| Basic Information | |
|---|---|
| Family ID | F035993 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 171 |
| Average Sequence Length | 45 residues |
| Representative Sequence | ALVTHLLGRQQPLKEVDIEKLLLARTKYFGAKIAAAMPLPRSPQKVS |
| Number of Associated Samples | 150 |
| Number of Associated Scaffolds | 171 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.58 % |
| % of genes near scaffold ends (potentially truncated) | 98.83 % |
| % of genes from short scaffolds (< 2000 bps) | 85.38 % |
| Associated GOLD sequencing projects | 137 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.906 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (8.772 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.146 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.386 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.33% β-sheet: 8.00% Coil/Unstructured: 62.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 171 Family Scaffolds |
|---|---|---|
| PF00593 | TonB_dep_Rec | 54.97 |
| PF13620 | CarboxypepD_reg | 4.09 |
| PF07715 | Plug | 4.09 |
| PF02911 | Formyl_trans_C | 3.51 |
| PF11146 | DUF2905 | 2.34 |
| PF00128 | Alpha-amylase | 1.17 |
| PF09286 | Pro-kuma_activ | 1.17 |
| PF01902 | Diphthami_syn_2 | 1.17 |
| PF01327 | Pep_deformylase | 0.58 |
| PF13505 | OMP_b-brl | 0.58 |
| PF12704 | MacB_PCD | 0.58 |
| PF00069 | Pkinase | 0.58 |
| PF02517 | Rce1-like | 0.58 |
| PF01497 | Peripla_BP_2 | 0.58 |
| PF13742 | tRNA_anti_2 | 0.58 |
| PF00248 | Aldo_ket_red | 0.58 |
| PF03692 | CxxCxxCC | 0.58 |
| PF04264 | YceI | 0.58 |
| PF01740 | STAS | 0.58 |
| PF04191 | PEMT | 0.58 |
| PF08818 | DUF1801 | 0.58 |
| PF00596 | Aldolase_II | 0.58 |
| PF13570 | PQQ_3 | 0.58 |
| PF00903 | Glyoxalase | 0.58 |
| PF08281 | Sigma70_r4_2 | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 171 Family Scaffolds |
|---|---|---|---|
| COG0223 | Methionyl-tRNA formyltransferase | Translation, ribosomal structure and biogenesis [J] | 3.51 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.34 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 1.17 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 1.17 |
| COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 1.17 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 1.17 |
| COG2102 | Diphthamide synthase (EF-2-diphthine--ammonia ligase) | Translation, ribosomal structure and biogenesis [J] | 1.17 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 1.17 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.58 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.58 |
| COG4607 | ABC-type enterochelin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.58 |
| COG4594 | ABC-type Fe3+-citrate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.58 |
| COG4592 | ABC-type Fe2+-enterobactin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.58 |
| COG4558 | ABC-type hemin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.58 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.58 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.58 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.58 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.58 |
| COG0614 | ABC-type Fe3+-hydroxamate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.58 |
| COG0242 | Peptide deformylase | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.91 % |
| Unclassified | root | N/A | 4.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001546|JGI12659J15293_10042866 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300004080|Ga0062385_10015373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2743 | Open in IMG/M |
| 3300004080|Ga0062385_10220396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1038 | Open in IMG/M |
| 3300004080|Ga0062385_10395519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 824 | Open in IMG/M |
| 3300004080|Ga0062385_10476282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 765 | Open in IMG/M |
| 3300004082|Ga0062384_100022096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2723 | Open in IMG/M |
| 3300004091|Ga0062387_100040649 | All Organisms → cellular organisms → Bacteria | 2148 | Open in IMG/M |
| 3300004092|Ga0062389_104036830 | Not Available | 551 | Open in IMG/M |
| 3300004152|Ga0062386_100082425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 2456 | Open in IMG/M |
| 3300004152|Ga0062386_101318183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 601 | Open in IMG/M |
| 3300004635|Ga0062388_100693986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 949 | Open in IMG/M |
| 3300005437|Ga0070710_10570339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
| 3300005439|Ga0070711_100486809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1015 | Open in IMG/M |
| 3300005533|Ga0070734_10246905 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300005534|Ga0070735_10001540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 22170 | Open in IMG/M |
