| Basic Information | |
|---|---|
| Family ID | F035983 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 171 |
| Average Sequence Length | 42 residues |
| Representative Sequence | LKTHYNEGSKAIYQGINQILNGRSASSVLPSIQSKLNRILR |
| Number of Associated Samples | 149 |
| Number of Associated Scaffolds | 171 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.66 % |
| % of genes from short scaffolds (< 2000 bps) | 92.40 % |
| Associated GOLD sequencing projects | 140 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.70 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.719 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (19.298 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.240 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.216 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.38% β-sheet: 0.00% Coil/Unstructured: 53.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.70 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 171 Family Scaffolds |
|---|---|---|
| PF00528 | BPD_transp_1 | 45.03 |
| PF00005 | ABC_tran | 0.58 |
| PF13416 | SBP_bac_8 | 0.58 |
| PF01569 | PAP2 | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.72 % |
| Unclassified | root | N/A | 12.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908016|OU_2_1_1_newblercontig05600 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 2170459019|G14TP7Y01D9XIS | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
| 3300000891|JGI10214J12806_11164697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 555 | Open in IMG/M |
| 3300000891|JGI10214J12806_11713642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1183 | Open in IMG/M |
| 3300000956|JGI10216J12902_105180745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 569 | Open in IMG/M |
| 3300000956|JGI10216J12902_105412641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1565 | Open in IMG/M |
| 3300000956|JGI10216J12902_112185913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus | 774 | Open in IMG/M |
| 3300004081|Ga0063454_101647674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 556 | Open in IMG/M |
| 3300004114|Ga0062593_100209845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1562 | Open in IMG/M |
| 3300004114|Ga0062593_101307128 | Not Available | 769 | Open in IMG/M |
| 3300004157|Ga0062590_102025542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 598 | Open in IMG/M |
| 3300004643|Ga0062591_100116418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1774 | Open in IMG/M |
| 3300004643|Ga0062591_100169492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1555 | Open in IMG/M |
| 3300005093|Ga0062594_100664932 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300005171|Ga0066677_10081335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1683 | Open in IMG/M |
| 3300005181|Ga0066678_10109280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1685 | Open in IMG/M |
| 3300005187|Ga0066675_11025987 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005332|Ga0066388_100600400 | All Organisms → cellular organisms → Bacteria | 1723 | Open in IMG/M |
| 3300005332|Ga0066388_103882591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 763 | Open in IMG/M |
| 3300005337|Ga0070682_100099813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1915 | Open in IMG/M |
| 3300005338|Ga0068868_101683447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 597 | Open in IMG/M |
| 3300005344|Ga0070661_100164634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1681 | Open in IMG/M |
| 3300005356|Ga0070674_101161799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 684 | Open in IMG/M |
| 3300005364|Ga0070673_102286506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 514 | Open in IMG/M |
| 3300005434|Ga0070709_10673944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 802 | Open in IMG/M |
| 3300005435|Ga0070714_100207966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1793 | Open in IMG/M |
| 3300005439|Ga0070711_100154313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1734 | Open in IMG/M |
