVFD*
Ga0182174_10571691	3300015279	Miscanthus Phyllosphere	MEPGFPMADDPDMHEELIEDFDDAAAAIMDITSTEDVLNK
Ga0182124_10161371	3300015282	Miscanthus Phyllosphere	MELGSQMADDPDIHKELIEDFDDAVAAIVDITPAQDVVNKVFD*
Ga0182124_10375431	3300015282	Miscanthus Phyllosphere	MESGFLMADDPDMHKELIEDFDDTVAAIVDITLAQDVVNKVFD*
Ga0182124_10635211	3300015282	Miscanthus Phyllosphere	MELGFPMADDPDMHKNLIEDFNDAAAAIVDITSTQDIINEVFD*
Ga0182156_10185682	3300015283	Miscanthus Phyllosphere	MEPGFPKADDPNMHRELIEDFDDDAAAIVDITPAQDVMNKIFD*
Ga0182156_10367601	3300015283	Miscanthus Phyllosphere	MELGFPMADDPNMNKEQIEDFDDAMAAIVDITPAQDVVNKVFD*
Ga0182156_10451331	3300015283	Miscanthus Phyllosphere	MESGFLMAGDPNMHKDLIEDFDDDTAAIVDITSAQEIINKVF*
Ga0182156_10745162	3300015283	Miscanthus Phyllosphere	MEPGFPMADDLDMHEDLIKDFDDAAAAIMDITSAQDVINKVFD*
Ga0182156_10776721	3300015283	Miscanthus Phyllosphere	PMADDPDMHEELIEDFDDAAMAIVDITSAQDVINKVFD*
Ga0182186_10215322	3300015285	Miscanthus Phyllosphere	MEPGFLMANDPDMHEELIEDFDDAVAATVDITLAQDVVNKVFD*
Ga0182171_10550201	3300015287	Miscanthus Phyllosphere	HTIEMGFPMADDPDMLEHLIEDFDDDAAAIMDITSTQDVINKVFE*
Ga0182171_10608062	3300015287	Miscanthus Phyllosphere	MESGFLMVDDPDMHDELIKNFDDATAAIVDITSAQDVINKVFE*
Ga0182173_10313742	3300015288	Miscanthus Phyllosphere	MEPGFPMTDDLDMHKELIEDFDDTTAAIVDITPAQDVVNMVFD*
Ga0182138_10172371	3300015289	Miscanthus Phyllosphere	MEAGLPMADDPNIHEDLIEDFDDAATAIMDITSAQDVINKVFD*
Ga0182138_10822502	3300015289	Miscanthus Phyllosphere	MEPGFPMADDPDMHKELIEDFDDAAAAIVDITPAQDVVNKVFN*
Ga0182125_10439351	3300015291	Miscanthus Phyllosphere	MEPGFLMANDPNMHKELIKDFDDTMVAIADITPAQDVLNKV
Ga0182125_10620062	3300015291	Miscanthus Phyllosphere	MEPGFPMANDPDMHEELIEDFDDASTAIVDITSAQDVINKVFD*
Ga0182141_10345452	3300015292	Miscanthus Phyllosphere	MESGFPMSDDPDMHKELIEDFDDAAAAIVDITPAQDVVNKVFD*
Ga0182141_10504522	3300015292	Miscanthus Phyllosphere	MESGFPMADDPDMHEELIEDFNDVTGAIVDITSAQNVINKVFD*
Ga0182175_10590002	3300015295	Miscanthus Phyllosphere	MEPGFPMANDPNMHEELIKDFDDAMISIVDITLAQDVVNKVFD*
Ga0182175_10980751	3300015295	Miscanthus Phyllosphere	MEPGFPMADDPDLHEDLIKDFSDAAAAIVDITSAQDVINK
Ga0182106_10154781	3300015298	Miscanthus Phyllosphere	MEPSFPMADDLDMHKELIENFDDAVAAIVDITPAQDIVNKVFD*
Ga0182106_10267132	3300015298	Miscanthus Phyllosphere	MADDPDVHENLIEDFNDVAVAIVDITSTQDVINKVLD*
Ga0182106_10650161	3300015298	Miscanthus Phyllosphere	MEPGFPMANDPDMHEELIEDFDDAVATIVDITPAQGVVNKLFD*
