| Basic Information | |
|---|---|
| Family ID | F036056 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 170 |
| Average Sequence Length | 55 residues |
| Representative Sequence | VRVLLFLERLFSSASMEYSKQLMGIASEDEIFMESQLLNYKPAIKFSAIFIEHINY |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 170 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 4.12 % |
| % of genes near scaffold ends (potentially truncated) | 15.29 % |
| % of genes from short scaffolds (< 2000 bps) | 100.00 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (78.824 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (66.471 % of family members) |
| Environment Ontology (ENVO) | Unclassified (86.471 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (81.176 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 63.10% β-sheet: 0.00% Coil/Unstructured: 36.90% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 78.82 % |
| All Organisms | root | All Organisms | 21.18 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005353|Ga0070669_101968142 | Not Available | 511 | Open in IMG/M |
| 3300005719|Ga0068861_100781311 | Not Available | 894 | Open in IMG/M |
| 3300005841|Ga0068863_101363665 | Not Available | 716 | Open in IMG/M |
| 3300005842|Ga0068858_101115464 | Not Available | 775 | Open in IMG/M |
| 3300005843|Ga0068860_100931349 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 885 | Open in IMG/M |
| 3300005843|Ga0068860_101039651 | Not Available | 837 | Open in IMG/M |
| 3300005844|Ga0068862_101097949 | Not Available | 790 | Open in IMG/M |
| 3300009553|Ga0105249_11956164 | Not Available | 659 | Open in IMG/M |
| 3300009972|Ga0105137_106598 | Not Available | 592 | Open in IMG/M |
| 3300009975|Ga0105129_110899 | Not Available | 620 | Open in IMG/M |
| 3300009976|Ga0105128_115931 | Not Available | 562 | Open in IMG/M |
| 3300009980|Ga0105135_111900 | Not Available | 682 | Open in IMG/M |
| 3300009981|Ga0105133_104581 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 867 | Open in IMG/M |
| 3300009981|Ga0105133_106635 | Not Available | 789 | Open in IMG/M |
| 3300009981|Ga0105133_111723 | Not Available | 679 | Open in IMG/M |
| 3300009989|Ga0105131_124918 | Not Available | 613 | Open in IMG/M |
| 3300009990|Ga0105132_137355 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 539 | Open in IMG/M |
| 3300009994|Ga0105126_1033016 | Not Available | 615 | Open in IMG/M |
| 3300009995|Ga0105139_1077224 | Not Available | 624 | Open in IMG/M |
| 3300009995|Ga0105139_1107184 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 539 | Open in IMG/M |
| 3300010371|Ga0134125_13110629 | Not Available | 503 | Open in IMG/M |
| 3300010373|Ga0134128_11254332 | Not Available | 817 | Open in IMG/M |
| 3300010373|Ga0134128_12960655 | Not Available | 523 | Open in IMG/M |
| 3300010396|Ga0134126_11166597 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 857 | Open in IMG/M |
| 3300010397|Ga0134124_10760883 | Not Available | 964 | Open in IMG/M |
| 3300010399|Ga0134127_11532391 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 740 | Open in IMG/M |
| 3300010400|Ga0134122_13305762 | Not Available | 507 | Open in IMG/M |
| 3300013306|Ga0163162_10416475 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 1476 | Open in IMG/M |
| 3300014968|Ga0157379_11313954 | Not Available | 699 | Open in IMG/M |
| 3300015270|Ga0182183_1050156 | Not Available | 618 | Open in IMG/M |
| 3300015278|Ga0182099_1004056 | Not Available | 1076 | Open in IMG/M |
| 3300015280|Ga0182100_1010091 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1028 | Open in IMG/M |
| 3300015284|Ga0182101_1074303 | Not Available | 559 | Open in IMG/M |
| 3300015297|Ga0182104_1096130 | Not Available | 547 | Open in IMG/M |
| 3300015306|Ga0182180_1049188 | Not Available | 636 | Open in IMG/M |
| 3300015309|Ga0182098_1033359 | Not Available | 793 | Open in IMG/M |
| 3300015309|Ga0182098_1128909 | Not Available | 501 | Open in IMG/M |
| 3300015310|Ga0182162_1061943 | Not Available | 661 | Open in IMG/M |
| 3300015310|Ga0182162_1096054 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 564 | Open in IMG/M |
| 3300015311|Ga0182182_1013657 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1032 | Open in IMG/M |
| 3300015311|Ga0182182_1036999 | Not Available | 761 | Open in IMG/M |
| 3300015311|Ga0182182_1082859 | Not Available | 580 | Open in IMG/M |
| 3300015312|Ga0182168_1053057 | Not Available | 719 | Open in IMG/M |
| 3300015312|Ga0182168_1103135 | Not Available | 563 | Open in IMG/M |
| 3300015313|Ga0182164_1104194 | Not Available | 561 | Open in IMG/M |
| 3300015315|Ga0182120_1059593 | Not Available | 695 | Open in IMG/M |
| 3300015315|Ga0182120_1091855 | Not Available | 592 | Open in IMG/M |
| 3300015315|Ga0182120_1093688 | Not Available | 588 | Open in IMG/M |