| 3300005440|Ga0070705_101345044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 593 | Open in IMG/M |
| 3300005444|Ga0070694_101260662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus | 621 | Open in IMG/M |
| 3300005456|Ga0070678_102096673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 536 | Open in IMG/M |
| 3300005529|Ga0070741_11595485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus | 535 | Open in IMG/M |
| 3300005534|Ga0070735_10928834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 510 | Open in IMG/M |
| 3300005548|Ga0070665_101975873 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300005552|Ga0066701_10801686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus | 561 | Open in IMG/M |
| 3300005560|Ga0066670_10309576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus | 961 | Open in IMG/M |
| 3300005560|Ga0066670_10941942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 526 | Open in IMG/M |
| 3300005576|Ga0066708_10547113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 746 | Open in IMG/M |
| 3300005587|Ga0066654_10059994 | All Organisms → cellular organisms → Bacteria | 1713 | Open in IMG/M |
| 3300005587|Ga0066654_10226482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus | 979 | Open in IMG/M |
| 3300005618|Ga0068864_101798748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 618 | Open in IMG/M |
| 3300005618|Ga0068864_102061035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 577 | Open in IMG/M |
| 3300005713|Ga0066905_100044794 | All Organisms → cellular organisms → Bacteria | 2657 | Open in IMG/M |
| 3300005842|Ga0068858_100839854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 897 | Open in IMG/M |
| 3300006034|Ga0066656_10856172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 582 | Open in IMG/M |
| 3300006163|Ga0070715_10734589 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300006173|Ga0070716_100927922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 683 | Open in IMG/M |
| 3300006196|Ga0075422_10369378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 629 | Open in IMG/M |
| 3300006358|Ga0068871_100514073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1081 | Open in IMG/M |
| 3300006606|Ga0074062_12744886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 929 | Open in IMG/M |
| 3300006755|Ga0079222_11351086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus | 655 | Open in IMG/M |
| 3300006852|Ga0075433_10545144 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300006881|Ga0068865_100841955 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300009094|Ga0111539_11946959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 682 | Open in IMG/M |
| 3300009098|Ga0105245_11721245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 679 | Open in IMG/M |
| 3300009137|Ga0066709_101610131 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300009174|Ga0105241_11455821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 658 | Open in IMG/M |
| 3300009177|Ga0105248_10475132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1409 | Open in IMG/M |
| 3300009177|Ga0105248_11395460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 793 | Open in IMG/M |
| 3300009545|Ga0105237_11184749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 770 | Open in IMG/M |
| 3300009553|Ga0105249_10535516 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300009792|Ga0126374_11077177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 636 | Open in IMG/M |
| 3300010040|Ga0126308_10485415 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300010043|Ga0126380_10053557 | All Organisms → cellular organisms → Bacteria | 2195 | Open in IMG/M |
| 3300010105|Ga0127470_1019739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 719 | Open in IMG/M |
| 3300010303|Ga0134082_10345431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 629 | Open in IMG/M |
| 3300010304|Ga0134088_10680328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