Ga0182107_10609132	3300015299	Miscanthus Phyllosphere	MELGFPMANDPDIHEELIEDFDDAATAIVDITSAQDMINKFFD*
Ga0182108_10253081	3300015300	Miscanthus Phyllosphere	MEPGFPIADDPDMNEELIENFDDNVATIVDIMPAQDVVNKVFD*
Ga0182108_10790821	3300015300	Miscanthus Phyllosphere	MEPGFPMADDPDLHEELIEDFDDADAAIMDITSAQEVINKVFD*
Ga0182143_10417653	3300015302	Miscanthus Phyllosphere	MEPGFPMADDPNMHEELIEEFDDVDVAIVDITSAQDVINKVFD*
Ga0182143_10436591	3300015302	Miscanthus Phyllosphere	MEPGFLMADDPNMHEELIEDFDDATVAIVDVTLAQDLVNKVFN*
Ga0182123_10212062	3300015303	Miscanthus Phyllosphere	MADDPDMHEELIEDFNDATMIIVDITPAQDVVNEVFD*
Ga0182123_10488342	3300015303	Miscanthus Phyllosphere	MEPGFPMADDPNMHKELIEDFDDAAAAIVDITPTQDVVNKVFD*
Ga0182112_10220602	3300015304	Miscanthus Phyllosphere	MKPGFPMADDPNMHKELIEDFNDATTAIVDITPAQDVVNKVFD*
Ga0182112_10892582	3300015304	Miscanthus Phyllosphere	MELGFPMADDPNMHEELIEDFDDATAAIVDIMPAKDVVNKVFD*
Ga0182158_10348043	3300015305	Miscanthus Phyllosphere	MADDPDMHKELIEDCDDTAAAIVDITPAQDGVNKVFD*
Ga0182158_10504361	3300015305	Miscanthus Phyllosphere	MEPGFPMVDDPNMHEELIEDFDDGAAAIVDITLAQDIVNKVFD*
Ga0182158_10742021	3300015305	Miscanthus Phyllosphere	DDPDMHKELIEDFDDDVAAIVDITLAQDVVNKVFD*
Ga0182158_10814961	3300015305	Miscanthus Phyllosphere	MEPGFPMADDPDMHNELIEDFDDDAAAIVDITPAQDVVNKVFD*
Ga0182158_10905051	3300015305	Miscanthus Phyllosphere	MESGFPMSDDPDMHKELIGDFDDAAVAIMDITLAQDVVNKVFD*
Ga0182158_11011011	3300015305	Miscanthus Phyllosphere	MEPGFPMADDPDMHEDLIEDFGDAADAIVDIISAQDVINKVFD*
Ga0182144_10202951	3300015307	Miscanthus Phyllosphere	MEPGFPMADDPNMHKEMIVDFDDTAAAIVDIIPAQDVCEQSV*
Ga0182144_10250842	3300015307	Miscanthus Phyllosphere	MESGFPMADDPDIHKELIEDSNDAAAAIVDITPAQDVVNKVFD*
Ga0182144_10520271	3300015307	Miscanthus Phyllosphere	MEPGFPMADDPDMHEDLIEDFDNTVVAIMDITSTQDVINKVFD*
Ga0182144_10721142	3300015307	Miscanthus Phyllosphere	MELGFPMADNPEMQEELIKNFDDAAAAIVDITSAQDVINKVFD*
Ga0182144_10727522	3300015307	Miscanthus Phyllosphere	MELGFPMADDPNKHEDLIEDFEDATATIVDITSAQDVINRVFD*
Ga0182142_10362711	3300015308	Miscanthus Phyllosphere	MEPSFSMVNNLNMHEELIEDFDDAAVAIMDITSTQNVINKVFD*
Ga0182142_10997812	3300015308	Miscanthus Phyllosphere	MELGFPMADDPDMHKEQIEDFNNTTVAIVDIIPAQDVCEQSV*
Ga0182140_10519551	3300015314	Miscanthus Phyllosphere	MEPAFPMVDDPDMHKELIEDFDGVAAAIVNITPVQDVVNKVFD*
Ga0182127_10258602	3300015321	Miscanthus Phyllosphere	MEPGFPMDDDPNMHMEPIEDFDDDATTIVDITPAQDIVNKVFDYLVLGANDE*
Ga0182127_10585531	3300015321	Miscanthus Phyllosphere	MADDPDMHEELIEDFDDAAAAIVDITCTQDVINKVFD*