| 3300015317|Ga0182136_1042036 | Not Available | 784 | Open in IMG/M |
| 3300015317|Ga0182136_1045117 | Not Available | 766 | Open in IMG/M |
| 3300015317|Ga0182136_1067096 | Not Available | 667 | Open in IMG/M |
| 3300015317|Ga0182136_1091256 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 596 | Open in IMG/M |
| 3300015317|Ga0182136_1104556 | Not Available | 566 | Open in IMG/M |
| 3300015317|Ga0182136_1107213 | Not Available | 561 | Open in IMG/M |
| 3300015317|Ga0182136_1113144 | Not Available | 549 | Open in IMG/M |
| 3300015318|Ga0182181_1021956 | Not Available | 878 | Open in IMG/M |
| 3300015318|Ga0182181_1105267 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 520 | Open in IMG/M |
| 3300015319|Ga0182130_1027329 | Not Available | 874 | Open in IMG/M |
| 3300015319|Ga0182130_1035366 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 808 | Open in IMG/M |
| 3300015319|Ga0182130_1049966 | Not Available | 722 | Open in IMG/M |
| 3300015320|Ga0182165_1090594 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 610 | Open in IMG/M |
| 3300015320|Ga0182165_1146290 | Not Available | 503 | Open in IMG/M |
| 3300015324|Ga0182134_1109641 | Not Available | 567 | Open in IMG/M |
| 3300015324|Ga0182134_1115636 | Not Available | 555 | Open in IMG/M |
| 3300015325|Ga0182148_1041626 | Not Available | 790 | Open in IMG/M |
| 3300015325|Ga0182148_1042598 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 785 | Open in IMG/M |
| 3300015325|Ga0182148_1111684 | Not Available | 559 | Open in IMG/M |
| 3300015327|Ga0182114_1030800 | Not Available | 939 | Open in IMG/M |
| 3300015327|Ga0182114_1081079 | Not Available | 667 | Open in IMG/M |
| 3300015327|Ga0182114_1130922 | Not Available | 550 | Open in IMG/M |
| 3300015328|Ga0182153_1093974 | Not Available | 609 | Open in IMG/M |
| 3300015329|Ga0182135_1086493 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 633 | Open in IMG/M |
| 3300015329|Ga0182135_1132555 | Not Available | 536 | Open in IMG/M |
| 3300015329|Ga0182135_1153455 | Not Available | 504 | Open in IMG/M |
| 3300015330|Ga0182152_1084930 | Not Available | 639 | Open in IMG/M |
| 3300015330|Ga0182152_1130913 | Not Available | 538 | Open in IMG/M |
| 3300015330|Ga0182152_1155077 | Not Available | 502 | Open in IMG/M |
| 3300015331|Ga0182131_1058163 | Not Available | 736 | Open in IMG/M |
| 3300015331|Ga0182131_1157920 | Not Available | 500 | Open in IMG/M |
| 3300015333|Ga0182147_1089336 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 654 | Open in IMG/M |
| 3300015333|Ga0182147_1124973 | Not Available | 572 | Open in IMG/M |
| 3300015334|Ga0182132_1166126 | Not Available | 506 | Open in IMG/M |
| 3300015335|Ga0182116_1048478 | Not Available | 855 | Open in IMG/M |
| 3300015335|Ga0182116_1069296 | Not Available | 749 | Open in IMG/M |
| 3300015336|Ga0182150_1090303 | Not Available | 642 | Open in IMG/M |
| 3300015336|Ga0182150_1146380 | Not Available | 530 | Open in IMG/M |
| 3300015337|Ga0182151_1103541 | Not Available | 610 | Open in IMG/M |
| 3300015337|Ga0182151_1129964 | Not Available | 557 | Open in IMG/M |
| 3300015338|Ga0182137_1107859 | Not Available | 627 | Open in IMG/M |
| 3300015338|Ga0182137_1173538 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 509 | Open in IMG/M |
| 3300015339|Ga0182149_1037483 | Not Available | 909 | Open in IMG/M |
| 3300015339|Ga0182149_1078316 | Not Available | 697 | Open in IMG/M |
| 3300015340|Ga0182133_1098502 | Not Available | 669 | Open in IMG/M |
| 3300015340|Ga0182133_1127088 | Not Available | 602 | Open in IMG/M |
| 3300015340|Ga0182133_1152107 | Not Available | 557 | Open in IMG/M |
| 3300015348|Ga0182115_1170098 | Not Available | 698 | Open in IMG/M |
| 3300015348|Ga0182115_1176502 | Not Available | 685 | Open in IMG/M |
| 3300015348|Ga0182115_1226322 | Not Available | 597 | Open in IMG/M |
| 3300015348|Ga0182115_1256563 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 556 | Open in IMG/M |
| 3300015349|Ga0182185_1133794 | Not Available | 731 | Open in IMG/M |
| 3300015350|Ga0182163_1168208 | Not Available | 684 | Open in IMG/M |
| 3300015350|Ga0182163_1209900 | Not Available | 610 | Open in IMG/M |
| 3300015350|Ga0182163_1209909 | Not Available | 610 | Open in IMG/M |
| 3300015352|Ga0182169_1081490 | Not Available | 1019 | Open in IMG/M |
| 3300015352|Ga0182169_1137546 | Not Available | 794 | Open in IMG/M |
| 3300015353|Ga0182179_1142876 | Not Available | 742 | Open in IMG/M |
| 3300015353|Ga0182179_1245293 | Not Available | 577 | Open in IMG/M |
| 3300015354|Ga0182167_1207231 | Not Available | 716 | Open in IMG/M |
| 3300017408|Ga0182197_1065681 | Not Available | 692 | Open in IMG/M |
| 3300017408|Ga0182197_1066370 | Not Available | 689 | Open in IMG/M |
| 3300017408|Ga0182197_1093433 | Not Available | 605 | Open in IMG/M |