| 3300010329|Ga0134111_10127834 | Not Available | 993 | Open in IMG/M |
| 3300010337|Ga0134062_10692844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
| 3300010360|Ga0126372_11012424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 843 | Open in IMG/M |
| 3300010371|Ga0134125_12116919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 612 | Open in IMG/M |
| 3300010399|Ga0134127_10058127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3229 | Open in IMG/M |
| 3300010401|Ga0134121_10888107 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300010403|Ga0134123_12600731 | Not Available | 573 | Open in IMG/M |
| 3300011119|Ga0105246_12059537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
| 3300012198|Ga0137364_10509825 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300012212|Ga0150985_103278698 | All Organisms → cellular organisms → Bacteria | 2606 | Open in IMG/M |
| 3300012212|Ga0150985_106503354 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300012360|Ga0137375_11207285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 579 | Open in IMG/M |
| 3300012362|Ga0137361_10603829 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300012469|Ga0150984_100983445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 526 | Open in IMG/M |
| 3300012481|Ga0157320_1024758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 572 | Open in IMG/M |
| 3300012501|Ga0157351_1027172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 645 | Open in IMG/M |
| 3300012532|Ga0137373_10599274 | Not Available | 831 | Open in IMG/M |
| 3300012884|Ga0157300_1056930 | Not Available | 630 | Open in IMG/M |
| 3300012892|Ga0157294_10123052 | Not Available | 692 | Open in IMG/M |
| 3300012895|Ga0157309_10374115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 502 | Open in IMG/M |
| 3300012906|Ga0157295_10189702 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300012907|Ga0157283_10113015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 747 | Open in IMG/M |
| 3300012909|Ga0157290_10038788 | Not Available | 1168 | Open in IMG/M |
| 3300012911|Ga0157301_10318827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → Thermobaculum → Thermobaculum terrenum | 574 | Open in IMG/M |
| 3300012948|Ga0126375_12031004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
| 3300012951|Ga0164300_10607291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 647 | Open in IMG/M |
| 3300012955|Ga0164298_10137682 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300012958|Ga0164299_10594579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 755 | Open in IMG/M |
| 3300012960|Ga0164301_11500727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| 3300012961|Ga0164302_11251249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 596 | Open in IMG/M |
| 3300012972|Ga0134077_10249495 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300012984|Ga0164309_10665969 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300012984|Ga0164309_11634497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
| 3300012986|Ga0164304_10329328 | Not Available | 1058 | Open in IMG/M |
| 3300012989|Ga0164305_11681595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 569 | Open in IMG/M |
| 3300013307|Ga0157372_10580294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1307 | Open in IMG/M |
| 3300013307|Ga0157372_11894706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 685 | Open in IMG/M |
| 3300014969|Ga0157376_12321926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
| 3300015201|Ga0173478_10463513 | Not Available | 625 | Open in IMG/M |
| 3300015371|Ga0132258_10986739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2128 | Open in IMG/M |
| 3300015374|Ga0132255_101557946 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300017792|Ga0163161_11681109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
| 3300017959|Ga0187779_11285357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300018060|Ga0187765_11329188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