| 3300005541|Ga0070733_11231098 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300005542|Ga0070732_10926773 | Not Available | 532 | Open in IMG/M |
| 3300005587|Ga0066654_10829154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 527 | Open in IMG/M |
| 3300005591|Ga0070761_10078462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1880 | Open in IMG/M |
| 3300005602|Ga0070762_10017535 | All Organisms → cellular organisms → Bacteria | 3687 | Open in IMG/M |
| 3300005610|Ga0070763_10367174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 804 | Open in IMG/M |
| 3300005712|Ga0070764_10230331 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300005921|Ga0070766_11055073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300006028|Ga0070717_11738293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300006102|Ga0075015_100094035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1495 | Open in IMG/M |
| 3300006163|Ga0070715_10023455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2418 | Open in IMG/M |
| 3300006954|Ga0079219_10229810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1082 | Open in IMG/M |
| 3300009012|Ga0066710_104549599 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 518 | Open in IMG/M |
| 3300009089|Ga0099828_11294872 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300009090|Ga0099827_10199741 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1662 | Open in IMG/M |
| 3300009090|Ga0099827_10468999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1080 | Open in IMG/M |
| 3300009143|Ga0099792_10738029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300009547|Ga0116136_1004966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5543 | Open in IMG/M |
| 3300009623|Ga0116133_1193965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300009628|Ga0116125_1187974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300009698|Ga0116216_10113093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1671 | Open in IMG/M |
| 3300009759|Ga0116101_1158572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300010048|Ga0126373_13121228 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300010049|Ga0123356_12519098 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300010343|Ga0074044_10905377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300010366|Ga0126379_12721629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300010376|Ga0126381_100480244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1749 | Open in IMG/M |
| 3300010376|Ga0126381_103409361 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300010398|Ga0126383_10174407 | All Organisms → cellular organisms → Bacteria | 2035 | Open in IMG/M |
| 3300010876|Ga0126361_10898350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1630 | Open in IMG/M |
| 3300010937|Ga0137776_1438462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 865 | Open in IMG/M |
| 3300012469|Ga0150984_117526562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1069 | Open in IMG/M |
| 3300012683|Ga0137398_10041378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2680 | Open in IMG/M |
| 3300012971|Ga0126369_10327144 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
| 3300014164|Ga0181532_10664073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300014165|Ga0181523_10777418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300014167|Ga0181528_10156774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1231 | Open in IMG/M |
| 3300014201|Ga0181537_10044581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3014 | Open in IMG/M |
| 3300014201|Ga0181537_10891656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300014489|Ga0182018_10397021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
| 3300014489|Ga0182018_10427563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
| 3300014495|Ga0182015_10289086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1074 | Open in IMG/M |
| 3300014501|Ga0182024_10860381 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300014655|Ga0181516_10265598 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300014655|Ga0181516_10406046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300014657|Ga0181522_10628958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300015265|Ga0182005_1173352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300015372|Ga0132256_102558757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300016357|Ga0182032_10562460 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300016387|Ga0182040_10706660 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300017937|Ga0187809_10376617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300017942|Ga0187808_10542257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300017955|Ga0187817_10676358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300017961|Ga0187778_11266571 | Not Available | 518 | Open in IMG/M |