Ga0182127_10773591	3300015321	Miscanthus Phyllosphere	QTGHDLHAMEPGFPMVDDPNMHEELIEDFDVDAAAIVDITPARDVVNNVFD*
Ga0182127_10878681	3300015321	Miscanthus Phyllosphere	MEPGFPMADDPNMHEELIEDFDDAATAIVDITFAQDVINKVFD*
Ga0182127_11023691	3300015321	Miscanthus Phyllosphere	MESGFPMADDPNMHKELIEDFNDVAAAIVDIIPGQDVVNMVLD*
Ga0182110_10479432	3300015322	Miscanthus Phyllosphere	MELGFAMGDDPNMHKDLIEDVDDTTAAIVDITRTQDVVNKVFD*
Ga0182129_10401332	3300015323	Miscanthus Phyllosphere	MNAMEPGFPMVDDPNMHEELIEDFDVDAAAIVDITPAQDVVNKVFD*
Ga0182129_10437071	3300015323	Miscanthus Phyllosphere	MESGFLMADDPNMHEDLIKDFEDAAAAIVDITSAQDVINKVFE*
Ga0182129_10442781	3300015323	Miscanthus Phyllosphere	MEPGFPMADDLDMHKELIEDFDDDVAAIADITPAQDIVNKVFG*
Ga0182129_11006572	3300015323	Miscanthus Phyllosphere	MNPNMHEELIEDFDDAAAAIMDITSAQDVINKIFD*
Ga0182187_10631842	3300015341	Miscanthus Phyllosphere	MELGFPMADDPNMHKELIEDFNDAAATIVDVTPAQDVVNRVFD*
Ga0182187_10839621	3300015341	Miscanthus Phyllosphere	MELGFPMAVALDMHEELIKDFDDAVVAIVDITSTQDVINKVFD*
Ga0182109_11301282	3300015342	Miscanthus Phyllosphere	MEPGFPMADDLGMHEELIEDFDDAAAAIVDITSAQDVINKVFD*
Ga0182155_11103272	3300015343	Miscanthus Phyllosphere	MESGFPMADDPNMHKELIEDFDDAVAAIMDITPAQDVVNKVFD*
Ga0182155_11451931	3300015343	Miscanthus Phyllosphere	MELGFPMADDHDMHEDLIKDFDDASAAIMDITSAQDVINKLL
Ga0182189_10793982	3300015344	Miscanthus Phyllosphere	MADDPDMHEELIEDFDDAAAAIVDITSAQDMINKVFD*
Ga0182189_10866541	3300015344	Miscanthus Phyllosphere	MGDDPDMHKELIKDFDDAVAAIVDITPAQDVVNKVFD*
Ga0182189_12100171	3300015344	Miscanthus Phyllosphere	MADDPDMHEELIEDFDDAAAAIMDITSTQDVINKVFD*
Ga0182189_12127522	3300015344	Miscanthus Phyllosphere	MEPGFLMTNDPNMHEDLIEDFEDVVAAIMDITSAQDIINKVFD*
Ga0182189_12181571	3300015344	Miscanthus Phyllosphere	MEPGFPMADDPDMHKELIEDFDDNAVAIVDITLAQDVVNKVFD*
Ga0182111_10884531	3300015345	Miscanthus Phyllosphere	MELSFLMADDLDMHKELIKDFDEVTATIVDITPAQDDVNKVFD*
Ga0182111_11391511	3300015345	Miscanthus Phyllosphere	MELGFPMVDDPDMHKEMIEDFGDAAVAIVDITLAQDVVNKVFD*
Ga0182139_10904351	3300015346	Miscanthus Phyllosphere	MEPGFPMADDPNMHEDLIEDFDDDAAAIVDITSAQDVINKVFE*
Ga0182139_11799851	3300015346	Miscanthus Phyllosphere	MELGFPMADDPDMHEELIEDFDDVVVAIVDITSAQDVINKVFD*
Ga0182139_12199231	3300015346	Miscanthus Phyllosphere	MELGFPMVDDPDMHEELIEDFDDAVAAIVDITPAQDVVNKVFD*
Ga0182177_10851291	3300015347	Miscanthus Phyllosphere	MELSFSMVNNLNMHEELIEDFDVVAGAIVDIISAQDVINKVFD*