| 3300018073|Ga0184624_10179601 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300018482|Ga0066669_10121470 | All Organisms → cellular organisms → Bacteria | 1862 | Open in IMG/M |
| 3300019279|Ga0184642_1182035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
| 3300019279|Ga0184642_1655709 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300019356|Ga0173481_10268000 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300021951|Ga0222624_1617671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
| 3300022694|Ga0222623_10061198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1453 | Open in IMG/M |
| 3300022756|Ga0222622_10344973 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300022886|Ga0247746_1033871 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300023264|Ga0247772_1080757 | Not Available | 693 | Open in IMG/M |
| 3300023266|Ga0247789_1034981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 889 | Open in IMG/M |
| 3300024310|Ga0247681_1030911 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300025908|Ga0207643_10875636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Friedmanniella → Friedmanniella luteola | 582 | Open in IMG/M |
| 3300025917|Ga0207660_10315033 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300025920|Ga0207649_11231319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 592 | Open in IMG/M |
| 3300025921|Ga0207652_10134511 | All Organisms → cellular organisms → Bacteria | 2207 | Open in IMG/M |
| 3300025921|Ga0207652_10442838 | Not Available | 1171 | Open in IMG/M |
| 3300025925|Ga0207650_10673778 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300025927|Ga0207687_11592972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 560 | Open in IMG/M |
| 3300025935|Ga0207709_11066226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 663 | Open in IMG/M |
| 3300025944|Ga0207661_11579798 | Not Available | 600 | Open in IMG/M |
| 3300026035|Ga0207703_11094619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 765 | Open in IMG/M |
| 3300026041|Ga0207639_10244312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1562 | Open in IMG/M |
| 3300026095|Ga0207676_11782862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 614 | Open in IMG/M |
| 3300026121|Ga0207683_10310837 | All Organisms → cellular organisms → Bacteria | 1442 | Open in IMG/M |
| 3300026121|Ga0207683_11371886 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300026142|Ga0207698_11367111 | Not Available | 723 | Open in IMG/M |
| 3300026142|Ga0207698_11949481 | Not Available | 602 | Open in IMG/M |
| 3300026142|Ga0207698_12087409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 580 | Open in IMG/M |
| 3300026326|Ga0209801_1059791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1711 | Open in IMG/M |
| 3300026343|Ga0209159_1061966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1768 | Open in IMG/M |
| 3300026530|Ga0209807_1109800 | Not Available | 1168 | Open in IMG/M |
| 3300027993|Ga0247749_1005724 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300028380|Ga0268265_10169348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1865 | Open in IMG/M |
| 3300028380|Ga0268265_11665998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 643 | Open in IMG/M |
| 3300028713|Ga0307303_10028249 | Not Available | 1112 | Open in IMG/M |
| 3300028715|Ga0307313_10005873 | All Organisms → cellular organisms → Bacteria | 2941 | Open in IMG/M |
| 3300028715|Ga0307313_10054886 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300028720|Ga0307317_10047890 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
| 3300028721|Ga0307315_10091642 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300028768|Ga0307280_10023543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1791 | Open in IMG/M |
| 3300028784|Ga0307282_10049317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1877 | Open in IMG/M |
| 3300028787|Ga0307323_10170657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 786 | Open in IMG/M |