| 3300017966|Ga0187776_10488723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 840 | Open in IMG/M |
| 3300017970|Ga0187783_10940363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300017975|Ga0187782_10011202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6575 | Open in IMG/M |
| 3300017995|Ga0187816_10451234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300018001|Ga0187815_10234914 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300018006|Ga0187804_10563815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300018018|Ga0187886_1364800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300018034|Ga0187863_10009933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6233 | Open in IMG/M |
| 3300018062|Ga0187784_10208690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1593 | Open in IMG/M |
| 3300018085|Ga0187772_11140569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 573 | Open in IMG/M |
| 3300018086|Ga0187769_10142445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1751 | Open in IMG/M |
| 3300019786|Ga0182025_1221799 | All Organisms → cellular organisms → Bacteria | 2466 | Open in IMG/M |
| 3300020581|Ga0210399_11607271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300020583|Ga0210401_11409489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300021046|Ga0215015_10644345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300021088|Ga0210404_10357147 | Not Available | 812 | Open in IMG/M |
| 3300021180|Ga0210396_10175064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1922 | Open in IMG/M |
| 3300021180|Ga0210396_10398196 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300021358|Ga0213873_10237233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300021401|Ga0210393_10484287 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300021404|Ga0210389_10369937 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300021405|Ga0210387_10035872 | All Organisms → cellular organisms → Bacteria | 3933 | Open in IMG/M |
| 3300021420|Ga0210394_11043018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
| 3300021433|Ga0210391_10172551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1702 | Open in IMG/M |
| 3300021478|Ga0210402_10017226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6196 | Open in IMG/M |
| 3300021559|Ga0210409_10380256 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300022510|Ga0242652_1050937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300022515|Ga0224546_1020481 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300025414|Ga0208935_1006489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1648 | Open in IMG/M |
| 3300025898|Ga0207692_11194703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300025905|Ga0207685_10015018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2441 | Open in IMG/M |
| 3300025911|Ga0207654_10329560 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300025928|Ga0207700_11219464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300026078|Ga0207702_10058375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3284 | Open in IMG/M |
| 3300027064|Ga0208724_1011116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 865 | Open in IMG/M |
| 3300027439|Ga0209332_1016374 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
| 3300027516|Ga0207761_1057272 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300027528|Ga0208985_1045623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 852 | Open in IMG/M |
| 3300027575|Ga0209525_1086113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 749 | Open in IMG/M |
| 3300027629|Ga0209422_1094596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
| 3300027676|Ga0209333_1012443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2507 | Open in IMG/M |
| 3300027696|Ga0208696_1035389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1797 | Open in IMG/M |
| 3300027738|Ga0208989_10080262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1116 | Open in IMG/M |
| 3300027745|Ga0209908_10112728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
| 3300027745|Ga0209908_10123603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300027783|Ga0209448_10321734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300027829|Ga0209773_10029170 | All Organisms → cellular organisms → Bacteria | 2184 | Open in IMG/M |
| 3300027842|Ga0209580_10307143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
| 3300027842|Ga0209580_10637694 | Not Available | 527 | Open in IMG/M |
| 3300027879|Ga0209169_10195368 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300027884|Ga0209275_10695907 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300027889|Ga0209380_10750141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300027895|Ga0209624_10859163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300027911|Ga0209698_10107219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2332 | Open in IMG/M |