Ga0182177_11374212	3300015347	Miscanthus Phyllosphere	MADDPDMHEELIEDFNDATATIVDITPAQDVVNEVFD*
Ga0182177_11629411	3300015347	Miscanthus Phyllosphere	MEPGFPMVDDPNMHEDQIKDFEDAVAAIVDITSAQDVINRVFD*
Ga0182177_11893711	3300015347	Miscanthus Phyllosphere	MELGFPMADDPDMRKELIEDFDDNTVAIVDITPAQDVVNKVFD*
Ga0182177_12143371	3300015347	Miscanthus Phyllosphere	MADDPDMHQELIEDFDDAAAAIVDSTPAQDVVNKVFD*
Ga0182177_12339742	3300015347	Miscanthus Phyllosphere	DLRTMESGFLMAGDPNMHKDLIEDFDDDTAAIVDITSAQEIINKVF*
Ga0182161_10768142	3300015351	Miscanthus Phyllosphere	MESGFPMADDPDMHEELIEDFDDAATTIVDITSTQDVINKVFD*
Ga0182161_11636961	3300015351	Miscanthus Phyllosphere	DDLEMHKELIKDFDDAAAAIVDITSAQDVINKVFD*
Ga0182161_12415611	3300015351	Miscanthus Phyllosphere	MELGFPMVDDPDMHKELIEDFDGVAAAIVNMTPAQDVVNKVFD*
Ga0182159_10824182	3300015355	Miscanthus Phyllosphere	MEPGIPMADDPDMHKELIEDFDNDVAAIVDITLAQDVVNKVFD*
Ga0182159_11687151	3300015355	Miscanthus Phyllosphere	MEPGFPMADDPDMHEELIEDFDDAAMAIVDITSAQDVINKVFD*
Ga0182159_12097312	3300015355	Miscanthus Phyllosphere	MEPGFLMANDPNMHEELIEDFDDATEAIVDITPAQNVVNKVFI*
Ga0182159_12253402	3300015355	Miscanthus Phyllosphere	MELGFSMVDDPDMHEELIKDFDDVAMTNMDITSTQYVINKVFD*
Ga0182159_12880662	3300015355	Miscanthus Phyllosphere	MADHPDMHKELIEDFDDAAATIVDITPAQDVVNKVFD*
Ga0182159_13347222	3300015355	Miscanthus Phyllosphere	MEPGFPMVDYPNTHEEVIEDFNNTATAIVDITLAKDVVNKVFD*
Ga0182145_10318282	3300015361	Miscanthus Phyllosphere	MEPGFSMANDPNMHADLIEDFEDAAAAIMGIASAQDVVNRVFD*
Ga0182145_10424801	3300015361	Miscanthus Phyllosphere	MELGSQMADDPDIHKELIKDFDDATMVIIDITLAQDVVNKVFD*
Ga0182145_10488061	3300015361	Miscanthus Phyllosphere	MEPGFPMADDLDMHEDLIEDFDDAAAAIVGITSTHDVINKVFD*
Ga0182145_11078191	3300015361	Miscanthus Phyllosphere	MEPGFPMTDDPDMHEDMIEDFDAASAAIMDITSAQDIINKVFE*
Ga0182145_11657261	3300015361	Miscanthus Phyllosphere	MEPGFPMDDDLDMHEDLIKDFDDTATAIVDITSAQDVINKVFD*
Ga0182203_11637141	3300017404	Miscanthus Phyllosphere	MESGFSMADDLDMHEDLIEDFNDTATAIMDITSAQDVTNKVFE
Ga0182220_10125012	3300017407	Miscanthus Phyllosphere	MEPGLPMTDDPDMHKELIEDFDDDVAATVDITPAQDVVNKVFN
Ga0182220_10492721	3300017407	Miscanthus Phyllosphere	MEPGFLMADDPNMHEELIEDFDDAVAAIVDITPAQDVVNKVFD
Ga0182220_10952731	3300017407	Miscanthus Phyllosphere	MESGFLMADDPNMHEDLIKDFEDAAAAIVDITSARDVINRVFD
Ga0182204_10356211	3300017409	Miscanthus Phyllosphere	MEPGFSMADDPNMHGELIEDFDDAAPAIVDITSTQDVINKVFD
Ga0182204_10398201	3300017409	Miscanthus Phyllosphere	VHIGHDLHTMEPGFPMADDPNMHKEPIEDFDDATAAIVDITPAQDVVNKVFD