| 3300028799|Ga0307284_10023841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1991 | Open in IMG/M |
| 3300028811|Ga0307292_10060186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → Thermobaculum | 1437 | Open in IMG/M |
| 3300028814|Ga0307302_10050910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1927 | Open in IMG/M |
| 3300028824|Ga0307310_10329046 | Not Available | 748 | Open in IMG/M |
| 3300028828|Ga0307312_10015776 | All Organisms → cellular organisms → Bacteria | 4241 | Open in IMG/M |
| 3300028828|Ga0307312_10062285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2252 | Open in IMG/M |
| 3300031421|Ga0308194_10118555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 783 | Open in IMG/M |
| 3300031562|Ga0310886_10075427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1611 | Open in IMG/M |
| 3300031640|Ga0318555_10775016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
| 3300031847|Ga0310907_10218132 | Not Available | 921 | Open in IMG/M |
| 3300031852|Ga0307410_12058414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
| 3300031938|Ga0308175_102301192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 604 | Open in IMG/M |
| 3300031996|Ga0308176_10113136 | All Organisms → cellular organisms → Bacteria | 2412 | Open in IMG/M |
| 3300032829|Ga0335070_10527803 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300033551|Ga0247830_10586052 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 19.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.09% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.51% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.34% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.34% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.34% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.34% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.92% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.92% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.75% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.75% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.17% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.17% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.17% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.17% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.17% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.17% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.17% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.58% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.58% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.58% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.58% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.58% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.58% |
| Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 0.58% | |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.58% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.58% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.58% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908016 | Sample 642 | Environmental | Open in IMG/M |
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010105 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012389 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012501 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610 | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 | Environmental | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
| 3300023264 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L151-409C-6 | Environmental | Open in IMG/M |
| 3300023266 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4 | Environmental | Open in IMG/M |
| 3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027993 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S199-509C-5 | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| OU_00296990 | 2124908016 | VTRPAKYLKTHYNEGSKDIYQGISQILNGTPAKNVLPGIASKLERLVR | |
| 4MG_01633570 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | LKTHYNEGSKDIYQGINQILNGTPASSVLPGIQSKLQRLVR |