| 3300028020|Ga0265351_1019038 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300028560|Ga0302144_10123733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 834 | Open in IMG/M |
| 3300028562|Ga0302151_10306347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300028773|Ga0302234_10119769 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300028775|Ga0302231_10365845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300029945|Ga0311330_10794863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300029951|Ga0311371_12381397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300029953|Ga0311343_11055156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300029955|Ga0311342_10069668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3907 | Open in IMG/M |
| 3300030053|Ga0302177_10111568 | All Organisms → cellular organisms → Bacteria | 1573 | Open in IMG/M |
| 3300030494|Ga0310037_10246953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 776 | Open in IMG/M |
| 3300030738|Ga0265462_12067703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300030743|Ga0265461_12946568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300030746|Ga0302312_10071713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1474 | Open in IMG/M |
| 3300030878|Ga0265770_1072052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300030906|Ga0302314_11160473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300031128|Ga0170823_13781058 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300031231|Ga0170824_112173774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
| 3300031231|Ga0170824_119462302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300031241|Ga0265325_10155770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1078 | Open in IMG/M |
| 3300031258|Ga0302318_10481485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300031446|Ga0170820_14945938 | Not Available | 507 | Open in IMG/M |
| 3300031708|Ga0310686_111862508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 734 | Open in IMG/M |
| 3300031708|Ga0310686_118967992 | Not Available | 586 | Open in IMG/M |
| 3300031708|Ga0310686_119489219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1041 | Open in IMG/M |
| 3300031715|Ga0307476_10204031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1435 | Open in IMG/M |
| 3300031715|Ga0307476_10703046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 748 | Open in IMG/M |
| 3300031715|Ga0307476_10994855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300031718|Ga0307474_10851687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300031718|Ga0307474_11393815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300031754|Ga0307475_11098961 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300031823|Ga0307478_10081947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2465 | Open in IMG/M |
| 3300031823|Ga0307478_10137135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1932 | Open in IMG/M |
| 3300031823|Ga0307478_10327332 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300032001|Ga0306922_12207684 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300032160|Ga0311301_12855243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300032174|Ga0307470_10324018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1056 | Open in IMG/M |
| 3300032180|Ga0307471_103079875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300032782|Ga0335082_10631503 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300032782|Ga0335082_11151631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300032783|Ga0335079_10471358 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
| 3300032805|Ga0335078_10481287 | All Organisms → cellular organisms → Bacteria | 1601 | Open in IMG/M |
| 3300032892|Ga0335081_10293131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2161 | Open in IMG/M |
| 3300032893|Ga0335069_10126198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3198 | Open in IMG/M |