Ga0182204_11073143	3300017409	Miscanthus Phyllosphere	MADDLDMHEELIEDFDDAVAAIVDITPAQDVVNKVFD
Ga0182207_10218953	3300017410	Miscanthus Phyllosphere	MEPGFMMANDPDMHEELIEDFDDAAAAIMDITSAQDVINKVLD
Ga0182207_11276231	3300017410	Miscanthus Phyllosphere	MELGFPMVDDPDMHEELIEDFDDAVAAIVDITPAQDVVNKVFN
Ga0182208_10338122	3300017411	Miscanthus Phyllosphere	MADDPDMYEELIEDFDDGATTSVDITPAQDVVNKVFD
Ga0182208_11085351	3300017411	Miscanthus Phyllosphere	MELGFPMADDPDMHKDLIEDFDDDVAAIVDITPAQDIVNKVFD
Ga0182222_10257542	3300017413	Miscanthus Phyllosphere	MEPGFPMTDDLDMHKELIEDFDDTTAAIVDITPAQDVVNKVFD
Ga0182222_10751551	3300017413	Miscanthus Phyllosphere	MEPGFPMADDPNMHKELIEDFDDAVAAIMDITPAQDVVNKVFD
Ga0182202_11044561	3300017415	Miscanthus Phyllosphere	LGFSMADDPDMHEDLIKDCDDDAAAIMDITLAQEVINKDF
Ga0182228_10468031	3300017420	Miscanthus Phyllosphere	LHTMEPGFLMADDPDKHKELIEDFDDAVAAVVDITPAQDVVNKVFD
Ga0182219_10710732	3300017424	Miscanthus Phyllosphere	MVDDPNMHEELIEDFDDAMVAIVDITPAQDVVNKVFD
Ga0182224_10526423	3300017425	Miscanthus Phyllosphere	MADDPNMHEDLIEDFGNAAVAIVDITSAQDVINKVFE
Ga0182224_10923091	3300017425	Miscanthus Phyllosphere	MELGFPMADDPDMHEELIEDFDDATVAIVDITPAQDVVNKVLD
Ga0182224_11162053	3300017425	Miscanthus Phyllosphere	MDLGFPMADDPDMHKELIEDFNDAAAAVVDITLAQDVVNKLFD
Ga0182190_10931441	3300017427	Miscanthus Phyllosphere	MADDPDMHKELIEDFDNAAAAIVDITSAQDVINKVFD
Ga0182192_10458412	3300017430	Miscanthus Phyllosphere	MEPGFPMADDPNMHEDLIEDFDDDATAIVDITSAQDVINKVFE
Ga0182192_11216581	3300017430	Miscanthus Phyllosphere	MEPGFPMADNPNMHKELIEDFDDAVAAIVDITPAQDVVNKVFD
Ga0182206_10648611	3300017433	Miscanthus Phyllosphere	MADDPDMHEELIEDFNDTTATIVDITPAQDVVNEVFD
Ga0182206_11024782	3300017433	Miscanthus Phyllosphere	MEPGFPMADDPDMHEELIEDFDDAAMAIVDITSAQDVINKVFD
Ga0182206_11221541	3300017433	Miscanthus Phyllosphere	LMADDLDMHMELIEDFNDATVAIVDITPAQDVVNKVFD
Ga0182209_10153792	3300017436	Miscanthus Phyllosphere	MADDPSMHEDLIEDFEDTVAAIMDIASAQDVVNRVFD
Ga0182209_10660861	3300017436	Miscanthus Phyllosphere	MVNAMELGFPMVDDPNMHEELIEDFNDDAAAIVDITPAQNVVNKVFD
Ga0182209_10660862	3300017436	Miscanthus Phyllosphere	MADDPYMHKELIEDFNDATVAIIDITPAQDVVNNVFD
Ga0182209_11255801	3300017436	Miscanthus Phyllosphere	MEPGFPMSNDPDMHEELIEDFDDAAAAIVDITPAQDVVNKVFD
Ga0182209_11317712	3300017436	Miscanthus Phyllosphere	MEPGFPMADDPTMHEELIEDFDDAATTIVDITSTQDVINKVFN
Ga0182209_11406461	3300017436	Miscanthus Phyllosphere	MGLGFPMTDDPDMHEELIEDFDDAAATIVDITSTEDVINKVFD