| JGI10214J12806_111646972 | 3300000891 | Soil | SNILGAHYNEGSKAIYQGINQILNGRSASSVLPGVQAKLQRILR* |
| JGI10214J12806_117136421 | 3300000891 | Soil | RPAKFLKTHYNEASKIIYQGINQILNGTPAKSVLPSIQSKLNTLLKK* |
| JGI10216J12902_1051807452 | 3300000956 | Soil | YNEASKVIYQGVNQILNGTPAKNVLPGMQSKLNQIIKQH* |
| JGI10216J12902_1054126413 | 3300000956 | Soil | NEGSKDIYQGISQILNGTPAKTVLPSIASKLQRLVK* |
| JGI10216J12902_1121859132 | 3300000956 | Soil | RPAKFLKTHYNEASKVIYQGVNQILNGTPAKNVLPSVQSKLNQIIK* |
| C688J35102_1184266001 | 3300002568 | Soil | VPRATRPSSALGAKYNEGSKDIYQAISRILNGAKAQSVLPGLQAQLQRLLR* |
| Ga0063454_1016476742 | 3300004081 | Soil | KYNEGSKDIYQAISRILNGASAQSVLPGLQSQLNSLLKK* |
| Ga0062593_1002098453 | 3300004114 | Soil | AKFLKTHYNEASKVIYQGINQILNGTPAKSVLPGVQSKLNQILKAK* |
| Ga0062593_1013071281 | 3300004114 | Soil | THYNEASKVIYQGINQILNGTPAKNVLPGVQSKLNQILKQK* |
| Ga0062590_1020255422 | 3300004157 | Soil | RPAKFLKTHYNEASKVIYQGVNQILNGTPAKNVLPGMQSKLNQIIK* |
| Ga0062591_1001164183 | 3300004643 | Soil | RPAKYLKTHYNEGSKDIYQGISQILNGTPAGSVLPSIASKLNALVK* |
| Ga0062591_1001694921 | 3300004643 | Soil | LKTHYNEASKVIYQGINQILNGAPAKSVLPGVQSKLNQILKAK* |
| Ga0062594_1006649321 | 3300005093 | Soil | HYNEASKVIYQGINQILNGTPAKSVLPGMQSKLNQILKQK* |
| Ga0066677_100813353 | 3300005171 | Soil | AKFLGTHYNEASKVVYQGINQILTGSSSSQVLPQIKSKLQQILKSK* |
| Ga0066678_101092801 | 3300005181 | Soil | RPSKFLKTHYNEASKAIYQGINQILNGASASSQLPQIKSKLQQILQGA* |
| Ga0066675_110259871 | 3300005187 | Soil | LGTHYNEGSKDIYQGISQILNGTPAKNVLPSISSKLQRLVK* |
| Ga0066388_1006004001 | 3300005332 | Tropical Forest Soil | KTHYNEASKVIYQGINQILNGTPAKNVLPGVQSKLNQIIKQG* |
| Ga0066388_1038825911 | 3300005332 | Tropical Forest Soil | KTHYNEASKVIYQGINQILNGTPAKNVLPGMQSKLNQIIK* |
| Ga0070682_1000998133 | 3300005337 | Corn Rhizosphere | AKYLKTHYNEGSKDIYQGISQILNGAPASSVLPGIQSKLEQLVKS* |
| Ga0068868_1016834472 | 3300005338 | Miscanthus Rhizosphere | LGSKYNEGSKDIYQAISRILNGSPASSVLPGLQSQLQGLLKK* |
| Ga0070661_1001646343 | 3300005344 | Corn Rhizosphere | LKTHYNEGSKAIYQGINQILNGKSANSVLPGIQSQLNRILR* |
| Ga0070674_1011617991 | 3300005356 | Miscanthus Rhizosphere | HYNEGSKVIYQGISQILNGASASSVLPSIQSKLQQLVKQ* |
| Ga0070673_1022865062 | 3300005364 | Switchgrass Rhizosphere | KFLKTHYNEASKAIYQGINQILNGTPASSVLPGVQSKLNQILKEH* |
| Ga0070709_106739441 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VARPSKFLKTHYNEASKAIYQGINQILNGTPASSVLPGIQSKLNQILKEH* |
| Ga0070714_1002079661 | 3300005435 | Agricultural Soil | PSKFLKTHYNEASKAIFQGINQILNGTPAKSVLPSLQSKLNTILKEK* |
| Ga0070711_1001543133 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | KFLKTHYNEASKAIFQGINQILNGTPAKSVLPSLQSKLNTILKEK* |
| Ga0070705_1013450441 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VTRPAKYLKTHYNEGSKDIYQGISQILNGTPASSVLPSIASKLNALVK* |
| Ga0070694_1012606622 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | AKFLGKNYNEASKVIYQGINQILTGTPASQVLPQIKSRLQQIMK* |
| Ga0070678_1020966731 | 3300005456 | Miscanthus Rhizosphere | VLGAKYNEGSKDIYQAISRILNGASAESVLPGLQSQLQALLS* |
| Ga0070741_115954851 | 3300005529 | Surface Soil | YNEASKVIYQGINQILTGSSASQVLPQIKSRLQQIKK* |
| Ga0070735_109288341 | 3300005534 | Surface Soil | PANSLKSHYNEGSQAIYQGINQILNGTPASSVLPGIASKLQSLLS* |
| Ga0070665_1019758733 | 3300005548 | Switchgrass Rhizosphere | HYNEGSKDIYQGISQILNGKPAKNVLPTVQAQLERIVR* |
| Ga0066701_108016861 | 3300005552 | Soil | PARFLGTHYNEASKVIYQGINQILNGTPAKNVLPGISSKLNQILKQK* |
| Ga0066670_103095761 | 3300005560 | Soil | RPAKFLKGKYNAGSKVIYQGVNEILQGQSASRVLPSIKSKLQRLLR* |
| Ga0066670_109419421 | 3300005560 | Soil | QYNAGSKAIYQGINEILNGQSAKNVLPSIESKLKRLLH* |
| Ga0066708_105471132 | 3300005576 | Soil | NEGSKAIYQGINQILNGTPAKQVLPGIASKLKRLVG* |
| Ga0066654_100599941 | 3300005587 | Soil | YNEGSKDIYQGISQILNGTPAKSVLPGIASKLQRLVK* |
| Ga0066654_102264822 | 3300005587 | Soil | RPAKFLKGKYNAGSKVIYQGINEILQGQSASRVLPSIKSKLQRLLR* |
| Ga0068864_1017987481 | 3300005618 | Switchgrass Rhizosphere | KFLKTHYNEASKVIYQGINQILNGTPAKSVLPGMQSKLNQILKQK* |
| Ga0068864_1020610351 | 3300005618 | Switchgrass Rhizosphere | YNEGSKDIYQGINQILNGDSADSVLPTIQRKLEQLVQ* |