| 3300032898|Ga0335072_10568199 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300033134|Ga0335073_11494624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300033405|Ga0326727_10810582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300034199|Ga0370514_199887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.77% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 7.02% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.43% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.26% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 4.68% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.68% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.09% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.09% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.51% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.51% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.51% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.51% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.51% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.34% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.34% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.92% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.75% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.75% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.17% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.17% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 1.17% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.17% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.58% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.58% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.58% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.58% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.58% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.58% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.58% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.58% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.58% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.58% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.58% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.58% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.58% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.58% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022515 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 1-5 | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027064 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF003 (SPAdes) | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
| 3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028020 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE4 | Environmental | Open in IMG/M |
| 3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028562 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12659J15293_100428662 | 3300001546 | Forest Soil | RQQPLSGVDIEKLLLARTKYFGGKMAKAMPMAIVREPEKVS* |
| Ga0062385_100153731 | 3300004080 | Bog Forest Soil | QIALVTHLLGRQQPLSGVDIEKLMLARTKYFGGKMAASMMPMAIVREPEKVS* |
| Ga0062385_102203961 | 3300004080 | Bog Forest Soil | HFAQIALVTHLLGRQQPLSGVDIEKLMLARTKYFGGKITASMMPIAIVREPEKVS* |
| Ga0062385_103955191 | 3300004080 | Bog Forest Soil | GRQQPLTGVDIQKLILARTKYFGGKMSGALPIAMVRPPEKVS* |
| Ga0062385_104762822 | 3300004080 | Bog Forest Soil | QIALVTHLLGRQQPLSGVDIEKLLLARTKYFGGKMVASMPIAMVRPPEKAS* |
| Ga0062384_1000220962 | 3300004082 | Bog Forest Soil | HFAQIALVTHLLGRQQPLSGVDIEKLMLARTKYFGGKMAASMMPMAIVREPEKVS* |
| Ga0062387_1000406493 | 3300004091 | Bog Forest Soil | LLGRQQPLTGVDIEKLMLARSKYFGGKMNASMPIALVREPEKVS* |
| Ga0062389_1040368301 | 3300004092 | Bog Forest Soil | IALVTHLLGRQQPLKQGEIEKLMQARTKYFGAKIASCMPAFARAPQKVS* |
| Ga0062386_1000824251 | 3300004152 | Bog Forest Soil | EHFAQIALVTHLLGRQQPLKEVEIEKLLVARTRYFGAKIASAIPLPRAPQKVS* |
| Ga0062386_1013181831 | 3300004152 | Bog Forest Soil | EHFAQIALVTHLLGRQQPLKEVEIEKLLLARTKYFGAKIAAAMPLPRAPQKVS* |
| Ga0062388_1006939861 | 3300004635 | Bog Forest Soil | HFAQIALVTHLLGRQQPLKEVEIEKLLLARTKYFGAKMASAMPLPRIPQKVS* |
| Ga0070710_105703392 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | LVTHMLGRQQPLQEREIEKLLLARTKYFGAKNAASMPLPLTRVPEEVS* |
| Ga0070711_1004868092 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | RQQPLEKVDIEKLLTARSKYFGAKIAAAMPLPRAPQKVS* |
| Ga0070734_102469052 | 3300005533 | Surface Soil | LGRQQPLKQVEIDKLLLARTKYFGSKIASTMPQPSMPQKVS* |
| Ga0070735_1000154020 | 3300005534 | Surface Soil | IALVTHLLGRQQPLKQVEIEKLISARTRYFGAKIAATMPIPRAPQKVS* |
| Ga0070733_112310981 | 3300005541 | Surface Soil | VEHFAQIALVTHLLGRQQPLKQVEIEKLMLARTRYFGAKIASAMPLPRVPQKVS* |
| Ga0070732_109267732 | 3300005542 | Surface Soil | LGRQQPLQEGEVEKLLLARVKYFGAKMAASMPLPRARQEVS* |
| Ga0066654_108291541 | 3300005587 | Soil | EHFAQIALVTHLLGRQQPLQEREIEKLILARTKYFGAKNAASMPMPLPRVAGES* |
| Ga0070761_100784621 | 3300005591 | Soil | VEHFAQIALVTHLLGRQQPLSGVDIEKLLLARTKYFGGKMAKAMPMAIVREPEKVS* |
| Ga0070762_100175351 | 3300005602 | Soil | IALVTHLLGRQQPLKEVEIEKLLLARTKYFGAKIAAAMPLPNSPQKVS* |
| Ga0070763_103671741 | 3300005610 | Soil | QIALVTHLLGRQQPLSGVDIEKLLLARTKYFGGKMAKAMPMAIVREPEKVS* |
| Ga0070764_102303311 | 3300005712 | Soil | LLGRQQPLTGVDIEKLLLARSKYFGGKMAASMPIEMVRPPEKVS* |
| Ga0070766_110550732 | 3300005921 | Soil | THLLGRQKPLKDVDIEKLLLARTKYFGAKIAAAMPLPRAPQKVS* |
| Ga0070717_117382931 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | QIALVTHLLGRQQPLQQVEIDKLLSARTKYFGAKLAAAMPIPRAPQKVS* |
| Ga0075015_1000940351 | 3300006102 | Watersheds | LQKVEIDKLLLARTKYFGAKLAASMPIPRVPQKVS* |
| Ga0070715_100234552 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LLGRQQPLQQVEIEKLLNARTKYFGAKLAATLPLPRIPQKVS* |
| Ga0079219_102298102 | 3300006954 | Agricultural Soil | ISLVTHLLGRQQPLQEREIEKLLLARTKYFGAKNAASMPLPLPRVPEEAS* |
| Ga0066710_1045495992 | 3300009012 | Grasslands Soil | AQIALVTHLLGRQQPLKDVDIEKLLLARTKYFGAKIAASMPLPRDPQKVS |
| Ga0099828_112948721 | 3300009089 | Vadose Zone Soil | GVDVEKLLLARTKYFGGKMAASMPIAMVRPPEKVS* |
| Ga0099827_101997411 | 3300009090 | Vadose Zone Soil | LGRQQPLKEVDIEKLLLARTKYFGAKIAAAMPFPRSPQKVS* |
| Ga0099827_104689992 | 3300009090 | Vadose Zone Soil | AQFSLVTHLLGRQQPLQEREVEKLLLARAKYFGTKMASSMPMPRQPEKVS* |
| Ga0099792_107380291 | 3300009143 | Vadose Zone Soil | HFAQIALVTHLLGRQQPLKEVEIEKLMLARTKYFGAKMASAMPLPRFPQKVS* |
| Ga0116136_10049661 | 3300009547 | Peatland | FAQIALVTHLLGRQQPLTGVDIEKLLLARTKYFGRKMNAAMPMVMAGEPEKVS* |
| Ga0116133_11939652 | 3300009623 | Peatland | VDIEKLLLARTKYFGAKSAASMPIAMARPPEKVS* |
| Ga0116125_11879742 | 3300009628 | Peatland | YLLGRQQPLSGVDIEKLLLARTKYFGGKMAASMPIALVREPEKVS* |
| Ga0116216_101130931 | 3300009698 | Peatlands Soil | THLLGRQQPLKEVEIEKLLLARSKYFGARIAAAMPLPRAPQKVS* |
| Ga0116101_11585721 | 3300009759 | Peatland | QIALVTHLLGRQQPLSGVDIEKLLLARTKYFGGKVAASMPIALVREPEKVS* |
| Ga0126373_131212282 | 3300010048 | Tropical Forest Soil | LGRQQPLKQVEIEKLLNARTKYFGAKIAATMPLPRMPQKVG* |
| Ga0123356_125190981 | 3300010049 | Termite Gut | HLLGRQQPLKQVEIEKLMIARTKYFGAKIAAALPMPRSPQKVS* |
| Ga0074044_109053772 | 3300010343 | Bog Forest Soil | QIALVTHLLGRQQPLSGVDIEKLMLARTKYFGGKMAASMPIAMVRPPEKVS* |
| Ga0126379_127216291 | 3300010366 | Tropical Forest Soil | KQVEIEKLMLARSKYFGAKIAATLPIPRAPQKVS* |
| Ga0126381_1004802441 | 3300010376 | Tropical Forest Soil | THLLGRQQPLKQVEIEKLLLARTKYFGAKLASSMPMPGIPQKVS* |
| Ga0126381_1034093611 | 3300010376 | Tropical Forest Soil | LLGRQQPLKQVEIEKLLLARTKYFGAKLAATMPLPRAPQKVS* |
| Ga0126383_101744074 | 3300010398 | Tropical Forest Soil | LGRQQPLKQVEIEKLLTARTKYFGAKIAAAMPLPRMPQKVG* |
| Ga0126361_108983501 | 3300010876 | Boreal Forest Soil | IALVTHLLGRQQPLKEVEIEKLLLARTKYFGAKIAAAMPLPNSPEKVS* |
| Ga0137776_14384621 | 3300010937 | Sediment | FAQIALVTHLLGRQQPLKQVEIEKLMMARSKYFGAKIAATMPMPRAPQKVS* |
| Ga0150984_1175265621 | 3300012469 | Avena Fatua Rhizosphere | ALVTHLLGRQQPLKEREIEKLLLARTKYFGAKNAASMPVPLPRVPEKFS* |
| Ga0137398_100413782 | 3300012683 | Vadose Zone Soil | QQPLSGVDVEKLLLARTKYFGGKMAASMPITMVRPPEKVS* |
| Ga0126369_103271442 | 3300012971 | Tropical Forest Soil | LGRQQPLQQVEIEKLLNARTKYFGAKLAATLPLPRIPQKVS* |
| Ga0181532_106640732 | 3300014164 | Bog | VTHLLGRQQPLTGVDIEKLLLARTKYFGGKMNASMPMAVTREPEKVS* |
| Ga0181523_107774182 | 3300014165 | Bog | VEHFAQIALVTHLLGRQQPLTGVDIEKLLLARTKYFGGKMNASMPMAVTREPEKVS* |
| Ga0181528_101567742 | 3300014167 | Bog | PLKQVEIEKLMLARTKYFGAKIASAMPLPREPQKVS* |
| Ga0181537_100445812 | 3300014201 | Bog | AQIALVTHLLGRQQPLKQVEIEKLMLARTKYFGAKIASAMPLPREPQKVS* |
| Ga0181537_108916561 | 3300014201 | Bog | GRQQPLSVVEIEKLMLARTKYFGQKIAASMPVAMARPPEKVS* |
| Ga0182018_103970212 | 3300014489 | Palsa | LVTHLLGKQQPLTGVDIEKLLLARTKYFGGKVNAAMPMVMAGPPEKVS* |
| Ga0182018_104275631 | 3300014489 | Palsa | HLLGRQQPLTGVDIEKLLLARTKYFGGKMAASMPIAMVREPEKVS* |
| Ga0182015_102890862 | 3300014495 | Palsa | ALVTHLLGRQQPLTGVDIEKLLLARTKYFGGKMAAAMPMPMAMVREPEKVS* |
| Ga0182024_108603812 | 3300014501 | Permafrost | ALVTHLLGRQQPLKEVEIEKLLMARTKYFGAKIAACMPLPRTPQKVS* |
| Ga0181516_102655982 | 3300014655 | Bog | QPLKEVEIEKLLLARTKYFGAKIAAAMPLPRFPQKVS* |
| Ga0181516_104060461 | 3300014655 | Bog | HLLGRQQPLKQVEIEKLMLARTKYFGAKIASAMPLPREPQKVS* |
| Ga0181522_106289582 | 3300014657 | Bog | QPLSGVDIEKLMLARTKYFGGKMAASMMPMAIVREPEKVS* |
| Ga0182005_11733522 | 3300015265 | Rhizosphere | VTHLLGRQQPLKEGEIEKLLLARTKYFGAKNAASMPVPLPRAPEKFS* |
| Ga0132256_1025587572 | 3300015372 | Arabidopsis Rhizosphere | VEHFAQIALVTHLLGRQQPLKDVDIEKLLLARTKYFGAKIAASMPLPRDPQKIS* |
| Ga0182032_105624602 | 3300016357 | Soil | VHEDGDRGAFRAIALVTHLLGKQQPLKQVEIEKLLTARTKYFGAKIAAAMPLPRMPQKVG |
| Ga0182040_107066601 | 3300016387 | Soil | QQPLKQVEIEKLLTARTKYFGAKIAAAMPLPRMPQKVG |
| Ga0187809_103766172 | 3300017937 | Freshwater Sediment | LLGRQQPLKQVEIDKLLSARTKYFGAKLAASMPMPREPQKVS |
| Ga0187808_105422572 | 3300017942 | Freshwater Sediment | GRQQPLQEGEIEKLILARSKYFGAKLAASMPIPRMPVKVS |
| Ga0187817_106763582 | 3300017955 | Freshwater Sediment | FAQIALVTHLLGRQQPLKQVEIEKLMTARTRYFGAKIAAGLPLPRVPQKVS |
| Ga0187778_112665711 | 3300017961 | Tropical Peatland | ALVTHLLGRQQPLKQVEIEKLLLARTKYFGTKIAAAMPIPREPQKVS |
| Ga0187776_104887232 | 3300017966 | Tropical Peatland | VEHFAQVALVTHLLGHQQPLKEVEIEKLLLARTRYFGSKVAAAMPLPLVPEKVS |
| Ga0187783_109403632 | 3300017970 | Tropical Peatland | FAQIALVTHLLGRQQPLKQVEIEKLLLARTKYFGAKLAATMPLPRAPQKVS |
| Ga0187782_100112025 | 3300017975 | Tropical Peatland | GRQQPLKEVEIEKLMLARTKYFGAKIAAALPIPRAPQKVS |
| Ga0187816_104512342 | 3300017995 | Freshwater Sediment | IALVTHLLGRQQPLQEGEIEKLILARSKYFGAKLAASMPIPRMPVKVS |
| Ga0187815_102349142 | 3300018001 | Freshwater Sediment | VTHLLGRQQPLNKSEVEKLVLARIKYFGTKAAASLPLPEAPQEVG |
| Ga0187804_105638151 | 3300018006 | Freshwater Sediment | LLGRQQPLKQVEIEKLMLARTRYFGAKIAAALPMPRAPQKVS |
| Ga0187886_13648002 | 3300018018 | Peatland | LGRQQPLTGVDIQKLLLARTKYFGGKMAAAMPMAMVREPEKVS |
| Ga0187863_100099336 | 3300018034 | Peatland | EHFAQIALVTHLLGQQQPLKQVEIEKLMLARTKYFGAKIASAMPLPREPQKVS |
| Ga0187784_102086904 | 3300018062 | Tropical Peatland | GRQQPLSGVDIEKLMQARTKYFGKMPAALMPVVMARPPEKAS |
| Ga0187772_111405691 | 3300018085 | Tropical Peatland | AQIALVTHLLGRQQPLQAVEIEKLLLARTKYFGTKIASSLPLPQVPEKVS |
| Ga0187769_101424451 | 3300018086 | Tropical Peatland | HFEQIALVTHLLGRQQPLKEVEIEKLMLARTKYFGAKIAAALPIPRAPQKVS |
| Ga0182025_12217993 | 3300019786 | Permafrost | LTGVDVEKLMLARTKYFGGKMTASLPMAMVREPEKVS |
| Ga0210399_116072711 | 3300020581 | Soil | IALVTHLLGRQQPLQEVEVQKLLVARAKYFGSKMASSMPLPLHTSPEKAS |
| Ga0210401_114094891 | 3300020583 | Soil | IALVTHLLGRQQPLNEVEVEKLLLARTKYFGTKAATSVPLPRVPQEVS |
| Ga0215015_106443451 | 3300021046 | Soil | IALVTHLLGRQQPLGEDEVEKLLLASARYFGAKMAASMPVPASPSPDKAS |
| Ga0210404_103571472 | 3300021088 | Soil | LKEVEIEKLLLARTKYFGAKMAASMPLPRAPQKVS |
| Ga0210396_101750642 | 3300021180 | Soil | LGRQQPLSGVDIEKLMLARTKYFGGKMAASMPIAMVREPEKVS |
| Ga0210396_103981961 | 3300021180 | Soil | IALVTHLLGRQQPLSGVDIEKLLLARTKYFGGKMAKAMPMAIVREPEKVS |
| Ga0213873_102372331 | 3300021358 | Rhizosphere | EHFAQIALVTHLLGKQQPLSGVDIEKLLSARTKYFGKMTASLMPVLMTRPPEKAS |
| Ga0210393_104842872 | 3300021401 | Soil | LLGRQQPLTGVDVEKLMLARTKYFGGKMTASLPMALVREPGKVS |
| Ga0210389_103699372 | 3300021404 | Soil | GVDIEKLLLARTKYFGGKMAAAMPMPMAMVREPEKVS |
| Ga0210387_100358724 | 3300021405 | Soil | GRQQPLKEVEIEKLLLARTKYFGAKIAAAMPLPNSPEKVS |
| Ga0210394_110430181 | 3300021420 | Soil | QIALVTHLLGRQQPLQEVEVQKLLVARAKYFGSKMASSMPLPLHSPPEKAS |
| Ga0210391_101725511 | 3300021433 | Soil | PLSGVDIEKLLLARTKYFGGKMSASMPIAMARPPEKVS |
| Ga0210402_100172261 | 3300021478 | Soil | QPLKQVEIEKLLNARTKYFGAKIAAAMPLPRVPQKVS |
| Ga0210409_103802561 | 3300021559 | Soil | HFAQIALVTHLLGRQQPLKEVEIEKLLLARTKYFGAKIAAAMPLPNSPEKVS |
| Ga0242652_10509372 | 3300022510 | Soil | THLLGRQQPLKQVEIEKLLNARTKYFGAKIAAAMPLPRVPQKVS |
| Ga0224546_10204812 | 3300022515 | Soil | LLGRQQPLTGVDIEKLLLARSKYFGGKMAASMPIEMVRPPEKVS |
| Ga0208935_10064892 | 3300025414 | Peatland | LLGRQQPLTGVDIEKLLLARTKYFGAKSAASMPIAMARPPEKVS |
| Ga0207692_111947031 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | EHFAQISLVTHMLGRQQPLQEREIEKLLLARTKYFGAKNAASMPLPLTRVPEEVS |
| Ga0207685_100150181 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | THLLGRQQPLQQVEIEKLLNARTKYFGAKLAATLPLPRIPQKVS |
| Ga0207654_103295602 | 3300025911 | Corn Rhizosphere | KEREIEKLLLARTKYFGAKNAASMPLPLPRVPEEAS |
| Ga0207700_112194641 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | QPLQEREIEKLLLARTKYFGAKNAASMPLPLPRVPEEAS |
| Ga0207702_100583753 | 3300026078 | Corn Rhizosphere | VEHFAQIALVTHLLGRQQPLKEREIEKLLLARTKYFGAKNAASMPVPLSRAPEKFS |
| Ga0208724_10111161 | 3300027064 | Forest Soil | HFAQIALVTHLLGRQQPLSGVDIEKLMLARTKYFGGKMAASMMPMAIVREPEKVS |
| Ga0209332_10163741 | 3300027439 | Forest Soil | SGVDIEKLLLARTKYFGGKAAASMPIAMVRPPEKVS |
| Ga0207761_10572722 | 3300027516 | Tropical Forest Soil | THLLGRQQPLKQVEIEKLLSARTKYFGAKIAAAMPLPRVPQKVG |
| Ga0208985_10456232 | 3300027528 | Forest Soil | FAQIALVTHLLGRQQPLKQGEIEKLMQARTKYFGAKIASCMPAFARAPQKVS |
| Ga0209525_10861132 | 3300027575 | Forest Soil | HLLGRQQPLKEVEIEKLLMARTKYFGAKIAACMPLPRSPQKVS |
| Ga0209422_10945962 | 3300027629 | Forest Soil | QIALVTHLLGRQQPLKDVEIEKLLMARTKYFGAKIASCMPLPPSPQKAS |
| Ga0209333_10124432 | 3300027676 | Forest Soil | QQPLTGLDIEKLLLARSKYFGGKMAASMPMAMVRPPEKVS |
| Ga0208696_10353891 | 3300027696 | Peatlands Soil | RQQPLNGIEVEKLLSARTKYFGAKLAAALPLPMMRPPEKAS |
| Ga0208989_100802621 | 3300027738 | Forest Soil | GHFAQIALVTHLLGRQQPLGEDEVEKLLLARAKYFGAKMAASMPVPVGPSPDKAS |
| Ga0209908_101127282 | 3300027745 | Thawing Permafrost | VGGEMCIRDSLLGRQQPLTGIDIEKLLLARTKYFGGKMAASMPMAMVRPPEKVS |
| Ga0209908_101236032 | 3300027745 | Thawing Permafrost | LVTHLLGRQQPLKEVEIEKLLMARTKYFGAKIAAGMPLPRTPQKVS |
| Ga0209448_103217341 | 3300027783 | Bog Forest Soil | LGRQQPLSGVDIEKLMLARTKYFGGKMAASMMPMAIVREPEKVS |
| Ga0209773_100291701 | 3300027829 | Bog Forest Soil | LLGRQQPLTGVDIEKLMLARSKYFGGKMNASMPIALVREPEKVS |
| Ga0209580_103071432 | 3300027842 | Surface Soil | QQPLQEVEIEKLLLARTKYFGKNAAPMPLPRAPQKVS |
| Ga0209580_106376941 | 3300027842 | Surface Soil | LGRQQPLQEGEVEKLLLARVKYFGAKMAASMPLPRARQEVS |
| Ga0209169_101953682 | 3300027879 | Soil | THLLGRQQPLTGVDIEKLLLARSKYFGGKMAASMPIEMVRPPEKVS |
| Ga0209275_106959072 | 3300027884 | Soil | LGRQQPLTGVDIEKLLLARSKYFGGKMAASMPIEMVRPPEKVS |
| Ga0209380_107501411 | 3300027889 | Soil | GVDIEKLMLARTKYFGGKMSASMPIAMVREPEKVS |
| Ga0209624_108591631 | 3300027895 | Forest Soil | QIALVTHLLGRQQPLQEGEIEKLMLARTKYFGAKIAACMPLPGSRQKVS |
| Ga0209698_101072192 | 3300027911 | Watersheds | QQPLKQVEIEKLLNARTKYFGAKIAAAMPLPRAPQKVS |
| Ga0265351_10190382 | 3300028020 | Soil | QQPLSGVDIEKLLLARTKYFGAKMAASLPMAMVREPEKVS |
| Ga0302144_101237331 | 3300028560 | Bog | LLGRQQPLTGVDIEKLLLARTKYFGGKMAASMPIALVREPEKVS |
| Ga0302151_103063471 | 3300028562 | Bog | QQPLTGVDIEKLLLARTKYFGGKMAASMPIALVREPEKVS |
| Ga0302234_101197691 | 3300028773 | Palsa | ALVTHLLGRQQPLTGLDIEKLLLARSKYFGGKMAASMPMAMVRPPEKVS |
| Ga0302231_103658451 | 3300028775 | Palsa | FAQIALVTHLLGRQQPLTGLDIEKLLLARSKYFGGKMAASMPMAMVRPPEKVS |
| Ga0311330_107948632 | 3300029945 | Bog | HFAQIALVTHLLGRQQPLSGVDVEKLMLARTKYFGGKMTASMPMAMVGEPEKVS |
| Ga0311371_123813972 | 3300029951 | Palsa | RQQPLQEVEIEKLLLARTKYFGAKMASSMPLPRIPQKVS |
| Ga0311343_110551561 | 3300029953 | Bog | QIALVTHLLGRQQPLSGVDIEKLMLARTKYFGGKIAASMPITMVREPEKVS |
| Ga0311342_100696686 | 3300029955 | Bog | TGVDIQKLLLARTKYFGGKVAASMPIALVREPEKVS |
| Ga0302177_101115681 | 3300030053 | Palsa | THLLGRQQPLTGVDIEKLLLARTKYFGGKMAASMPIAMVREPEKVS |
| Ga0310037_102469532 | 3300030494 | Peatlands Soil | LGRQQPLKEVEIEKLLLARSKYFGARIAAAMPLPRAPQKVS |
| Ga0265462_120677031 | 3300030738 | Soil | HFAQIALVTHLLGRQQPLTGVDIEKLLLARTKYFGGKMAAAMPMPMAMVREPEKVS |
| Ga0265461_129465681 | 3300030743 | Soil | LVTHLLGRQQPLTGVDIEKLMLARTKYFGGKMATSMPIAMVRPPEKVS |
| Ga0302312_100717132 | 3300030746 | Palsa | HLLGRQQPLTGVDVEKLLLARTKYFGGKMAASLPMAMVREPEKVS |
| Ga0265770_10720521 | 3300030878 | Soil | EHFAQIALVTHLLGRQQPLSGVDIEKLMLARTKYFGGKMSASMMPMAIVREPEKVS |
| Ga0302314_111604731 | 3300030906 | Palsa | QQPLSGVDIEKLLLARTKYFGGKMAASMPISLVREPEKVS |
| Ga0170823_137810582 | 3300031128 | Forest Soil | GVDIEKLMVARTKYFGGKVTASIPLPMALVRPPEKVS |
| Ga0170824_1121737742 | 3300031231 | Forest Soil | VTHLLGRQQPLKEVDIEKLLLARTKYFGAKIADAMPFPRSPQKVS |
| Ga0170824_1194623022 | 3300031231 | Forest Soil | HLLGRQQPLKQGEIEKLMLARTKYFGAKAASCMPVARAPQKVS |
| Ga0265325_101557703 | 3300031241 | Rhizosphere | ALVTHLLGRQQPLKEVDIEKLLLARTKYFGAKIAAAMPLPRSPQKVS |
| Ga0302318_104814852 | 3300031258 | Bog | AQIALVTHLLGQQQPLSGVDVEKLMLARTKYFGGKMNASMPMAMVGEPEKVS |
| Ga0170820_149459382 | 3300031446 | Forest Soil | AQIALVTHLLGRQQPLKEVDIEKLLLARTKYFGAKIAAAMPFPRSPQKVS |
| Ga0310686_1118625081 | 3300031708 | Soil | LLGRQQPLTGVDIEKLLLARTKYFGGKAAASMPIAMVREPEKVS |
| Ga0310686_1189679922 | 3300031708 | Soil | AQIALVTHMLGRQQPLKQVEIDKLLVARTRYFGAKLAASMPIPRAPQKVS |
| Ga0310686_1194892193 | 3300031708 | Soil | LVTHLLGRQQPLSGVEIEKLLLARTKYFSGKMAASMPLAMARPPVKVS |
| Ga0307476_102040312 | 3300031715 | Hardwood Forest Soil | QQPLKEGEIEKLLLARSKYFGAKLAASMPLPRAPQKVS |
| Ga0307476_107030461 | 3300031715 | Hardwood Forest Soil | PLKEGEIEKLLLARSKYFGAKLAASMPLPRAPQKVS |
| Ga0307476_109948552 | 3300031715 | Hardwood Forest Soil | PLSGVDIEKLLLARTKYFGGKIAAPMPIAMVRPPEKVS |
| Ga0307474_108516871 | 3300031718 | Hardwood Forest Soil | HFAQIALVTHLLGRQQPLSGVDIEKLLLARTKYFGGKMAKAMPMAIVREPEKVS |
| Ga0307474_113938152 | 3300031718 | Hardwood Forest Soil | GVDIEKLLLARTKYFGGKLAAALPMAMARTPEKAS |
| Ga0307475_110989612 | 3300031754 | Hardwood Forest Soil | VTHLLGRQQPLQEVEVEKLLLARAKYFGAKMAASMPLPQRSSPEKAS |
| Ga0307478_100819471 | 3300031823 | Hardwood Forest Soil | THLLGRQQPLTGVDIEKLLLARTKYFGGKLAAALPMAMARTPEKAS |
| Ga0307478_101371354 | 3300031823 | Hardwood Forest Soil | AQIALVTHLLGRQQPLSGVDIEKLMLARTKYFGGKMAASMPIAMVRPPEKVS |
| Ga0307478_103273321 | 3300031823 | Hardwood Forest Soil | HLLGRQQPLTGVDVEKLLLARTKYFGGKMAASMPMVMVREPEKVS |
| Ga0306922_122076841 | 3300032001 | Soil | THLLGRQQPLKQVEIEKLLNARTKYFGAKIAAAMPLPRMPQKVG |
| Ga0311301_128552431 | 3300032160 | Peatlands Soil | GRQQPLKEVEIEKLLLARTKYFGAKIAAAMPLPRAPQKVS |
| Ga0307470_103240181 | 3300032174 | Hardwood Forest Soil | QIALVTHLLGRQQPLKQVEIEKLLHARTKYFGAKIAAGMPLPRVPQKVS |
| Ga0307471_1030798752 | 3300032180 | Hardwood Forest Soil | LVTHLLGRQQPLKQVEIEKLLNARTKYFGAKIAAAMPLPRAPQKVG |
| Ga0335082_106315032 | 3300032782 | Soil | THLLGRQQPLKQVEIEKLLTARTKYFGAKIAAAMPLPRVPQKVG |
| Ga0335082_111516311 | 3300032782 | Soil | ALVTHLLGRQQPLQEPEVEKLLLARAKYFGAKMAASMPLPLPRQPVKVS |
| Ga0335079_104713581 | 3300032783 | Soil | GRQQPLKEVEIEKLLLARTRYFGAKAAASMPLPQVPEKVS |
| Ga0335078_104812873 | 3300032805 | Soil | PLKQVEIEKLLNARTKYFGAKIAATMPIPRAPQKVS |
| Ga0335081_102931311 | 3300032892 | Soil | QPLNGVEVEKLLSARTKYFGAKLAASLPLPLMRSPEKAS |
| Ga0335069_101261981 | 3300032893 | Soil | GRQQPLQQVEIDKLLSARTKYFGAKLAAAMPIPRPPQKVS |
| Ga0335072_105681992 | 3300032898 | Soil | IALITHLLGRQQPLKEVEIEKLLLARTKYFGAKIAAAMPLPRAPQKVS |
| Ga0335073_114946242 | 3300033134 | Soil | SGVDIEKLLLARTKYFGGKAAASMPMPMEMVRPPEKVS |
| Ga0326727_108105822 | 3300033405 | Peat Soil | QIALVTHLLGRQQPLKEVEIEKLLLARTKYFGAKIAAAMPLPRAPQKVS |
| Ga0370514_199887_10_162 | 3300034199 | Untreated Peat Soil | LVTHLLGRQQPLTGVDIEKLMLARTKYFGGKMAASMPLPMALVRPPEKVS |
| ⦗Top⦘ |