| 3300017408|Ga0182197_1107293 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 575 | Open in IMG/M |
| 3300017412|Ga0182199_1201344 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 506 | Open in IMG/M |
| 3300017414|Ga0182195_1172917 | Not Available | 557 | Open in IMG/M |
| 3300017414|Ga0182195_1215065 | Not Available | 509 | Open in IMG/M |
| 3300017421|Ga0182213_1150184 | Not Available | 656 | Open in IMG/M |
| 3300017421|Ga0182213_1211699 | Not Available | 553 | Open in IMG/M |
| 3300017422|Ga0182201_1109220 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 555 | Open in IMG/M |
| 3300017432|Ga0182196_1035658 | Not Available | 831 | Open in IMG/M |
| 3300017435|Ga0182194_1068588 | Not Available | 680 | Open in IMG/M |
| 3300017439|Ga0182200_1024696 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 951 | Open in IMG/M |
| 3300017440|Ga0182214_1071129 | Not Available | 717 | Open in IMG/M |
| 3300017440|Ga0182214_1091777 | Not Available | 641 | Open in IMG/M |
| 3300017445|Ga0182198_1087492 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 695 | Open in IMG/M |
| 3300017445|Ga0182198_1197286 | Not Available | 508 | Open in IMG/M |
| 3300017446|Ga0182217_1086242 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 735 | Open in IMG/M |
| 3300017447|Ga0182215_1051350 | Not Available | 878 | Open in IMG/M |
| 3300017447|Ga0182215_1123355 | Not Available | 587 | Open in IMG/M |
| 3300017447|Ga0182215_1160591 | Not Available | 521 | Open in IMG/M |
| 3300017691|Ga0182212_1107790 | Not Available | 627 | Open in IMG/M |
| 3300017694|Ga0182211_1105488 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 661 | Open in IMG/M |
| 3300017792|Ga0163161_10653157 | Not Available | 872 | Open in IMG/M |
| 3300020033|Ga0182146_102948 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 645 | Open in IMG/M |
| 3300020223|Ga0182118_115066 | Not Available | 508 | Open in IMG/M |
| 3300025903|Ga0207680_10844623 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 656 | Open in IMG/M |
| 3300025961|Ga0207712_10800900 | Not Available | 828 | Open in IMG/M |
| 3300026088|Ga0207641_12524577 | Not Available | 512 | Open in IMG/M |
| 3300026095|Ga0207676_11854949 | Not Available | 602 | Open in IMG/M |
| 3300028049|Ga0268322_1043660 | Not Available | 552 | Open in IMG/M |
| 3300028050|Ga0268328_1018043 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 808 | Open in IMG/M |
| 3300028050|Ga0268328_1031276 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 677 | Open in IMG/M |
| 3300028054|Ga0268306_1019357 | Not Available | 612 | Open in IMG/M |
| 3300028056|Ga0268330_1006705 | Not Available | 1048 | Open in IMG/M |
| 3300028058|Ga0268332_1028741 | Not Available | 722 | Open in IMG/M |
| 3300028058|Ga0268332_1041995 | Not Available | 636 | Open in IMG/M |
| 3300028063|Ga0268350_1036207 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 716 | Open in IMG/M |
| 3300028064|Ga0268340_1044068 | Not Available | 644 | Open in IMG/M |
| 3300028140|Ga0268334_1008021 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 669 | Open in IMG/M |
| 3300028151|Ga0268308_1001400 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1374 | Open in IMG/M |
| 3300028151|Ga0268308_1029815 | Not Available | 525 | Open in IMG/M |
| 3300028153|Ga0268320_1021733 | Not Available | 558 | Open in IMG/M |
| 3300028154|Ga0268341_1021976 | Not Available | 567 | Open in IMG/M |
| 3300028155|Ga0268349_1031921 | Not Available | 698 | Open in IMG/M |
| 3300028248|Ga0268312_1003503 | Not Available | 1017 | Open in IMG/M |
| 3300028248|Ga0268312_1033813 | Not Available | 524 | Open in IMG/M |
| 3300028380|Ga0268265_12517436 | Not Available | 521 | Open in IMG/M |
| 3300028464|Ga0268302_101796 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 861 | Open in IMG/M |
| 3300028466|Ga0268321_102760 | Not Available | 754 | Open in IMG/M |
| 3300028467|Ga0268333_1002230 | Not Available | 854 | Open in IMG/M |
| 3300028470|Ga0268307_1003442 | Not Available | 894 | Open in IMG/M |
| 3300028470|Ga0268307_1011833 | Not Available | 634 | Open in IMG/M |
| 3300032467|Ga0214488_1071551 | Not Available | 767 | Open in IMG/M |
| 3300032551|Ga0321339_1129117 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 564 | Open in IMG/M |
| 3300032593|Ga0321338_1111340 | Not Available | 965 | Open in IMG/M |
| 3300032625|Ga0214501_1250869 | Not Available | 560 | Open in IMG/M |
| 3300032689|Ga0214497_1097415 | Not Available | 640 | Open in IMG/M |
| 3300032697|Ga0214499_1248846 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 548 | Open in IMG/M |
| 3300032823|Ga0314723_1098778 | Not Available | 543 | Open in IMG/M |
| 3300032913|Ga0314739_1060493 | Not Available | 709 | Open in IMG/M |
| 3300033525|Ga0314758_1204294 | Not Available | 534 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 66.47% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 12.94% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 7.06% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.29% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.12% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.18% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.18% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.18% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.59% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009972 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG | Host-Associated | Open in IMG/M |
| 3300009975 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG | Host-Associated | Open in IMG/M |
| 3300009976 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG | Host-Associated | Open in IMG/M |
| 3300009980 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG | Host-Associated | Open in IMG/M |
| 3300009981 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG | Host-Associated | Open in IMG/M |
| 3300009989 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG | Host-Associated | Open in IMG/M |
| 3300009990 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG | Host-Associated | Open in IMG/M |
| 3300009994 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG | Host-Associated | Open in IMG/M |
| 3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015278 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015318 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017421 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017435 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017446 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017447 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017691 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017694 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300020033 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12JUL2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300020223 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028050 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028054 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028063 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028064 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028140 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028151 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028153 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028154 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028155 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028248 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028464 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028466 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028467 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028470 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300032467 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032551 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032593 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032625 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032689 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032697 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032823 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032913 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033525 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070669_1019681421 | 3300005353 | Switchgrass Rhizosphere | VGVLLFLEKLFSSASMEYLKQLMGIASEDEIFMESQLLNYKLAIKFSAIFTEHINY* |
| Ga0068861_1007813112 | 3300005719 | Switchgrass Rhizosphere | VRVLLFLERLFSSASMEYSKQMIGIVSEDGIFMESQLLKYKPAIKFSAIFIEHINY* |
| Ga0068863_1013636651 | 3300005841 | Switchgrass Rhizosphere | VRVLLFLERLFSSASMEYSKQLMDIVFEDRIFMESQLLKYKPAIKFSAIFIEHINY* |
| Ga0068858_1011154641 | 3300005842 | Switchgrass Rhizosphere | VRVLLFLERLFSSASMEYSKQLMGKVYEDEIFMGSQLLKYKPSIKFSAILLSILIIKNTLNSYY* |
| Ga0068860_1009313492 | 3300005843 | Switchgrass Rhizosphere | VRVLLFLERLFSSASMEYSKQLMGIVSEDGIFMESQLLKYKPAIKFSAIFIEHINY* |
| Ga0068860_1010396511 | 3300005843 | Switchgrass Rhizosphere | VRVLLFLERLLSSASMEYLNQLMGIASEDEIFMESQLLNYKLAIKFSAIFTEHAN* |
| Ga0068862_1010979491 | 3300005844 | Switchgrass Rhizosphere | VGVLLFLEKLFSSASMEYLKQLMGIASEDEIFMESQLLNYKLAIKFSAIFTEHTNY* |
| Ga0105249_119561641 | 3300009553 | Switchgrass Rhizosphere | VRVLLFLERLVSSASMEYSKQLMGIVSEDEIFMESQLLKYKPGIKFLAIFIEHINY* |
| Ga0105137_1065981 | 3300009972 | Switchgrass Associated | VRVLLFLERLFSSASMEYSKQMIGIVSEGGIFMESQLLKYKASIKFSAIFIEDINY* |
| Ga0105129_1108992 | 3300009975 | Switchgrass Associated | LLFLERLLSSASMENSKQLVGIASEDEIFMESPLLNYKPAIKFSAIFTEHINY* |
| Ga0105128_1159311 | 3300009976 | Switchgrass Associated | VRVLLFLERLFSSASMENSKQLMGIASEDEIFMESQLLNYKLAIKFSAIFTEHKNY* |
| Ga0105135_1119001 | 3300009980 | Switchgrass Associated | VRVLLFLERLFSSASMEYSKQLMGIASEDEIFMESQLLNYKPAIKFSAIFIEHINY* |
| Ga0105133_1045812 | 3300009981 | Switchgrass Associated | VGVLLFLEKLFSSASMEYLKQLMGIASEDEIFMDSQLLNYKLTIKFSAIFTKHANY* |
| Ga0105133_1066351 | 3300009981 | Switchgrass Associated | VRVLLFLEMSFSSASMEYSKQLMGIVYEDEIFMEIQLLKYKPVIKFSAILIEDVNY* |
| Ga0105133_1117231 | 3300009981 | Switchgrass Associated | VRVLLFLERLFSSARMKYSKQLMGIVSEDGIFMEIQLLKYKPAIKFSAIFIEHINY* |
| Ga0105131_1249181 | 3300009989 | Switchgrass Associated | VRVLLFLERLFSSASMEYSKQLMGIVSEDGIFMESQLLKYKPTIKFSAIFIEHIN* |
| Ga0105132_1373551 | 3300009990 | Switchgrass Associated | VRVLLFLERLFSSASMKYSEQLMGKVSEDEIFMGSQLLKYKPAIKFSAIFVEHINY* |
| Ga0105126_10330161 | 3300009994 | Switchgrass Associated | VRVLLFLEKLFSSASMENSKQLVGIASEDEIFIESQLFKYKPAIKFSAIFTEHINY* |
| Ga0105139_10772241 | 3300009995 | Switchgrass Associated | VRVLLFLERLFSSASMEYSKQLMGIVYEDGIFMESQLLKYKPAIKFSAIFIEQINY* |
| Ga0105139_11071841 | 3300009995 | Switchgrass Associated | VGVLLFLEKLFSSASMEYLNPLMGIASEDEIFMESQLLNYKLTIKFSAIFTEHTKY* |
| Ga0134125_131106291 | 3300010371 | Terrestrial Soil | LFLEKLFSSARMEYLNPLNDIASEDEMFMESQLLNYKLAIKFSAIFTEHANY* |
| Ga0134128_112543321 | 3300010373 | Terrestrial Soil | VRVLLFLERLFSSASMEYSKQLMGKVSEDEIFMGSQLLKYKPVIKFLAIFVEHINY* |
| Ga0134128_129606551 | 3300010373 | Terrestrial Soil | VLLFLEKLFSSASMEYSKQMIHIVSEDGTFMESQLLKYKPAIKFSAIFIERINY* |
| Ga0134126_111665971 | 3300010396 | Terrestrial Soil | VRVLLFLEKIFSSASMEYSKQLMGIASEDEIFMESQLLKYKPAIKFSDIFIEHINY* |
| Ga0134124_107608831 | 3300010397 | Terrestrial Soil | VRVLLFLERLFSSASMEYSKQLMGIASEDELFMESQVLKYKPAIKFSAIFI* |
| Ga0134127_115323912 | 3300010399 | Terrestrial Soil | VGVLLFLEKLFSSASMEYLKQLMGIASEDEIFMESQLLNYKLAIKFSAIFTEHANY* |
| Ga0134122_133057621 | 3300010400 | Terrestrial Soil | VRVLLFLERLFSSARMEYSKQLMGIASEDEIFMKSQLLKYKPDIKFS |
| Ga0163162_104164752 | 3300013306 | Switchgrass Rhizosphere | VRVLLFLERLFSSASMEYSKQLMGIVSEDGIFMEIQLLKYKPAIKFSAIFIEHINY* |
| Ga0157379_113139541 | 3300014968 | Switchgrass Rhizosphere | LFSSASMEYLKQLMGITSEDENFMESQLLNYKLAIKFSAIFTEHINY* |
| Ga0182183_10501561 | 3300015270 | Switchgrass Phyllosphere | VGGVCFFLKLFSSASMDYLNPLKGIASEDEIFMESQKFNYKLVINVSAIFTEHANY* |
| Ga0182099_10040561 | 3300015278 | Switchgrass Phyllosphere | VRVLLFLERLVSSARMKYSKQLMGIVSEDEIFMESQLLKYKPAIKFSAIFIEHINY* |
| Ga0182100_10100912 | 3300015280 | Switchgrass Phyllosphere | VGVLLFLEKLFSSASMEYLKQLMGIASEDEIFMESQLLNYKLAIKFSAIFTEHVNY* |
| Ga0182101_10743031 | 3300015284 | Switchgrass Phyllosphere | VRVLLFLEKLFSSASMENSKQLVGIASEDEIFIESQLLNYKPSIKFSAIFIEPIN* |
| Ga0182104_10961302 | 3300015297 | Switchgrass Phyllosphere | EKLFSSASMEYLKRLVGIAPEDEIFMESQLLNYKLAIKFSAIFTEHINY* |
| Ga0182180_10491881 | 3300015306 | Switchgrass Phyllosphere | VRVLLFLERLFSSASMEYSKQKIAIVSEDGIFMESQLLKYKPTIKFSAIFIEHIN* |
| Ga0182098_10333591 | 3300015309 | Switchgrass Phyllosphere | VRVLLFLEKLFSSASMEYLKQLMGIASEDEIFMESQLHNYKLSIKFSSIFTEHANY* |
| Ga0182098_11289092 | 3300015309 | Switchgrass Phyllosphere | VGVLLFLERLFSSASIEYLKQLMGIAYEDEIFVESQLLNYKLAIKFSAIFTEHANY* |
| Ga0182162_10619431 | 3300015310 | Switchgrass Phyllosphere | VRVLLFLERLFSSASMKYSKQMIGIVSEDGTFMESQLLKYKPDIKFSAIFIEHINY* |
| Ga0182162_10960541 | 3300015310 | Switchgrass Phyllosphere | MVLLFLERLLSSASIENSKQLVGIASKDEIFMESQLLNYKLALQFSAIFTEQINY* |
| Ga0182182_10136572 | 3300015311 | Switchgrass Phyllosphere | VGVLLFLEKLFSSASMEYLNQLMGIASEDEIFMESQLLNYKLAIKFSDIFTEHANY* |
| Ga0182182_10369991 | 3300015311 | Switchgrass Phyllosphere | VRVLLFLERLFSSASMEYSKQLMGKGSEDEIFMGSQLLKYKPSIKFSTVFIEHIN* |
| Ga0182182_10828591 | 3300015311 | Switchgrass Phyllosphere | VGVLLFLEKLFSSASMEYLKQLMGIASEDEIFMESQLLNYKLSIKFSAIFTKHVNY* |
| Ga0182168_10530571 | 3300015312 | Switchgrass Phyllosphere | VRVLLFLDRLLSSASMENFKQLVGIASEDEIFMESQLLKYKPAIKFSAIFIEHINY* |
| Ga0182168_11031351 | 3300015312 | Switchgrass Phyllosphere | GFVILERLFSSESMEYSKQLMVKVSEDKMFTGSQLLKYKPVIKFSAIFIEHINY* |
| Ga0182164_11041942 | 3300015313 | Switchgrass Phyllosphere | VRVLLFLERLVSSASMEYSKQLMGIVSEDEIFMESQLLKYKPAIKFSAIFIEHINY* |
| Ga0182120_10595931 | 3300015315 | Switchgrass Phyllosphere | RLFSSVSMEYSKQLMGIASEDAIFMESQLLKHKPAIKFSAIFIDHINY* |
| Ga0182120_10918552 | 3300015315 | Switchgrass Phyllosphere | VGFLLFLEKLFSSASMEYLNQLMGIASEDEIFMESQLLNYKLAIKFSAIFTEHINY* |
| Ga0182120_10936881 | 3300015315 | Switchgrass Phyllosphere | FLEKLLSSARMEYLKQLMGIYSEDEIFMESQLLIYKLAIKFSAIFAEHANY* |
| Ga0182136_10420361 | 3300015317 | Switchgrass Phyllosphere | VGVLLFLERLLSSASMEKFQQLVGIASDDEIFMESQLLNYKPAITFSAIFTEHINY* |
| Ga0182136_10451171 | 3300015317 | Switchgrass Phyllosphere | VRVLLFLERSFSSASMECSKQLIGIVSEDETFIESQLLKYKPVIKFSAIFNENINY* |
| Ga0182136_10670961 | 3300015317 | Switchgrass Phyllosphere | VGVLLFLEKLFSSASMEYLKQLMGIASEDEIFMESQLLNYKLAIKFSAIFTEHTN* |
| Ga0182136_10912561 | 3300015317 | Switchgrass Phyllosphere | VGVLLFLEKLFSSASMEYLKQLTGIASADEIFTESQKHNYKAAIKFSAIST* |
| Ga0182136_11045561 | 3300015317 | Switchgrass Phyllosphere | VGVLLFLERLLSSASMENSKQLVGIASEDEIFMESQLLNYKPAIKFSDIFTEHINY* |
| Ga0182136_11072131 | 3300015317 | Switchgrass Phyllosphere | VGVLLFLEKLFSSARMEYLNQLMGIASEDEFFMESQLLNYKLAIKFSAIFTEHVNY* |
| Ga0182136_11131441 | 3300015317 | Switchgrass Phyllosphere | VRVLLFLERLFSSASMENSKQLMGIASEDEIFMESQLLKYKPAIKFSAIFIEHINY* |
| Ga0182181_10219561 | 3300015318 | Switchgrass Phyllosphere | VGVLLFLEKLFSSASIEYLNQLMDKSSEDQIFMESQLLNYKLTIKFSAIFTEHANY* |
| Ga0182181_11052672 | 3300015318 | Switchgrass Phyllosphere | VRVLLFLERLLSSASMENSKQLMGIASEDEIFMESQLLKYKSAIKFSAIFIEHINY* |
| Ga0182130_10273291 | 3300015319 | Switchgrass Phyllosphere | MLFSSASMENSKQLMAIASEDEIFMESQLLKCKPAIKFSAIFIEHNNY* |
| Ga0182130_10353661 | 3300015319 | Switchgrass Phyllosphere | VRVLLFLERLFSSASMEYSKQLMGIVYEDGIFMESQLLKYKPVIKFSAIFIEQINY* |
| Ga0182130_10499661 | 3300015319 | Switchgrass Phyllosphere | VGVLLFLEKLFSSASMEYLKQLMGIASKYEIFMESQLLNNKLSIKVSAIFTEHTNY* |
| Ga0182165_10905941 | 3300015320 | Switchgrass Phyllosphere | VGVLLFLERLFSSASMEYLKQLMGIASEDEIFVESQLLKYKPAIKFSAIFSEHINY* |
| Ga0182165_11462901 | 3300015320 | Switchgrass Phyllosphere | VRVLLFLERLFSSVSMEYSKQLMSIASEDEIFMESQLLKYKPAIKFSAIFIEHINF* |
| Ga0182134_11096411 | 3300015324 | Switchgrass Phyllosphere | MVLLFLERLLSSASMENSKQLMGIASEDEIFMESQLLNYKLSIKFSAIFTEHVNY* |
| Ga0182134_11156361 | 3300015324 | Switchgrass Phyllosphere | VILERLFSSASMEYSQQLMVKVSEDEIFMGSQLLKYKPAINFSAIFVEHINY* |
| Ga0182148_10416261 | 3300015325 | Switchgrass Phyllosphere | VRVLLFLERLFSSASMEYSKQLMGIVSEDEIFMESQLLKYKPAIKFSAIFIEHINY* |
| Ga0182148_10425981 | 3300015325 | Switchgrass Phyllosphere | VRVLLFLEKLFSSASMEYSKQLVGIASEDEILMESQLLKYKPAIKFSAIFIKHINY* |
| Ga0182148_11116841 | 3300015325 | Switchgrass Phyllosphere | VGVLLFLERLFSNASMEYLNQLMGIASEDKIFIESQLLNYKLVIKFSAIFTERANY* |
| Ga0182114_10308001 | 3300015327 | Switchgrass Phyllosphere | VRVLLFLERLFSSARMEYSKQLMGIVSEDGIFMESQILKYKPSIKFSAIFIEYINY* |
| Ga0182114_10810791 | 3300015327 | Switchgrass Phyllosphere | VRVLLFLERLFSSVSKEYLKQLMGVASEDQIFMESQLPKYKPSIKFSDILSEHINY* |
| Ga0182114_11309221 | 3300015327 | Switchgrass Phyllosphere | LLFLERLLSSASMENSKQLMGIASEDEIFMESQLLNYKPAIKFSAIFTEHINY* |
| Ga0182153_10939741 | 3300015328 | Switchgrass Phyllosphere | VGVLLFLERLFSSASMEYLKQLMGIASEDEIFVESQLLNYKLAIKFSAIFTEHANY* |
| Ga0182135_10864931 | 3300015329 | Switchgrass Phyllosphere | VGVLLFLEKLFSSASMEYLKQLMGIAFEDEIFMESQLLNYKLVIKFSAIFTEHINY* |
| Ga0182135_11325551 | 3300015329 | Switchgrass Phyllosphere | VGVLLFLEKLFSSASMEYLKQLMGIASKDEIFMESQLLNYKHFIKFSAIFTEHANY* |
| Ga0182135_11534551 | 3300015329 | Switchgrass Phyllosphere | FLERLFSSASMEYSKQWMGIVSEDEIFMESQLLKYKPDIKFSAIFIEKINY* |
| Ga0182152_10849301 | 3300015330 | Switchgrass Phyllosphere | VRVLLFLERSFSSANMEYSKQLMGKVSEDEIFMESQLLKYKPAIKLSAIFIEHINY* |
| Ga0182152_11309131 | 3300015330 | Switchgrass Phyllosphere | VRVLLFLERLFSSASMEYSKQLMGIVSEDGIFMESQLLNYKSAIKFSAIFIEHINY* |
| Ga0182152_11550771 | 3300015330 | Switchgrass Phyllosphere | VGVLLFLEKLFSSASMEYLTQLMGIASQDEIFTESQLLNYKLAIKFSAIFTEHINY* |
| Ga0182131_10581631 | 3300015331 | Switchgrass Phyllosphere | VRVLLFLERLFSSARMEYSKQLMGIVSEDGIFMESQILKYKPSIKFSAIFI* |
| Ga0182131_11579201 | 3300015331 | Switchgrass Phyllosphere | RVLLFLERLLSSASMEYLNQLMGIASEDEFFMESQLLNYKLAIKFSAIFIEHINY* |
| Ga0182147_10893361 | 3300015333 | Switchgrass Phyllosphere | VGVLLFLERLFSSASMEYLKQLMGIASEDEIFMESQLLKYKPAIKFSAIFSEHINY* |
| Ga0182147_11249731 | 3300015333 | Switchgrass Phyllosphere | VRVLLFLERLFSSASMEYSKQLMGIVYEDGIFMESQLLKYKPAIKFSAIFIEYINY* |
| Ga0182132_11661261 | 3300015334 | Switchgrass Phyllosphere | VRVLLFLEKLFSSASMEYSKQLMGIVSKEEIFMESQLLKYKPAIKFSDIFTDHINY* |
| Ga0182116_10484781 | 3300015335 | Switchgrass Phyllosphere | VGVLLFLEKLFSSASMEYLKQLMGIASEDKIFIESQLLNFKLSIKFSAIFTEHANY* |
| Ga0182116_10692961 | 3300015335 | Switchgrass Phyllosphere | VRVLLFLERLFSSASMEHSKQLMGIVSEDEIFMESQLLKYKPSIKFLAIFIERINY* |
| Ga0182150_10903031 | 3300015336 | Switchgrass Phyllosphere | VRVLLFLERLFSSASMEYSKQLMGIASEDEIFMESQLLKYKPAIKFLAIFIDHINY* |
| Ga0182150_11463801 | 3300015336 | Switchgrass Phyllosphere | VRVLLFLERLFSSASMEYLKQMMGIASEDEIFMESQLLKYKPAIKFLAIFNEHINY* |
| Ga0182151_11035411 | 3300015337 | Switchgrass Phyllosphere | FSSASIEYLKQLMGIASEDEIFLESQLLNYKLSIKFSAIFTEHIIY* |
| Ga0182151_11299641 | 3300015337 | Switchgrass Phyllosphere | LEKLFSSASIEYLNQLMGKSYEDKIFMESQLLNYKLVIKFSAIFIEHINY* |
| Ga0182137_11078591 | 3300015338 | Switchgrass Phyllosphere | SSASMEYFKQLMGIASEDEIFTESQLFKYKPAIKFSVIFIEHINY* |
| Ga0182137_11735382 | 3300015338 | Switchgrass Phyllosphere | VGVLLFLEKLFSSASMEYLKQLMGIASEDEIFMESQLLNYKLSIKFSAIFTEHTNY* |
| Ga0182149_10374831 | 3300015339 | Switchgrass Phyllosphere | VGVLLFLEKLFSSASMEYLNQLMGKAYEDEIFMESQLINYKLAIKFSAIFTEHANY* |
| Ga0182149_10783161 | 3300015339 | Switchgrass Phyllosphere | VGGFVIFLKKLFSSASMEYLNQLMGIASEDEMFMESQLLNYKLTIKFSAIFTEHANY* |
| Ga0182133_10985022 | 3300015340 | Switchgrass Phyllosphere | VRVLLFLERLLSSASMEYLNQLMGIASEDEIFMESQLLNYKLSIKFSAIFTEHVNY* |
| Ga0182133_11270881 | 3300015340 | Switchgrass Phyllosphere | VRVLLFLERLFSSARMEYSKQLMGIVSEDGIFMESQLQNYKPAIKFSAIFIEHINY* |
| Ga0182133_11521071 | 3300015340 | Switchgrass Phyllosphere | VRVLLFLERLFSSASMEYLKQLMAKAPEDEIFMESQLLKYKPSIKFSAIFI* |
| Ga0182115_11700981 | 3300015348 | Switchgrass Phyllosphere | VGVLLFLEKLFSSASMEYLKQLMGIASADEIFIESQKLNYKPAIKFSAISTKHINY* |
| Ga0182115_11765021 | 3300015348 | Switchgrass Phyllosphere | VGVLLFSEKLFSSASMEYLKQLMGIASEDEIFMESQLLNYKLSIKFLDIFTEQANY* |
| Ga0182115_12263221 | 3300015348 | Switchgrass Phyllosphere | VRVLLFLERLFSSASMEYSKQLMGIVSEDEIFLERQLLKYKPAIKFLAIFIEHINY* |
| Ga0182115_12565631 | 3300015348 | Switchgrass Phyllosphere | VGVLLFLEKLFSSASMEYLKQLMGIASEDEIFMESQLLNYKLAIKLSAIFTEHSNY* |
| Ga0182185_11337941 | 3300015349 | Switchgrass Phyllosphere | VLLFLEKLFSSASMEYSKQLVGIASEDEILMESQLLKYKPAIKFSAIFTEHINY* |
| Ga0182163_11682082 | 3300015350 | Switchgrass Phyllosphere | VGVLLFLEKLFSSASMEYLNQLMGIASEDEIFMDSQLLNYKLTIKFSAIFTKHANY* |
| Ga0182163_12099001 | 3300015350 | Switchgrass Phyllosphere | SASMENSKQLVGIASGDEIFMESQIPNYKPAIKFSAIFIEHINYEKYINSYC* |
| Ga0182163_12099091 | 3300015350 | Switchgrass Phyllosphere | VRVLLFLEKLFSSASMEYSKQMIHIVSEDGTFMESQLLKYKPAIKFSTIFIEHINY* |
| Ga0182169_10814901 | 3300015352 | Switchgrass Phyllosphere | ERSFSSASMEYSKQLMGIVSEDEIFMESQLLKYKPSIKFSAIFIEHINY* |
| Ga0182169_11375461 | 3300015352 | Switchgrass Phyllosphere | FVILEKLLSSASMEYLNQLIRKASEDEIFMESQLLNYKLVIKFSAIFTYHDNY* |
| Ga0182179_11428761 | 3300015353 | Switchgrass Phyllosphere | VRVLLFLERLFSSESMEYSNQLMGIVSEDGIFMESQLLKYKPTINFSAIFIEHINY* |
| Ga0182179_12452931 | 3300015353 | Switchgrass Phyllosphere | VRVLLFLERLFSSASIEYSKQLMGIVSEDGIFMESQLLKYKPAIKFSAIFIEHINY* |
| Ga0182167_12072311 | 3300015354 | Switchgrass Phyllosphere | VRVLLFLERLFSSANMEYSKQLMGIVYEDEIFMESQLFKYKPVIKFSAIFIENINY* |
| Ga0182197_10656811 | 3300017408 | Switchgrass Phyllosphere | VRVLLFLERLFSSASMEYSKQLMGIASEDEIFMESQLLKYKPAIKFSAIFIDHINY |
| Ga0182197_10663701 | 3300017408 | Switchgrass Phyllosphere | VRVLLFLEGLFSSASMEYSKQMMGIASEDEIFMESQLLKYKLAIKFSAIFIEHINY |
| Ga0182197_10934331 | 3300017408 | Switchgrass Phyllosphere | VGVLLFLEKLFSSASMEYLKQLMGIASEDEIFMESQLLNYKLSIKFSAIFTEHANY |
| Ga0182197_11072931 | 3300017408 | Switchgrass Phyllosphere | VGVLLFLEKLFSSASMEYLKQLMGVASEDEIFMESQLLNYKSSIKFSAIFTQHINY |
| Ga0182199_12013441 | 3300017412 | Switchgrass Phyllosphere | VRVLLFLERLFSSASMEYSKQLMGIVSEDEIFMESQLLNYKSAIKFSAIFSEHINY |
| Ga0182195_11729171 | 3300017414 | Switchgrass Phyllosphere | VRVLLFLERLFLSASMEYSKQLMGIVSEDEIFMESQLLKYKPTIKFSAIFVEILIIKNTLNSYC |
| Ga0182195_12150651 | 3300017414 | Switchgrass Phyllosphere | VRVLLFLERLFSSASMEYSKQLMGIVSEDGIFMESQLLKYKPAIKFSPIFIEHINY |
| Ga0182213_11501841 | 3300017421 | Switchgrass Phyllosphere | VRVLLFLERLFSSARMEYSKQLMGIVSEDEIFMEIQLLKYKPVIKFSAIFIEHINY |
| Ga0182213_12116991 | 3300017421 | Switchgrass Phyllosphere | VRVLLFLERLFSSASMEYLKQLMDIASEDEIFMESQLLNYKLAIKFLAIFTEYINY |
| Ga0182201_11092202 | 3300017422 | Switchgrass Phyllosphere | VRVLLFLERLFSSVCMEYSKQLMGIVSEDGIFMESQLLKYKPAIKFSAIFIEHINY |
| Ga0182196_10356581 | 3300017432 | Switchgrass Phyllosphere | FSSVSMEYSKQLMGIASEDAIFMESQLLKHKPAIKFSAIFIDHINY |
| Ga0182194_10685881 | 3300017435 | Switchgrass Phyllosphere | LLFLERLLSSASMENSKQLVGISSEDEIFMESQLLNYKLAIKFSAIFTDNINY |
| Ga0182200_10246961 | 3300017439 | Switchgrass Phyllosphere | VRVLLFLERLFSSGSMEYSKKLMGIAYEDEIFMESQVLKYKPAIKFSAIFIDHINY |
| Ga0182214_10711291 | 3300017440 | Switchgrass Phyllosphere | VGFLLFLEKLFSSASMDYLIQLMGVASEDEIFMKSQLLNYKRAIKFSAIFTEHINY |
| Ga0182214_10917771 | 3300017440 | Switchgrass Phyllosphere | VRVLLFLEKLFSSASMEYLKQLMGIASKDEIFMESQLLNYKLSINFSAIFTEHDNY |
| Ga0182198_10874922 | 3300017445 | Switchgrass Phyllosphere | VRVLLFLERLFSSATMEYSKKLMGIASEDEIFMESQLLNYKPAINFSAIFIEHINY |
| Ga0182198_11972861 | 3300017445 | Switchgrass Phyllosphere | GVLLFLEKLFSSASMEYLKQLMGIASEDEIFMESQLLNYKLAIKFSAIFTEHINY |
| Ga0182217_10862422 | 3300017446 | Switchgrass Phyllosphere | VGVLLFLEKLFSSASMEYLKQLMGIASKDEIFMESQLLNYKLSIKFSAIFTEHANY |
| Ga0182215_10513501 | 3300017447 | Switchgrass Phyllosphere | VRVLLFLERLFSSASMEYSKQLMGIVSEDGIFMESQLLNYKLSIKFSAIFTEHVNY |
| Ga0182215_11233551 | 3300017447 | Switchgrass Phyllosphere | VRVLLFLERLLSSASMENSKQLVGIASEDEIFMESQIPNYKPAIKFSAIFTEHINY |
| Ga0182215_11605911 | 3300017447 | Switchgrass Phyllosphere | VGVLLFLEKLFSSASMEYLKQLMRIASEDEIFMKSQLLNYKLAIKFSAIFTEYANY |
| Ga0182212_11077901 | 3300017691 | Switchgrass Phyllosphere | VKVLLFLERLFSSASIEYSKQLMGIVSEDEIFMESQLLKYKPAIKFLAIFTEHTNY |
| Ga0182211_11054881 | 3300017694 | Switchgrass Phyllosphere | VGVLLFLEKLFSSPSMEYLIQLMGIASEDEIFMESQLLNYKLAIKFSAIFTEHANY |
| Ga0163161_106531571 | 3300017792 | Switchgrass Rhizosphere | VGVLLFLEKLFSSAIMEYLKQLTGIVSEDEIFMESQLLKYKPAIKFSIIFIEHINY |
| Ga0182146_1029481 | 3300020033 | Switchgrass Phyllosphere | VRVLLFLEKLFSSASMEYSKQLVGIASEDEILMESQLLKYKPAIKFSAIFTEHINY |
| Ga0182118_1150662 | 3300020223 | Switchgrass Phyllosphere | VGVLLFLEKLFSSASMEYLKQPMGKAPEDEIFMENQLLKYKPSIKFSAIFI |
| Ga0207680_108446231 | 3300025903 | Switchgrass Rhizosphere | VRVLLFLEKLFSSASMEYSKQLMGIVSEDEIFMESQLLKYKPSIKFSAIFIEHINY |
| Ga0207712_108009001 | 3300025961 | Switchgrass Rhizosphere | VRVLLFLERLVSSASMEYSKQLMGIVSEDEIFMESQLLKYKLAIKFSAIFTEHVNY |
| Ga0207641_125245771 | 3300026088 | Switchgrass Rhizosphere | VRVLLFLERLFLSASMEYSKQMIGIVSEDVIFMESQSLKYKPAIKFSAIFIEHINY |
| Ga0207676_118549492 | 3300026095 | Switchgrass Rhizosphere | VRVLLFLERLFSSASIEYSKQLMGIVSEDGIFMESQLLKYKPSIKFSAIFIEHINY |
| Ga0268322_10436601 | 3300028049 | Phyllosphere | LFSSARMEYSKQLMGIVSEDGIFMESQILKYKPSIKFSAIFIEHINY |
| Ga0268328_10180432 | 3300028050 | Phyllosphere | VRVLLFLERLFSSASMEYSKQLMGIVSEDEIFMESQLLKYKPSIKFSAIFIEHINY |
| Ga0268328_10312762 | 3300028050 | Phyllosphere | VRVLLFLEKLFSSASMENSKQLVGIASEDEIFMESQLLKYKPSIKFSAIFTKQFNY |
| Ga0268306_10193571 | 3300028054 | Phyllosphere | VGVLLFLERLFSSASMEYLNQLMGIASEDDIFMESQLLNYKLAIKFSPRKIIRIFHVQ |
| Ga0268330_10067051 | 3300028056 | Phyllosphere | VRVLLFLEKLFSIASMEYSKQLMGIDYEDEIFMESQLLKYKPAIKFSAIFIEYINY |
| Ga0268332_10287411 | 3300028058 | Phyllosphere | VGVLLFLEKLFSSASMEYLKQLMGIASEDEIFMESQLLKYKPAIKFSIIFIEHINY |
| Ga0268332_10419951 | 3300028058 | Phyllosphere | LLFLEKLFSRASMEYLKQLMGIASENEIFMERQLLNYKLAIKFSAIFTEHIIY |
| Ga0268350_10362071 | 3300028063 | Phyllosphere | VRVLLFLERLFSSASMEYSKQLMGIVSEDGISMESQLLKYKPAIKFSAIFIEHINY |
| Ga0268340_10440681 | 3300028064 | Phyllosphere | VGVLLFLERLFSSASMEYLKQLMGIASEDEIFMESQLLKYKPAIKFSAIFSEHINY |
| Ga0268334_10080212 | 3300028140 | Phyllosphere | VGVLLFLEKLFSSASMEYLKQLMGIASEDEIFMESQLLNYKLAIKFSAIFTEHINY |
| Ga0268308_10014001 | 3300028151 | Phyllosphere | LLFLEKLFSSASMEYSKQLVGIASEDEILMESQLLKYKPAIKFSAIFTEHINY |
| Ga0268308_10298151 | 3300028151 | Phyllosphere | VRVLLFLERLFSSASMEYSKQLMGIVSEDEIFMESQLLKYKPAIKFSAIFIEHINY |
| Ga0268320_10217331 | 3300028153 | Phyllosphere | VRVLLFLERLFSSASMEYSKQLMGKVSEDEIFMGSQLLKYKPAIKFSAIFIEHINY |
| Ga0268341_10219761 | 3300028154 | Phyllosphere | VGVLLFLEKLFSSASMEYLKQMMGIDSKDEIFMESQLLNYKLSIKFSAIFTEHANY |
| Ga0268349_10319211 | 3300028155 | Phyllosphere | VGVLLFLEKLFSSASMEYLKQLMGIASEDEIFMESQLLNYKHAIKFSAIFTEHTNY |
| Ga0268312_10035032 | 3300028248 | Phyllosphere | FLIKEVRVLLFLEKLFSSASMEYSKQLVGIASEDEILMESQLLKYKPAIKFSAIFTEHIN |
| Ga0268312_10338131 | 3300028248 | Phyllosphere | VRVLLFLERSFSSASMEYSKHLMGIVSEDEIFMESQLLKYKPSIKFSDILISHINC |
| Ga0268265_125174361 | 3300028380 | Switchgrass Rhizosphere | VRVLLFLERSFSSASMEYSKQLMGIASEYEIFMESQLLKYKPAIKFSAIFTEHINY |
| Ga0268302_1017961 | 3300028464 | Phyllosphere | VGVLLFLEKLFSSASMEYLKQLMGIASEDEIFMESQLLNYKLAIKISAIFTEHANY |
| Ga0268321_1027602 | 3300028466 | Phyllosphere | VRVLLFLERLFSSASMEYSKQLMGIVSEDGIFMESQLLKYKPTIKFSDIFIEHINY |
| Ga0268333_10022301 | 3300028467 | Phyllosphere | LLSSASMENSKQLVGISSEDEIFMESPLLNYKPAIKFSAIFTKHINY |
| Ga0268307_10034421 | 3300028470 | Phyllosphere | VRVLLFLERLFSSASMENSKQLMGIASEDEIFMESQLLKYKPAIKFSAIFTEHINY |
| Ga0268307_10118331 | 3300028470 | Phyllosphere | VRVLLFLERLFSSASMEYSKQLMGIVSEDGIFMESQILKYKPTIKFSAIFIEHIN |
| Ga0214488_10715511 | 3300032467 | Switchgrass Phyllosphere | VRVLLFLERLFSSASMEYSKQLMGIVSEDGIFMESQLLKYKPAIKFSAIFIEHINY |
| Ga0321339_11291171 | 3300032551 | Switchgrass Phyllosphere | VRVLLFLERLFSSASMEYSKQLMGIVSEDGIFMESQLLKYKLAIKFSAIFIEHINY |
| Ga0321338_11113401 | 3300032593 | Switchgrass Phyllosphere | VRVLLFLERLFSSASMEYSKQLMGIVSEDGIFMESQLLKYKPAIKFSIIFIEHINY |
| Ga0214501_12508692 | 3300032625 | Switchgrass Phyllosphere | VRVLLFLERLFSGASMEYSKQLMGKVSEDEIFMGSQLLKYKQAIKFSAIFVEHINY |
| Ga0214497_10974151 | 3300032689 | Switchgrass Phyllosphere | VGVWLFLERLFSSASMEYLNQLMGIASGDEIFMESQLLNYKLAIKFSAIFTEHTNY |
| Ga0214499_12488461 | 3300032697 | Switchgrass Phyllosphere | VRVLLFLERLFSSASMEYSKQLMGIVSEDGIFMESQLLKYKPAIKFSAIFSEHINY |
| Ga0314723_10987781 | 3300032823 | Switchgrass Phyllosphere | VGVLLFLEKLFSSVSMEDLKQMMGIVPEDEIFMESQLLNYKLSIKFSAIFTEHTNY |
| Ga0314739_10604932 | 3300032913 | Switchgrass Phyllosphere | VRVLLFLERLFSSASIEYSKQLMGIVSEDGIFMESQLLKYKPAIKFSAIFIEHINY |
| Ga0314758_12042941 | 3300033525 | Switchgrass Phyllosphere | VRVLLFLERLFSSARMEYSKQLMGIASEDEIFMESQLLKYKPDIKFSIIFIEHINY |
| ⦗Top⦘ |