| Ga0066905_1000447941 | 3300005713 | Tropical Forest Soil | SKVVYQGINQILTGTPASQVLPQVKARLEQILKSK* |
| Ga0068858_1008398542 | 3300005842 | Switchgrass Rhizosphere | VTRPANSLKTHYNEGSKAIYQGINQILNGRPASSVLPSIQSKLDRILR* |
| Ga0066656_108561722 | 3300006034 | Soil | NEASKVIYQGVNQILNGSSAGSVLPSIQSKLNQILKSR* |
| Ga0070715_107345892 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | HYNEGSKDIYQGISQILNGTPASSVLPRIQSELQRLLR* |
| Ga0070716_1009279221 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VARPSKFLKTHYNEASKAIYQGINQILNGTPASSVLPGVQSKLNQILKEH* |
| Ga0075422_103693782 | 3300006196 | Populus Rhizosphere | LKTHYNEGSKAIYQGINQILNGRSASSVLPSIQSKLNRILR* |
| Ga0068871_1005140731 | 3300006358 | Miscanthus Rhizosphere | LKTHYNEGSKAIYQGINQILNGRPASSVLPSIQSKLDRILR* |
| Ga0074062_127448862 | 3300006606 | Soil | HYNEGSKAIYQGINQILNGRPASSVLPSIESKLNRILR* |
| Ga0079222_113510862 | 3300006755 | Agricultural Soil | FGTQYNEASKIIYQGINQILTGSSASQVLPQIKSKLQQIKH* |
| Ga0075433_105451442 | 3300006852 | Populus Rhizosphere | SKAIYQGINQILNGTPASSVLPGIQSKLNQILKEH* |
| Ga0068865_1008419552 | 3300006881 | Miscanthus Rhizosphere | TVARVTRPARYLGSHYNEGSKVIYQGISQILNGASASSVLPSIQSKLEQLVK* |
| Ga0111539_119469592 | 3300009094 | Populus Rhizosphere | GPHYNEASKVVYQGINQILTGAPASQVLPQIKSRLEQILKSK* |
| Ga0105245_117212451 | 3300009098 | Miscanthus Rhizosphere | KIIYQGVNQILNGTPAKSVLPSMQSKLNTLLKQK* |
| Ga0066709_1016101311 | 3300009137 | Grasslands Soil | AKFLKTHYNEASKVIYQGVNQILNGRSAKSVLPGIQAKLNQIIKRH* |
| Ga0105241_114558211 | 3300009174 | Corn Rhizosphere | KVIYQGINQILNGTPAKNVLPGIQSKLNQILKQK* |
| Ga0105248_104751323 | 3300009177 | Switchgrass Rhizosphere | HYNEASKVIYQGINQILNGTPAKNVLPGVQSKLNQILKQK* |
| Ga0105248_113954602 | 3300009177 | Switchgrass Rhizosphere | VLGAKYNEGSKDIYQGISQILNGAPASSVLPGIQSKLEQLVKS* |
| Ga0105237_111847493 | 3300009545 | Corn Rhizosphere | SKVIYQGINQILNGTPAKSVLPGMQSKLNQILKQK* |
| Ga0105249_105355161 | 3300009553 | Switchgrass Rhizosphere | GSKDIYQGISQILNGTPASSVLPSIASKLNALVK* |
| Ga0126374_110771772 | 3300009792 | Tropical Forest Soil | TRPAKFLGARYNEASKVIYQGINQILTGTPASQVLPQIKSRLQQIMK* |
| Ga0126308_104854151 | 3300010040 | Serpentine Soil | TRPSKFLKTHYNEGSKDIYQGISQILNGTPANSVLPGVQSKLDRLLR* |
| Ga0126380_100535571 | 3300010043 | Tropical Forest Soil | NEASKVIYQGINQILNGTPAKSVLPGVQAKLNQILKQK* |
| Ga0127470_10197392 | 3300010105 | Grasslands Soil | TRPAKFLKGKYNAGSKVIYQGVNEILQGQSASRVLPSIKSKLQRLLR* |
| Ga0134082_103454311 | 3300010303 | Grasslands Soil | SGSKVIYQGVNEILRGTPAKNVLPSIESKLKRLLR* |
| Ga0134088_106803281 | 3300010304 | Grasslands Soil | NEASKVVYQAINQILTGSSASQVLPQIKSRLEQILKSK* |
| Ga0134111_101278341 | 3300010329 | Grasslands Soil | EASKVVYQGINQILTGSPASKVLPQIKAKLQQIMK* |
| Ga0134062_106928442 | 3300010337 | Grasslands Soil | RPAKFLKTHYNEASKVIYQGVNQILNGRSAKSVLPGIQAKLNQIIKRH* |
| Ga0126372_110124241 | 3300010360 | Tropical Forest Soil | SKAIYQGINQILNGTPASSVLPGVQSKLNQILKEK* |
| Ga0134125_121169192 | 3300010371 | Terrestrial Soil | PSNILGAHYNEGSKAIYQGINQILNGRSASSVLPGVQAKLQRILR* |
| Ga0134127_100581271 | 3300010399 | Terrestrial Soil | ARVTRPAKYLKTHYNEGSKDIYQGISQILNGTPAGSVLPSVASKLNALIK* |
| Ga0134121_108881072 | 3300010401 | Terrestrial Soil | KFLKTHYNEASKVIYQGINQILNGTPAKNVLPGVQSKLNQILKQK* |
| Ga0134123_126007311 | 3300010403 | Terrestrial Soil | EGSKTIYQGINQILNGRPASSVLPGVQSKLQRILR* |
| Ga0105246_120595371 | 3300011119 | Miscanthus Rhizosphere | LGTHYNEGSKIIYQGISQILNGQDANSVLPSIQSKLDRLVK* |
| Ga0137364_105098251 | 3300012198 | Vadose Zone Soil | ARPSKFLKTHYNEASKAIFQGINQILNGTPAKNVLPGLQSKLNTILKEK* |
| Ga0150985_1006867273 | 3300012212 | Avena Fatua Rhizosphere | PRATRPSTVLGAKYNEGSKAIYQAVSRILNGASASSVLPGLQSQLQALIK* |
| Ga0150985_1032786981 | 3300012212 | Avena Fatua Rhizosphere | KYLKTHYNEGSKDIYQGINQILNGDSADSVLPTIQRKLEQLVQ* |
| Ga0150985_1065033542 | 3300012212 | Avena Fatua Rhizosphere | ANSLKGKYNEGSKYIYQGISQILNGQSASSVLPSIQSRLQRLLR* |
| Ga0137375_112072852 | 3300012360 | Vadose Zone Soil | GTHYNEGSKAIYQGINQILNGTPASRVLPSIQSKLERLVK* |