Ga0182209_11718401	3300017436	Miscanthus Phyllosphere	MEPGFPMADDPDLHEELIKDFDDAAAAIVDITSAQDVINKVFD
Ga0182191_10782331	3300017438	Miscanthus Phyllosphere	MEPGFPMADDPDMHKELIEDFDDAAAAIVDITPAQDVVNKVFN
Ga0182191_11139902	3300017438	Miscanthus Phyllosphere	MEPGFSMADDPDMHGDLIEDFSDATAAIVDITSAHDVINKVFE
Ga0182191_11263641	3300017438	Miscanthus Phyllosphere	MADDPDMHKELIEDFDDNAVAIVDITLAQDVVNKVFD
Ga0182221_10238603	3300017442	Miscanthus Phyllosphere	MEPGFPMADDPDMHKELIEDFDDVVAAIVDITPAQDVVNKVFD
Ga0182221_10523252	3300017442	Miscanthus Phyllosphere	MEPGFPMADDPNMHKDMIKDFDDAVVAIVDITSTQNVINKVLD
Ga0182221_11466332	3300017442	Miscanthus Phyllosphere	MDLGFRMVDDPNMHKELIEDFDDATTAIVDITLAQHVVNKVFN
Ga0182193_11256771	3300017443	Miscanthus Phyllosphere	MADFLDMHEELIEDFDDDAVAIVDITPTQDVVNKVF
Ga0182229_10796461	3300017682	Miscanthus Phyllosphere	MELGFPMADDPDMHEELIEDFDDAAVAIVDITSTQDVINKVFD
Ga0182218_11164761	3300017683	Miscanthus Phyllosphere	RTMEPGFWMADEIDMNEDLIEDFDDAAVAIMDNTFTQDVINKVFD
Ga0182225_10972021	3300017684	Miscanthus Phyllosphere	MADDPDMHKELIEYFDDDAAAIVDITPAQDVMNKVFD
Ga0182225_11150771	3300017684	Miscanthus Phyllosphere	MDPGFPMADDLDMHKELIEDFDDDAATIVDITPAQDVLNKVFD
Ga0182227_10618931	3300017685	Miscanthus Phyllosphere	MKPGFPMADDPNMHKELIEDFDDTTTTIVDITPAQDVVNKAFD
Ga0182227_10831772	3300017685	Miscanthus Phyllosphere	MELGFPMADDPDMHEELIEDFNDAATAIVDITPAQDVMNRVFD
Ga0182227_11149371	3300017685	Miscanthus Phyllosphere	MKLGFPMADDPDMHEELIEDFDDTTAAIVDITPAKDIVNKVFD
Ga0182227_11168901	3300017685	Miscanthus Phyllosphere	MESGFPMADDPNMHKELIEDFDDAMVAIVDITPAQDVVNKLFD
Ga0182227_11336831	3300017685	Miscanthus Phyllosphere	GFPMADDPNMLEHLIEDFDDDAAAIMDITSTQDVINKVFE
Ga0182205_11626781	3300017686	Miscanthus Phyllosphere	MEPGFPMADDPDMQEDLIEDFNDAAAAIVDITSAQDVFNKVFD
Ga0182223_10439791	3300017690	Miscanthus Phyllosphere	MELGFPMADDPNKHKELIEDFDDAVASIVDITPAQDVVNKVFD
Ga0182223_10472182	3300017690	Miscanthus Phyllosphere	MEPGIPMADDPDMHKELIEDFNDATVAIVDITLAQVVVNKVFD
Ga0182223_10781352	3300017690	Miscanthus Phyllosphere	MELSFLMADDLDMHKELIEDFDDDVAAIADITPAQDIVNKVFG
Ga0207648_122768491	3300026089	Miscanthus Rhizosphere	MEPGFPMADDPDTHKELIEDFDDDAATIVDITPAQDVVNKVFD

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.36
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.36
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F036064

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign