| Basic Information | |
|---|---|
| Family ID | F036039 |
| Family Type | Metagenome |
| Number of Sequences | 170 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MLKKINNIFRLKGIFVFSHLQFDGVRAQTDGSGMEDTKKLE |
| Number of Associated Samples | 64 |
| Number of Associated Scaffolds | 170 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 2.40 % |
| % of genes near scaffold ends (potentially truncated) | 66.47 % |
| % of genes from short scaffolds (< 2000 bps) | 97.06 % |
| Associated GOLD sequencing projects | 64 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (85.882 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (97.647 % of family members) |
| Environment Ontology (ENVO) | Unclassified (97.647 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (97.647 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 170 Family Scaffolds |
|---|---|---|
| PF13456 | RVT_3 | 1.76 |
| PF01487 | DHquinase_I | 0.59 |
| PF00076 | RRM_1 | 0.59 |
| PF14291 | DUF4371 | 0.59 |
| PF03514 | GRAS | 0.59 |
| PF13041 | PPR_2 | 0.59 |
| PF00067 | p450 | 0.59 |
| COG ID | Name | Functional Category | % Frequency in 170 Family Scaffolds |
|---|---|---|---|
| COG0710 | 3-dehydroquinate dehydratase | Amino acid transport and metabolism [E] | 0.59 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.59 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 85.88 % |
| All Organisms | root | All Organisms | 14.12 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005364|Ga0070673_102407580 | Not Available | 501 | Open in IMG/M |
| 3300013296|Ga0157374_11391208 | Not Available | 724 | Open in IMG/M |
| 3300013297|Ga0157378_11445835 | Not Available | 731 | Open in IMG/M |
| 3300015267|Ga0182122_1044075 | Not Available | 579 | Open in IMG/M |
| 3300015269|Ga0182113_1025633 | Not Available | 746 | Open in IMG/M |
| 3300015269|Ga0182113_1070237 | Not Available | 557 | Open in IMG/M |
| 3300015269|Ga0182113_1088475 | Not Available | 518 | Open in IMG/M |
| 3300015274|Ga0182188_1010577 | Not Available | 792 | Open in IMG/M |
| 3300015275|Ga0182172_1017924 | Not Available | 753 | Open in IMG/M |
| 3300015277|Ga0182128_1079792 | Not Available | 502 | Open in IMG/M |
| 3300015279|Ga0182174_1060325 | Not Available | 560 | Open in IMG/M |
| 3300015281|Ga0182160_1037572 | Not Available | 634 | Open in IMG/M |
| 3300015282|Ga0182124_1018791 | Not Available | 759 | Open in IMG/M |
| 3300015283|Ga0182156_1043258 | Not Available | 620 | Open in IMG/M |
| 3300015283|Ga0182156_1045323 | Not Available | 612 | Open in IMG/M |
| 3300015283|Ga0182156_1070082 | Not Available | 539 | Open in IMG/M |
| 3300015283|Ga0182156_1070951 | Not Available | 537 | Open in IMG/M |
| 3300015286|Ga0182176_1042265 | Not Available | 629 | Open in IMG/M |
| 3300015286|Ga0182176_1052481 | Not Available | 588 | Open in IMG/M |
| 3300015286|Ga0182176_1065506 | Not Available | 548 | Open in IMG/M |
| 3300015287|Ga0182171_1002179 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 1401 | Open in IMG/M |
| 3300015287|Ga0182171_1086917 | Not Available | 504 | Open in IMG/M |
| 3300015288|Ga0182173_1010282 | Not Available | 905 | Open in IMG/M |
| 3300015288|Ga0182173_1057550 | Not Available | 568 | Open in IMG/M |
| 3300015288|Ga0182173_1065840 | Not Available | 546 | Open in IMG/M |
| 3300015289|Ga0182138_1030117 | Not Available | 687 | Open in IMG/M |
| 3300015291|Ga0182125_1003513 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1257 | Open in IMG/M |
| 3300015291|Ga0182125_1049017 | Not Available | 612 | Open in IMG/M |
| 3300015291|Ga0182125_1083889 | Not Available | 522 | Open in IMG/M |
| 3300015292|Ga0182141_1020376 | Not Available | 779 | Open in IMG/M |
| 3300015292|Ga0182141_1087408 | Not Available | 514 | Open in IMG/M |
| 3300015294|Ga0182126_1030843 | Not Available | 701 | Open in IMG/M |
| 3300015294|Ga0182126_1064031 | Not Available | 568 | Open in IMG/M |
| 3300015296|Ga0182157_1050831 | Not Available | 623 | Open in IMG/M |
| 3300015298|Ga0182106_1033811 | All Organisms → cellular organisms → Eukaryota | 701 | Open in IMG/M |
| 3300015299|Ga0182107_1042248 | Not Available | 661 | Open in IMG/M |
| 3300015299|Ga0182107_1078681 | Not Available | 550 | Open in IMG/M |
| 3300015300|Ga0182108_1073875 | Not Available | 564 | Open in IMG/M |
| 3300015300|Ga0182108_1082086 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 546 | Open in IMG/M |
| 3300015303|Ga0182123_1073721 | Not Available | 549 | Open in IMG/M |
| 3300015304|Ga0182112_1016603 | Not Available | 860 | Open in IMG/M |
| 3300015307|Ga0182144_1088111 | Not Available | 537 | Open in IMG/M |
| 3300015308|Ga0182142_1077148 | Not Available | 570 | Open in IMG/M |
| 3300015308|Ga0182142_1088978 | Not Available | 545 | Open in IMG/M |
| 3300015314|Ga0182140_1058524 | Not Available | 622 | Open in IMG/M |
| 3300015321|Ga0182127_1044566 | Not Available | 692 | Open in IMG/M |
| 3300015321|Ga0182127_1046594 | Not Available | 683 | Open in IMG/M |
| 3300015322|Ga0182110_1052787 | Not Available | 657 | Open in IMG/M |
| 3300015322|Ga0182110_1070660 | Not Available | 601 | Open in IMG/M |
| 3300015322|Ga0182110_1074571 | Not Available | 592 | Open in IMG/M |
| 3300015323|Ga0182129_1000297 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu | 2702 | Open in IMG/M |
| 3300015323|Ga0182129_1045700 | Not Available | 666 | Open in IMG/M |
| 3300015323|Ga0182129_1092631 | Not Available | 539 | Open in IMG/M |
| 3300015323|Ga0182129_1101626 | Not Available | 524 | Open in IMG/M |
| 3300015341|Ga0182187_1058667 | Not Available | 775 | Open in IMG/M |
| 3300015342|Ga0182109_1085898 | Not Available | 718 | Open in IMG/M |
| 3300015342|Ga0182109_1206296 | Not Available | 518 | Open in IMG/M |
| 3300015343|Ga0182155_1005062 | Not Available | 1691 | Open in IMG/M |
| 3300015343|Ga0182155_1103540 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 668 | Open in IMG/M |
| 3300015343|Ga0182155_1133363 | Not Available | 611 | Open in IMG/M |
| 3300015344|Ga0182189_1140606 | Not Available | 606 | Open in IMG/M |
| 3300015345|Ga0182111_1024141 | Not Available | 1165 | Open in IMG/M |
| 3300015345|Ga0182111_1174873 | Not Available | 573 | Open in IMG/M |
| 3300015345|Ga0182111_1197919 | Not Available | 546 | Open in IMG/M |
| 3300015346|Ga0182139_1002853 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 2118 | Open in IMG/M |
| 3300015346|Ga0182139_1080064 | Not Available | 770 | Open in IMG/M |
| 3300015346|Ga0182139_1105508 | Not Available | 695 | Open in IMG/M |
| 3300015346|Ga0182139_1130571 | Not Available | 642 | Open in IMG/M |
| 3300015346|Ga0182139_1143556 | Not Available | 619 | Open in IMG/M |
| 3300015346|Ga0182139_1187055 | Not Available | 559 | Open in IMG/M |
| 3300015346|Ga0182139_1193115 | Not Available | 552 | Open in IMG/M |
| 3300015346|Ga0182139_1233476 | Not Available | 512 | Open in IMG/M |
| 3300015347|Ga0182177_1074408 | Not Available | 792 | Open in IMG/M |
| 3300015347|Ga0182177_1155273 | Not Available | 604 | Open in IMG/M |
| 3300015347|Ga0182177_1171167 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 581 | Open in IMG/M |
| 3300015347|Ga0182177_1203582 | Not Available | 544 | Open in IMG/M |
| 3300015347|Ga0182177_1206822 | Not Available | 540 | Open in IMG/M |
| 3300015351|Ga0182161_1033832 | Not Available | 1101 | Open in IMG/M |
| 3300015351|Ga0182161_1048631 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 969 | Open in IMG/M |
| 3300015351|Ga0182161_1117855 | Not Available | 696 | Open in IMG/M |
| 3300015351|Ga0182161_1132982 | Not Available | 664 | Open in IMG/M |
| 3300015351|Ga0182161_1174318 | Not Available | 597 | Open in IMG/M |
| 3300015351|Ga0182161_1186938 | Not Available | 581 | Open in IMG/M |
| 3300015351|Ga0182161_1238679 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 526 | Open in IMG/M |
| 3300015351|Ga0182161_1243232 | Not Available | 522 | Open in IMG/M |
| 3300015355|Ga0182159_1010378 | Not Available | 1907 | Open in IMG/M |
| 3300015355|Ga0182159_1015392 | Not Available | 1685 | Open in IMG/M |
| 3300015355|Ga0182159_1037675 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1247 | Open in IMG/M |
| 3300015355|Ga0182159_1067876 | Not Available | 1001 | Open in IMG/M |
| 3300015355|Ga0182159_1086976 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 908 | Open in IMG/M |
| 3300015355|Ga0182159_1088433 | Not Available | 902 | Open in IMG/M |
| 3300015355|Ga0182159_1113529 | Not Available | 815 | Open in IMG/M |
| 3300015355|Ga0182159_1131641 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 766 | Open in IMG/M |
| 3300015355|Ga0182159_1160475 | Not Available | 706 | Open in IMG/M |
| 3300015355|Ga0182159_1173013 | Not Available | 684 | Open in IMG/M |
| 3300015355|Ga0182159_1187484 | Not Available | 661 | Open in IMG/M |
| 3300015355|Ga0182159_1191388 | Not Available | 655 | Open in IMG/M |
| 3300015355|Ga0182159_1202131 | Not Available | 640 | Open in IMG/M |
| 3300015355|Ga0182159_1223782 | Not Available | 612 | Open in IMG/M |
| 3300015355|Ga0182159_1265620 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 568 | Open in IMG/M |
| 3300015355|Ga0182159_1293097 | Not Available | 544 | Open in IMG/M |
| 3300015355|Ga0182159_1299249 | Not Available | 539 | Open in IMG/M |
| 3300015355|Ga0182159_1342803 | Not Available | 508 | Open in IMG/M |
| 3300015361|Ga0182145_1040765 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 841 | Open in IMG/M |
| 3300015361|Ga0182145_1140881 | Not Available | 561 | Open in IMG/M |
| 3300015361|Ga0182145_1145330 | Not Available | 555 | Open in IMG/M |
| 3300015361|Ga0182145_1158560 | Not Available | 538 | Open in IMG/M |
| 3300017404|Ga0182203_1039887 | Not Available | 788 | Open in IMG/M |
| 3300017404|Ga0182203_1081121 | Not Available | 632 | Open in IMG/M |
| 3300017404|Ga0182203_1127379 | Not Available | 547 | Open in IMG/M |
| 3300017407|Ga0182220_1037739 | Not Available | 674 | Open in IMG/M |
| 3300017407|Ga0182220_1055447 | Not Available | 608 | Open in IMG/M |
| 3300017410|Ga0182207_1052158 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 752 | Open in IMG/M |
| 3300017410|Ga0182207_1111116 | Not Available | 589 | Open in IMG/M |
| 3300017410|Ga0182207_1112500 | Not Available | 587 | Open in IMG/M |
| 3300017410|Ga0182207_1143011 | Not Available | 541 | Open in IMG/M |
| 3300017411|Ga0182208_1078469 | Not Available | 589 | Open in IMG/M |
| 3300017413|Ga0182222_1003472 | Not Available | 1212 | Open in IMG/M |
| 3300017413|Ga0182222_1075352 | Not Available | 553 | Open in IMG/M |
| 3300017413|Ga0182222_1087164 | Not Available | 532 | Open in IMG/M |
| 3300017415|Ga0182202_1053806 | Not Available | 681 | Open in IMG/M |
| 3300017415|Ga0182202_1068974 | Not Available | 631 | Open in IMG/M |
| 3300017420|Ga0182228_1103862 | Not Available | 545 | Open in IMG/M |
| 3300017424|Ga0182219_1038832 | Not Available | 749 | Open in IMG/M |
| 3300017424|Ga0182219_1090713 | Not Available | 577 | Open in IMG/M |
| 3300017425|Ga0182224_1023783 | Not Available | 914 | Open in IMG/M |
| 3300017425|Ga0182224_1066758 | Not Available | 671 | Open in IMG/M |
| 3300017425|Ga0182224_1069423 | Not Available | 664 | Open in IMG/M |
| 3300017425|Ga0182224_1092454 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula | 607 | Open in IMG/M |
| 3300017425|Ga0182224_1142929 | Not Available | 527 | Open in IMG/M |
| 3300017427|Ga0182190_1010912 | Not Available | 1226 | Open in IMG/M |
| 3300017427|Ga0182190_1084882 | Not Available | 632 | Open in IMG/M |
| 3300017427|Ga0182190_1091579 | Not Available | 616 | Open in IMG/M |
| 3300017430|Ga0182192_1064840 | Not Available | 707 | Open in IMG/M |
| 3300017430|Ga0182192_1099103 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes | 611 | Open in IMG/M |
| 3300017433|Ga0182206_1052382 | Not Available | 715 | Open in IMG/M |
| 3300017433|Ga0182206_1083326 | Not Available | 619 | Open in IMG/M |
| 3300017436|Ga0182209_1032588 | Not Available | 850 | Open in IMG/M |
| 3300017436|Ga0182209_1101592 | Not Available | 599 | Open in IMG/M |
| 3300017436|Ga0182209_1175833 | Not Available | 500 | Open in IMG/M |
| 3300017438|Ga0182191_1028376 | Not Available | 922 | Open in IMG/M |
| 3300017438|Ga0182191_1047486 | Not Available | 786 | Open in IMG/M |
| 3300017438|Ga0182191_1058681 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis | 734 | Open in IMG/M |
| 3300017438|Ga0182191_1068479 | Not Available | 698 | Open in IMG/M |
| 3300017438|Ga0182191_1104255 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 608 | Open in IMG/M |
| 3300017442|Ga0182221_1040247 | Not Available | 782 | Open in IMG/M |
| 3300017442|Ga0182221_1141067 | Not Available | 534 | Open in IMG/M |
| 3300017443|Ga0182193_1113062 | Not Available | 610 | Open in IMG/M |
| 3300017443|Ga0182193_1117274 | Not Available | 603 | Open in IMG/M |
| 3300017680|Ga0182233_1104872 | Not Available | 525 | Open in IMG/M |
| 3300017682|Ga0182229_1061616 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 639 | Open in IMG/M |
| 3300017682|Ga0182229_1097628 | Not Available | 520 | Open in IMG/M |
| 3300017682|Ga0182229_1099708 | Not Available | 515 | Open in IMG/M |
| 3300017683|Ga0182218_1037478 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza | 772 | Open in IMG/M |
| 3300017683|Ga0182218_1070492 | Not Available | 640 | Open in IMG/M |
| 3300017683|Ga0182218_1104305 | Not Available | 568 | Open in IMG/M |
| 3300017684|Ga0182225_1041323 | Not Available | 741 | Open in IMG/M |
| 3300017684|Ga0182225_1058571 | Not Available | 665 | Open in IMG/M |
| 3300017684|Ga0182225_1098034 | Not Available | 568 | Open in IMG/M |
| 3300017686|Ga0182205_1008735 | Not Available | 1297 | Open in IMG/M |
| 3300017686|Ga0182205_1048405 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 764 | Open in IMG/M |
| 3300017686|Ga0182205_1106390 | Not Available | 592 | Open in IMG/M |
| 3300017690|Ga0182223_1020973 | Not Available | 815 | Open in IMG/M |
| 3300017690|Ga0182223_1032106 | Not Available | 729 | Open in IMG/M |
| 3300017690|Ga0182223_1065047 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 603 | Open in IMG/M |
| 3300017690|Ga0182223_1106151 | Not Available | 526 | Open in IMG/M |
| 3300025940|Ga0207691_11636356 | Not Available | 523 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 97.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.18% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.59% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015267 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015282 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015286 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017680 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017682 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070673_1024075801 | 3300005364 | Switchgrass Rhizosphere | MLKKINDIFRLKGIFDFSHLQFDGVSAQTDGSGMEGTKKLEQWR* |
| Ga0157374_113912081 | 3300013296 | Miscanthus Rhizosphere | RCSKKINNIFELKGIFVFSHLQFNGVRAQTDGSGMDDTKKLK* |
| Ga0157378_114458351 | 3300013297 | Miscanthus Rhizosphere | MLKKINDIFKRKGIFDFSHLQFDGVRAQTDGSGMEDTKKLE* |
| Ga0182122_10440751 | 3300015267 | Miscanthus Phyllosphere | MLKKINDVFRFKGIFDFLLLQFDTVRAQTDGSGMEGIKKLEQWR* |
| Ga0182113_10256332 | 3300015269 | Miscanthus Phyllosphere | KSLRCSKKINNIFKLKGIFVFSHLQFDDVRAQTDGSGMEDTKKLE* |
| Ga0182113_10702371 | 3300015269 | Miscanthus Phyllosphere | MLKKINDIFILKGIFVFSHLPFDGVRAQTDGSGMKGTKKLEQ* |
| Ga0182113_10884751 | 3300015269 | Miscanthus Phyllosphere | NDIFRLKGIFDFSHLQFDGVKAQTDGSGIEGTKKLEQWR* |
| Ga0182188_10105771 | 3300015274 | Miscanthus Phyllosphere | KINNIFELKGIFVFSHLQFNGVRAQTDGSGMDDTKKLK* |
| Ga0182172_10179241 | 3300015275 | Miscanthus Phyllosphere | MLKKINDIFIFKGIFDFLRLQFGGVRAQTDGSGMEGTKKLKQ* |
| Ga0182128_10797921 | 3300015277 | Miscanthus Phyllosphere | MLKKINDIFRLKGIFDFSHLQFDGVKAQTDDSDIEGTKKLKQ*Y*RP |
| Ga0182174_10603251 | 3300015279 | Miscanthus Phyllosphere | KKINNIFRLKGIFVFSHLQFDGVRAQTDGSGMEDTKKLE* |
| Ga0182160_10375721 | 3300015281 | Miscanthus Phyllosphere | NDIFKHNGIFDFLHLQFDTVGIQSDGSSMEGKKKK* |
| Ga0182124_10187912 | 3300015282 | Miscanthus Phyllosphere | VKMLKKINDIFRLKGIFDFSHLQFDDVRAQTDGSGMKGTKKLEQ* |
| Ga0182156_10432582 | 3300015283 | Miscanthus Phyllosphere | MLKKINDIFTLKGIFVFSHLQFDDVRAQTNGSGMEDMKKLEQ* |
| Ga0182156_10453231 | 3300015283 | Miscanthus Phyllosphere | VFSFEVVKMLKKNNNIFELKGIFVFSHLRFDGVKTCTDESGMEDLKKLE* |
| Ga0182156_10700822 | 3300015283 | Miscanthus Phyllosphere | EFFSFEVVKMLKKINNIFRLKDIFDFSHLQFDGVRAQTDGSDMKDKKKLEQ* |
| Ga0182156_10709511 | 3300015283 | Miscanthus Phyllosphere | LKKINDIFRLKGIFVFSHLQFDGVRAQTDSSGMEGTKKLEQWP* |
| Ga0182176_10422651 | 3300015286 | Miscanthus Phyllosphere | SLTCSKKLTTFKLRDIFDFSHLQFDGVRAQTDGSGMEDTKKLEQWR* |
| Ga0182176_10524811 | 3300015286 | Miscanthus Phyllosphere | MLKKINDIFTLKDIFVFSHLQFDGVRAQTDRSVMEGIKKLEQ* |
| Ga0182176_10655061 | 3300015286 | Miscanthus Phyllosphere | MLKKINDIFRLKGIFDFSRVQFDDVRAQTDGSGID |
| Ga0182171_10021791 | 3300015287 | Miscanthus Phyllosphere | MNDIFRHMGIFDFSHLQFDGVKVQTDDSGMEGTKKLEQWR* |
| Ga0182171_10869171 | 3300015287 | Miscanthus Phyllosphere | KKINNIFELKGIFVFSHLQFDGVNVQTDGSGIEDTKKLK* |
| Ga0182173_10102822 | 3300015288 | Miscanthus Phyllosphere | MLKKINDIFKLKGIFDFLRLQFDGVRAQTDDSGMEGTKKLEQWR* |
| Ga0182173_10575502 | 3300015288 | Miscanthus Phyllosphere | NNIFELKGIFVFSHLQFDGVRAQTDGSGMDDTKKLK* |
| Ga0182173_10658401 | 3300015288 | Miscanthus Phyllosphere | VFSFEVVKMFKKINNIFRLKGIFVFSHLQFDGVRAQTDGSGMKDTKKLE* |
| Ga0182138_10301171 | 3300015289 | Miscanthus Phyllosphere | MLKKINDIFILKGIFVFSHLQFDGVRAQTDGSGMEDTKKLE* |
| Ga0182125_10035131 | 3300015291 | Miscanthus Phyllosphere | KKINNIFRLKGIFVFSHLQFDGVRAQTNGSGMDNTKK* |
| Ga0182125_10490171 | 3300015291 | Miscanthus Phyllosphere | MLKKINDIFRLKGIFVFSHLQFDGVRAQTDESGMEDTKKLK* |
| Ga0182125_10838891 | 3300015291 | Miscanthus Phyllosphere | VVKMLKKINDIFRHKGIFDFLHLQYDIVRTQSEGSGMEGKNKLKQWR* |
| Ga0182141_10203761 | 3300015292 | Miscanthus Phyllosphere | KKINDIFRLKGIFDFSHLKFDVVRAQTDGSGMEGTKKFEQWR* |
| Ga0182141_10874081 | 3300015292 | Miscanthus Phyllosphere | KKINNIFELKGILVFSHLQFDGVRVQTGGSGMEDTKKLK* |
| Ga0182126_10308432 | 3300015294 | Miscanthus Phyllosphere | VFSIEVVKMLKKINDIFKHKGIFDFSHLQFDGVRAQTDGSGMEGTKKLEQ* |
| Ga0182126_10640311 | 3300015294 | Miscanthus Phyllosphere | IFRLKGIFVFSHLQFDGVRAQTDGSGMEDTKKLE* |
| Ga0182157_10508311 | 3300015296 | Miscanthus Phyllosphere | NIFELEGIFVFSHLQFDGVRAQTDDSGMEDTKKLVQ* |
| Ga0182106_10338111 | 3300015298 | Miscanthus Phyllosphere | LKKINDIFRLKGIFIFSHLQFDGVRAQTDGSGVEGTKKLEQWR* |
| Ga0182107_10422481 | 3300015299 | Miscanthus Phyllosphere | IFELKGIFVFSHLQFDGVRAQTDGSGMDDTKKLE* |
| Ga0182107_10786811 | 3300015299 | Miscanthus Phyllosphere | VVKMLKKINNIFRLKGIFVFSHLQFDGVRAQTDGSGMEDTKKLE* |
| Ga0182108_10738752 | 3300015300 | Miscanthus Phyllosphere | MLKNDIFRLKGIFDFSHMQFDGVKAQTDGIGIEGTKKLEQ* |
| Ga0182108_10820862 | 3300015300 | Miscanthus Phyllosphere | MLKKINNIFELKGIFVFSHLQFDGFKAQTDGSGMDDTKKLE* |
| Ga0182123_10737213 | 3300015303 | Miscanthus Phyllosphere | FEVVKMLKKINNIFRLKGIFVFSHLQFDSVRAQTDRSGMKDTKKLE* |
| Ga0182112_10166031 | 3300015304 | Miscanthus Phyllosphere | GIFRLKGIFDFSHLQFDGVRAQTDSSGMDGTKKLEQWH* |
| Ga0182144_10881111 | 3300015307 | Miscanthus Phyllosphere | EVVKMLKKINNIFRLKGIFVFSHLQFDSVRAQIDESGMEDMKKLE* |
| Ga0182142_10771481 | 3300015308 | Miscanthus Phyllosphere | MLKKINDIFRLKGIFIFSHLQFDGVRAQTDGSGMEGTKKLEQWR* |
| Ga0182142_10889781 | 3300015308 | Miscanthus Phyllosphere | NIFELKGIFVFSHLQFDGVRG*TDGSGMEDPKKLE* |
| Ga0182140_10585241 | 3300015314 | Miscanthus Phyllosphere | NIFRLKGIFVFSHLQFDGVRGQTDGSGMKDTKKLE* |
| Ga0182127_10445661 | 3300015321 | Miscanthus Phyllosphere | MLKKINDIFKLKGIFDFSHLQFDGVRAQTDGSGIEGTKKLEQ* |
| Ga0182127_10465941 | 3300015321 | Miscanthus Phyllosphere | FEVVKMLKKINNIFRHKGIFDFSHLQFDGVRAQTDGSGMEGTKKLEQ* |
| Ga0182110_10527871 | 3300015322 | Miscanthus Phyllosphere | IFRLKGIFDFSHLQFDGVRAQTDGSGMEGTKKLEQWH* |
| Ga0182110_10706601 | 3300015322 | Miscanthus Phyllosphere | EVVKILKKINGIF*LKGIFDFSHLQFDTVRAQSDDSGMEGKKKLKQ* |
| Ga0182110_10745711 | 3300015322 | Miscanthus Phyllosphere | MLKKINNIFELKGIFVFSHLQFDGVRVQTDGSGMEDTKKLE* |
| Ga0182129_10002971 | 3300015323 | Miscanthus Phyllosphere | MLKKINGIFRLRGIFDFSHLQFDGVRAQTDGSGIEGIKKSDQWR* |
| Ga0182129_10457001 | 3300015323 | Miscanthus Phyllosphere | IFRLKGNFDFSHLQFDTVRVQFYGSGIEDKKKKLKQWR* |
| Ga0182129_10926312 | 3300015323 | Miscanthus Phyllosphere | VFSFEVVKMLQNINDIFRLKDIFVFSHLQFDDVRAQTDGSGMEGKKKLEQ* |
| Ga0182129_11016261 | 3300015323 | Miscanthus Phyllosphere | KMLKKINNIFRLKGIFVFSHLQFDGVRAQTDGSGMEDMKKLEHTEDCDLL* |
| Ga0182187_10586671 | 3300015341 | Miscanthus Phyllosphere | EFFHLKSLRYLKKINNIFELKGIFVFSHLQFDGVRA*TDGSGMEDPKKLE* |
| Ga0182109_10858981 | 3300015342 | Miscanthus Phyllosphere | NIFKLKGIFVFSHLQFDGVRAQTDGSGMDDTKKLK* |
| Ga0182109_12062961 | 3300015342 | Miscanthus Phyllosphere | IFRLKGIFVFSHLQFDGVRAQIDGSGMEGIKKLEQWR* |
| Ga0182155_10050621 | 3300015343 | Miscanthus Phyllosphere | FKVVKILKKINDISRHKGIFDFSHLQFDGVEAQTDGNGIEGTKKLEPWR* |
| Ga0182155_11035401 | 3300015343 | Miscanthus Phyllosphere | KINDIFRLKGIFDFSQLQFDVVRAQTDDNGMEGTQKLEQWR* |
| Ga0182155_11333631 | 3300015343 | Miscanthus Phyllosphere | MLKKIKDIFRLKGIFDFSHLQFDGVRVKTDGSDIKSTKKLEQW* |
| Ga0182189_11406062 | 3300015344 | Miscanthus Phyllosphere | FFHLKLLRCSKKINNIFRLKGIFVFSHLQFDSVRAQIDESGMEDMKKLE* |
| Ga0182111_10241413 | 3300015345 | Miscanthus Phyllosphere | SKKINNIFELKGIFVFLHLQFDGVRA*TDGSGIEDPKKLE* |
| Ga0182111_11748731 | 3300015345 | Miscanthus Phyllosphere | MLKKINNIFRLKGIFVFSHLQFDGIRAQTDGSGMEDMKKLE* |
| Ga0182111_11979191 | 3300015345 | Miscanthus Phyllosphere | SKKINNIFRLNGIFVFSHLQFDGVRGQTDGSGMEATKKLE* |
| Ga0182111_12457791 | 3300015345 | Miscanthus Phyllosphere | FFHLKSLRCSKKINNIFKLKGIFVFSHLQFDGVKVQIDGSGMEDTKKLE* |
| Ga0182139_10028531 | 3300015346 | Miscanthus Phyllosphere | MLKKKINDIFKLKGIFDFLHLQFNGVRAQTDGSGMEGTKKLKQ* |
| Ga0182139_10800641 | 3300015346 | Miscanthus Phyllosphere | LKSLRYLKNNDIFRLKDIFDFSHLQFDGVRAQTDESGMESVKKLEQ |
| Ga0182139_11055081 | 3300015346 | Miscanthus Phyllosphere | MLKKINGIFKPKGIFYFSHLQFDNVRAQSNGSDMEGKKN* |
| Ga0182139_11305712 | 3300015346 | Miscanthus Phyllosphere | IFELKGIFVFSHLQFNGVRAQTDGSGMDDTKKLE* |
| Ga0182139_11435561 | 3300015346 | Miscanthus Phyllosphere | MLKKIDDIFRLKAIFDFSHLQFDTVRAQSDGSGIEGKKKLEQ*R* |
| Ga0182139_11870552 | 3300015346 | Miscanthus Phyllosphere | DIFRLKGIFDFSHLQFDGVRAQTDDSGMEGIKKLEQWR* |
| Ga0182139_11931151 | 3300015346 | Miscanthus Phyllosphere | VKILKKINDIFKFKGIFVFSHLQFDGVRAQTDGSGMEGIKKLEQWR* |
| Ga0182139_12334761 | 3300015346 | Miscanthus Phyllosphere | MLKKINDIFTLKGIFDFSQLQFDGVRAQTDGSGMEDTKKLEQWH* |
| Ga0182177_10744081 | 3300015347 | Miscanthus Phyllosphere | NNIFEFKGIFVFSHLQFNGVRAQTDGSGIDDTKKLK* |
| Ga0182177_11552731 | 3300015347 | Miscanthus Phyllosphere | MLKKINNIFRLMGIFVFSHLQFNGVRAQTDGSGMEDTKKLE* |
| Ga0182177_11711672 | 3300015347 | Miscanthus Phyllosphere | MLKKINDIFKPKGIFDFSHPQFDTVIVQSDSSGMEGKKKLEQ* |
| Ga0182177_12035821 | 3300015347 | Miscanthus Phyllosphere | VFSFEVVKMLKKINDIFRLKGIFDFSHLQFDDVRAQTDGSGMEGTKKLEQWR* |
| Ga0182177_12068221 | 3300015347 | Miscanthus Phyllosphere | SKKLMTFKLRDIFDFSHLQFDGVRAQTDGSGMEDTKKLEQWR* |
| Ga0182161_10338321 | 3300015351 | Miscanthus Phyllosphere | MLKKINNIFRLKGIFVFSHLQFDGVRAQTDGSGMEDTKKLE* |
| Ga0182161_10486311 | 3300015351 | Miscanthus Phyllosphere | KINDIFRHKGIFDFSHLQFDGVRVQTNGSGIEGTKKLE* |
| Ga0182161_11178551 | 3300015351 | Miscanthus Phyllosphere | MLKKINDIFTFKGIFDFSHMQFNGVRAQTDGSGMEGTKKLEQWR* |
| Ga0182161_11329821 | 3300015351 | Miscanthus Phyllosphere | LKGIFDFSHLQFDGVIAQTDGSGMEGIKKLEQWR* |
| Ga0182161_11743181 | 3300015351 | Miscanthus Phyllosphere | NNIFRLKGIFVFSHLQFDGVSVQTDRSGMEDTKKLK* |
| Ga0182161_11869381 | 3300015351 | Miscanthus Phyllosphere | VFVFEVVKMLKKINNIFRLKSIFVFSHLQFDGVRAQTNGSGIEGTKKL* |
| Ga0182161_12386791 | 3300015351 | Miscanthus Phyllosphere | EFFSFEVVKMLKKINDIFRFKGIFVFSHLQFDGVRAQTDGSGMEDAKTLEQ* |
| Ga0182161_12432321 | 3300015351 | Miscanthus Phyllosphere | CSKKINNIFKLKGIFVFSHLQFNGVRAQTDGSGMDDTKKLEQWR* |
| Ga0182159_10103781 | 3300015355 | Miscanthus Phyllosphere | KKINNIFRLKGIFVFSHLQFDGVRAQTDGSGMEDMKKLE* |
| Ga0182159_10153921 | 3300015355 | Miscanthus Phyllosphere | MNDIFRLKGIFDFSHLQLDGVRAQTDGSGMEGTKKLEQWR* |
| Ga0182159_10376752 | 3300015355 | Miscanthus Phyllosphere | MLKKIINIFELKGIFVFLHLQFDGVRV*TDGSGMEDPKKLE* |
| Ga0182159_10678761 | 3300015355 | Miscanthus Phyllosphere | MLKKINGIFRLKGIFDFSHLQFDGVRAQTNGSGMEGTKKLKQ* |
| Ga0182159_10869761 | 3300015355 | Miscanthus Phyllosphere | VVKMLKKINITFRLKSIFVFSHLQFDGVRAQTDGSDMDDTKKLK* |
| Ga0182159_10884332 | 3300015355 | Miscanthus Phyllosphere | MLKKINNIFELKGIFVISHLQFDGVRVQTDGSGMNDTKKLE* |
| Ga0182159_11135291 | 3300015355 | Miscanthus Phyllosphere | KMLKKINNIFELKGIFVFSHLQFNGVRAQTDGSGMDDTKKLE* |
| Ga0182159_11316412 | 3300015355 | Miscanthus Phyllosphere | MLKKINDIFTLKGIFVFSNLQFDGVRVQTDGSAMESMKKLEQWR* |
| Ga0182159_11604752 | 3300015355 | Miscanthus Phyllosphere | EVVKMLKKINNIFRLKGIFVFSHLQFDGVRAQTDGSGMEDMKKLE* |
| Ga0182159_11730131 | 3300015355 | Miscanthus Phyllosphere | VFLFEVVKMLKKINDIFRLKGIFDFSHLQFDGVGGQTDGSSM* |
| Ga0182159_11874841 | 3300015355 | Miscanthus Phyllosphere | MLKKINDIFRLKGIFDFSHLHFDGVRAQTDDSGMEGTKKLEQ* |
| Ga0182159_11913881 | 3300015355 | Miscanthus Phyllosphere | MLKKINNIFRVKDIFDFSYLQFDGVRVQTDGNGMEGTKKLKQWR* |
| Ga0182159_12021311 | 3300015355 | Miscanthus Phyllosphere | NIFELKGIFVFSHLQFDGVRAQTDGSGMDDTKKLE* |
| Ga0182159_12237821 | 3300015355 | Miscanthus Phyllosphere | KINDIFRLKGIFDFSHLQFDDVRGQTDGSGMEGMKKLKQWR* |
| Ga0182159_12656201 | 3300015355 | Miscanthus Phyllosphere | KKINNIFELKGIFVFSHLQFNGVRAQTDGSGMDDTKKLK* |
| Ga0182159_12926441 | 3300015355 | Miscanthus Phyllosphere | IFRLKGIFVFSHLQFDSVKVQTDGSGMEDMKKLE* |
| Ga0182159_12930971 | 3300015355 | Miscanthus Phyllosphere | INNIFELNGIFVFSPLQFNGVRAKTDRSGIDDTKKLK* |
| Ga0182159_12992491 | 3300015355 | Miscanthus Phyllosphere | KINNIFRLKGIFVFLHLQFDGVRAQTDGSGMGDTKKLE* |
| Ga0182159_13428031 | 3300015355 | Miscanthus Phyllosphere | IFRNKGIFNFSHLQFDGVRAQTDGSGMEGTKKLEQWR* |
| Ga0182145_10407652 | 3300015361 | Miscanthus Phyllosphere | VFSFKVVKMLKKINDIFRLNCIFDFSHLQFDTVRVQSDGSGMEGKKKS* |
| Ga0182145_11408811 | 3300015361 | Miscanthus Phyllosphere | EVVKMLKKINDIFRLKGIFDFSHLQFDGVRAQTDGSGMEGTKKLKQWR* |
| Ga0182145_11453301 | 3300015361 | Miscanthus Phyllosphere | KKINDIFRLKGIFDFLHLQFDIVRTQSEGSGMEGKNKLKQWR* |
| Ga0182145_11585602 | 3300015361 | Miscanthus Phyllosphere | MLKKINDIFTHKGIFDFSHLQFDGVRVQTDRSGMEGTKKLEQ* |
| Ga0182203_10398871 | 3300017404 | Miscanthus Phyllosphere | MLKKINDIFRLKGIFDFSHLQFDRVRGQTDGSGMDDTKKLEQ |
| Ga0182203_10811211 | 3300017404 | Miscanthus Phyllosphere | NNIFRLNGIFVFSHLQFDGVRGQTDGSGMEATKKLE |
| Ga0182203_11273792 | 3300017404 | Miscanthus Phyllosphere | MLKKINDIFRHKGIFDFSHLKFDGVRAQTNGSGMEGTKKLKQ |
| Ga0182220_10377391 | 3300017407 | Miscanthus Phyllosphere | KINNIFELKGIFVFSHLQFNCVRAQTDGSGMDDTKKLE |
| Ga0182220_10554471 | 3300017407 | Miscanthus Phyllosphere | MLKKINDIFRLKGIFDFSQLQFDGVRAQTDGSGMEDTKKLEQWH |
| Ga0182207_10521582 | 3300017410 | Miscanthus Phyllosphere | VLSFSFEVVKMLKKINNIFRLKGIFIFLYLQFDGVRAQTDESGMEDTKKLE |
| Ga0182207_11111161 | 3300017410 | Miscanthus Phyllosphere | MNDIFRLKGIFDFSHLQLDGVRAQTDGSGMEGTKKLEQWR |
| Ga0182207_11125001 | 3300017410 | Miscanthus Phyllosphere | MLKKINDIFKLKGIFDFSHMQFDGVRVQTDGSGMESTKKLEQWR |
| Ga0182207_11430111 | 3300017410 | Miscanthus Phyllosphere | MLKKINDIFTLNGIFDFSHLQFGGVRAQTDGSGMEGTKKLKQ |
| Ga0182208_10784691 | 3300017411 | Miscanthus Phyllosphere | MLKKINNIFRLKGIFVFSHLQFDGVRAQTDGSGMEDTKKLE |
| Ga0182222_10034724 | 3300017413 | Miscanthus Phyllosphere | SKKINNIFELKGIFVFSHLQFDGVRAQADGSGMNDTKKLE |
| Ga0182222_10753521 | 3300017413 | Miscanthus Phyllosphere | INNIFRLKVIFYFSHLQFDGVRAQTDGSGMEGTKKLEQWR |
| Ga0182222_10871641 | 3300017413 | Miscanthus Phyllosphere | LKKINNIFEFKGIFVFSHLQFNGVRAXTDGSGMEDPKKLE |
| Ga0182202_10538061 | 3300017415 | Miscanthus Phyllosphere | NIFELKGIFVFSHLRFDGVKAXTDGSGMEDPKKLE |
| Ga0182202_10689741 | 3300017415 | Miscanthus Phyllosphere | INNIFELKGSFVFSHLQFDGVRAQTDGSGMEDTKKLE |
| Ga0182228_11038621 | 3300017420 | Miscanthus Phyllosphere | NDIFRHKGIFDFSHLQFDGVRAQTDGSGMEGTKKLEQWH |
| Ga0182219_10388321 | 3300017424 | Miscanthus Phyllosphere | MLKKINNIFELKGIFVFSHLQFDGIRAQTDGSGMDDTKKLE |
| Ga0182219_10907131 | 3300017424 | Miscanthus Phyllosphere | INNIFEFKGIFVFSHLRFDDVKAXTDGSGMKDPKKLK |
| Ga0182224_10237831 | 3300017425 | Miscanthus Phyllosphere | VFSFKVVKMLKKINDIFRLKRIFNFSHLQFDGVRAQTDGSGMEGTKKLEQ |
| Ga0182224_10667581 | 3300017425 | Miscanthus Phyllosphere | MLKKINDIFKHKGIFDFSHLLFDGVKVQTNGSGIESKKKLEQ |
| Ga0182224_10694231 | 3300017425 | Miscanthus Phyllosphere | VFSFEVVKMFKKINNIFRLKGIFVFSHLQFDAVRAQTDGSGIEDTKKLE |
| Ga0182224_10924542 | 3300017425 | Miscanthus Phyllosphere | KKINDIFTHKGIFDFSHLQFDGVRVQTDRSGMEGTKKLEQ |
| Ga0182224_11429291 | 3300017425 | Miscanthus Phyllosphere | MLKKINNIFELKGIFVFSHLQFDGVRAQTDGSGIEDTKKLEQ |
| Ga0182190_10109121 | 3300017427 | Miscanthus Phyllosphere | MLKKINGIFRLRGIFDFSHLQFDGVRAQTDDGGMEGTKKLEQWR |
| Ga0182190_10848822 | 3300017427 | Miscanthus Phyllosphere | NDIFRLKGIFDFLHLQFDGVRAQTNGSGMDGKKKLEQ |
| Ga0182190_10915791 | 3300017427 | Miscanthus Phyllosphere | KKINDTFTLKGIFDFSHLQFDGVRAKTDGSGMDDTKKLKQ |
| Ga0182192_10648401 | 3300017430 | Miscanthus Phyllosphere | KSLRCSKKINNIFELKGIFVFSLLQFNGVRAQTDGSGMNDTKKLE |
| Ga0182192_10991031 | 3300017430 | Miscanthus Phyllosphere | VFSFEVVKMLKKINNIFRLKGIFVFSHLQFDGVRAQTDGSGMEATKKLE |
| Ga0182206_10523821 | 3300017433 | Miscanthus Phyllosphere | MLKKINDIFRYKGIFDFSHLEFDGVRAQTDGSGMEGTKKLEQWR |
| Ga0182206_10833262 | 3300017433 | Miscanthus Phyllosphere | MLKKINNIFRLKGIFDFSHLQFDGVRAKTDGSGMEGTKKLKQ |
| Ga0182209_10325881 | 3300017436 | Miscanthus Phyllosphere | EFFHLKSLRCSKKINKIFELKGIFVFSHLQFDGVRASGMEDPKKLE |
| Ga0182209_11015921 | 3300017436 | Miscanthus Phyllosphere | EVVKTLKKINDIFRHKGIFGFSHLQFDGVRAQTDGSGMEDTKKLVRWR |
| Ga0182209_11758332 | 3300017436 | Miscanthus Phyllosphere | LKKINNIFELKGIFVFSHLQFNGVRAQTDGSGMDDTKKLE |
| Ga0182191_10075042 | 3300017438 | Miscanthus Phyllosphere | MLKKINDIFRLKGIFDFSHLQFDTVRVQSDASGIEGKKNLAQWRXSPPNFFSDS |
| Ga0182191_10283762 | 3300017438 | Miscanthus Phyllosphere | MLKKINDIFRLKGIFDFSHLQFDGVRAQTDGIGMEGTKKLEQ |
| Ga0182191_10474861 | 3300017438 | Miscanthus Phyllosphere | MLKKINDIFRLKSIFDFLPLQFDGVRAQTDDSGMEDTKKLEQWR |
| Ga0182191_10586812 | 3300017438 | Miscanthus Phyllosphere | MKMLKKINDIFTLKGIFDFSHLQFDGVRAQTDDIGMEGT |
| Ga0182191_10684791 | 3300017438 | Miscanthus Phyllosphere | LKKINNIFELKGIFVFSHLQFDGVSVQTDGSGMENTKKLK |
| Ga0182191_11042552 | 3300017438 | Miscanthus Phyllosphere | FEVVKMLKKINNIFELKGIFVFLHLQFDGVRAQIDGSGMEDTKKLE |
| Ga0182221_10402471 | 3300017442 | Miscanthus Phyllosphere | RCSKKINNIFELKGIFVFSHLQFNGVRAQTDGSGMDDTKKLE |
| Ga0182221_11410671 | 3300017442 | Miscanthus Phyllosphere | LKKINDIFRLKDIFDYSHLQFDGVRAQTDGSGIEGTKRLEQ |
| Ga0182193_11130621 | 3300017443 | Miscanthus Phyllosphere | RCSKKINNIFELKGIFVFSHLQFDGVRAQTDGSGMDDTKKLK |
| Ga0182193_11172741 | 3300017443 | Miscanthus Phyllosphere | MIKKINNIFELKGIFVFSHLQFDGVNVQTDGSGMEDTKKLK |
| Ga0182233_11048721 | 3300017680 | Miscanthus Phyllosphere | MLKKINNIFRHNGIFDFSHLEFDGVRAQTDGSGIEGKKKVGAMTLL |
| Ga0182229_10616161 | 3300017682 | Miscanthus Phyllosphere | NDIFRLKGIFVFLHMQFDGIRAQTDGSGMEGTKKLE |
| Ga0182229_10976281 | 3300017682 | Miscanthus Phyllosphere | MLKKINDIFRHKGIFDFSHLQFDGVRVQTNGSGIEGTKKLE |
| Ga0182229_10997081 | 3300017682 | Miscanthus Phyllosphere | LRCSKKINNIFKLKGIFVFSHLRFNGVRAQTDGSGMDDTKKLK |
| Ga0182218_10374782 | 3300017683 | Miscanthus Phyllosphere | MLKKINDIFRLRGIFDFSHLQFDDVRAQTDGSGMEGKKKLEQ |
| Ga0182218_10704922 | 3300017683 | Miscanthus Phyllosphere | VFSFEVVKMLKKINDIFRLKGIFVFLHLQFDAITAQTDGSGMEGTKKLKQWR |
| Ga0182218_11043051 | 3300017683 | Miscanthus Phyllosphere | MLKKINDIFRPKGIFDFLHLQFDTVRAQSDSSGMEGKKKLE |
| Ga0182225_10413232 | 3300017684 | Miscanthus Phyllosphere | FLFEVVKMLKKINNIFRLKGIFVFSHLQFDGVRAQTDGSGMEATKKLE |
| Ga0182225_10585711 | 3300017684 | Miscanthus Phyllosphere | MLKKINDIFRLKDNLDFSHLQSDGVRAQTDGSGIEDIKKLEQ |
| Ga0182225_10980341 | 3300017684 | Miscanthus Phyllosphere | PFEVVKTLKKINDIFRLKGIFDFSHLQFDTVRAQSDGSGMEGKKKLEQWR |
| Ga0182205_10087352 | 3300017686 | Miscanthus Phyllosphere | MLKKINNIFELKGIFVFSHLQFNGVRAKTDGSGIDDTKKLE |
| Ga0182205_10484051 | 3300017686 | Miscanthus Phyllosphere | KSLRCSKKINDIFTFKGIFVFSPLQFNGFRGQTDGSGMESTKK |
| Ga0182205_11063901 | 3300017686 | Miscanthus Phyllosphere | KKINDIFRFKYIFDFSHLQFDTVRAQTDGNGMEDIKKLKQWR |
| Ga0182223_10209731 | 3300017690 | Miscanthus Phyllosphere | MLKKINNIFELKGIFVFSHLQFNGVRAQTDGSGMDDTKKLE |
| Ga0182223_10321061 | 3300017690 | Miscanthus Phyllosphere | FFLFKVVKMLKKINNIFRLKGIFVFSHLRFDSVRAQTDGSAMDDTKKLE |
| Ga0182223_10650472 | 3300017690 | Miscanthus Phyllosphere | KSLKCSKKINNIFRLKSIFDFSHLQFDGVRVQTDGSGMEGTKKLKQWR |
| Ga0182223_11061511 | 3300017690 | Miscanthus Phyllosphere | NIFILKGIFVFSHLQFDGVRAQTDGSGMEDTKKLE |
| Ga0207691_116363561 | 3300025940 | Miscanthus Rhizosphere | MLKKINNIFELKGIFVFSHLQFNGVRAQTDGSGMDD |
| ⦗Top⦘ |