| Ga0137361_106038291 | 3300012362 | Vadose Zone Soil | YNEASKVIYQGINQILNGTSASSVLPSVQSKLNQILKQG* |
| Ga0134040_10806571 | 3300012389 | Grasslands Soil | PRATRPSSALGSKYNEGSKDIYQAISRILNGASAQSVLPGLQSQLNSLLKK* |
| Ga0150984_1009834452 | 3300012469 | Avena Fatua Rhizosphere | GSKDIYQGINQILNGDSADSVLPTIQRKLEQLVQ* |
| Ga0157320_10247582 | 3300012481 | Arabidopsis Rhizosphere | LKSHYNEGSKAIYQGINQILNGRSASSVLPGVESKLNRILR* |
| Ga0157351_10271722 | 3300012501 | Unplanted Soil | SKVVYQGINQILTGSSSRQVLPQIKARLEQILKSK* |
| Ga0137373_105992741 | 3300012532 | Vadose Zone Soil | LKAKYNAGSKDIYQGINQILNGKDAKSVLPSIQSKLQRLIR* |
| Ga0157300_10569301 | 3300012884 | Soil | HYNEGSKAIYQGINQILNGRPASSVLPSIQSKLNRILR* |
| Ga0157294_101230521 | 3300012892 | Soil | NILGAHYNEGSKAIYQGINQILNGRSASSVLPGVQAKLQRILR* |
| Ga0157309_103741152 | 3300012895 | Soil | SLKTHYNEGSKAIYQGINQILNGRPASSVLPSIQSKLDRILR* |
| Ga0157295_101897023 | 3300012906 | Soil | SKAIYQGINQILNGRSASSVLPSIQAKLERIVPR* |
| Ga0157283_101130152 | 3300012907 | Soil | LGAHYNEGSKAIYQGINQILNGRSASSVLPGVQAKLQRILR* |
| Ga0157290_100387881 | 3300012909 | Soil | HYNEGSKAIYQGINQILNGRSASSVLPGVESKLNRILR* |
| Ga0157301_103188271 | 3300012911 | Soil | TRPANSLKTHYNEGSKAIYQGINQILNGRSASSVLPSIQSKLNRILR* |
| Ga0126375_120310041 | 3300012948 | Tropical Forest Soil | PAKFLGARYNEASKVIYQGINQILTGTPASQVLPQIKSRLQQIMK* |
| Ga0164300_106072911 | 3300012951 | Soil | TRPARDLKTHYNEGSKAIYQGFSQILNGTPASSVLPSIQSKLDRLAK* |
| Ga0164298_101376821 | 3300012955 | Soil | KVIYQGINQILNGTPAKNVLPGVQSKLNQILKQK* |
| Ga0164299_105945792 | 3300012958 | Soil | VTRPARYLGTHYNEGSKDIYQGISQILNGQPAKNVLPSIQSKLERLVK* |
| Ga0164301_115007272 | 3300012960 | Soil | HYNEASKDVYQGINQILTGTPASQVLPQIKQKLQLLLKK* |
| Ga0164302_112512492 | 3300012961 | Soil | RPSKFLKTHYNEASKAIYQGINQILNGTPASSVLPGVQSKLNQILKEH* |
| Ga0134077_102494951 | 3300012972 | Grasslands Soil | KYNEGSKDIYQAISRILNGASAQSVLPGLQAQLQRLLK* |
| Ga0164309_106659692 | 3300012984 | Soil | VARPSKFLKTHYNEASKAIFQGINQILNGTPAKSVLPSLQSKLNTILKEK* |
| Ga0164309_116344971 | 3300012984 | Soil | VTRPARYLGTHYNEGSKDIYQGISQILNGQPAKNVLPSIQSK |
| Ga0164304_103293281 | 3300012986 | Soil | ARSLKTHYNEGSKAIYQGINQILNGKSANSVLPGIQSQLNRILR* |
| Ga0164305_116815951 | 3300012989 | Soil | SKVIYQGINQILNGTPAKNVLPGVQSKLNQILKQK* |
| Ga0157372_105802943 | 3300013307 | Corn Rhizosphere | YNEASKVIYQGINQILNGTPAKNVLPGVQSKLNQILKQK* |
| Ga0157372_118947062 | 3300013307 | Corn Rhizosphere | YNEGSKDIYQGISQILNGTPASSVLPSIASKLNALVK* |
| Ga0157376_123219261 | 3300014969 | Miscanthus Rhizosphere | RPSTALGAKYNEGSKDIYQAISRILNGAKAQSVLPGLQAQLQRLLR* |
| Ga0173478_104635131 | 3300015201 | Soil | EGSKAIYQGINQILNGRSASSVLPGVESKLNRILR* |
| Ga0132258_109867394 | 3300015371 | Arabidopsis Rhizosphere | KTHYNEASKVIYQGINQILNGTPAKSVLPGMQAKLNQIIK* |
| Ga0132255_1015579461 | 3300015374 | Arabidopsis Rhizosphere | KTHYNEGSKAIYQGINQILNGRSASSVLPSIQSKLQRILR* |
| Ga0163161_116811091 | 3300017792 | Switchgrass Rhizosphere | PARYLGTHYNEGSKIIYQGISQILNGQDANSVLPSIQSKLDRLVK |
| Ga0187779_112853572 | 3300017959 | Tropical Peatland | PSSILGVKYNEGSKDIYQAINRILNGASASSVLPGLQSQLQALLKK |
| Ga0187765_113291882 | 3300018060 | Tropical Peatland | ARVTRPARYLGTHYNEGSKDIYQGISQILNGASASSVLPSIQSKLQQLVK |
| Ga0184624_101796011 | 3300018073 | Groundwater Sediment | NEASKVVYQGINQILTGSSASQVLPQIKSRLEQILKSK |
| Ga0066669_101214703 | 3300018482 | Grasslands Soil | LKAKYNSGSKVIYQGINQILRGTPAKNVLPSIESKLKRLLR |
| Ga0184642_11820352 | 3300019279 | Groundwater Sediment | GTHYNEGSKAIYQGISQILNGQKANKVLPSIKAKLERLLR |
| Ga0184642_16557091 | 3300019279 | Groundwater Sediment | THYNEGSKAIYQGISQILNGQKANKVLPSIKAKLERLLR |
| Ga0173481_102680001 | 3300019356 | Soil | VTRPAKYLKTHYNEGSKDIYQGVSQILNGTPASSVLPSVASKLNALVK |
| Ga0222624_16176711 | 3300021951 | Groundwater Sediment | SNALGAKYNEGSKIIYQGISQILNGKPAKDVLPTIQAQLERLAK |
| Ga0222623_100611983 | 3300022694 | Groundwater Sediment | ASYNEGSKDIYQGISQILNGTPAKNVLPSIASKLQRLVK |
| Ga0222622_103449732 | 3300022756 | Groundwater Sediment | KYLKASYNEGSKDIYQGISQILNGTPAKNVLPSIASKLQRLVK |
| Ga0247746_10338711 | 3300022886 | Soil | THYNEASKVIYQGVNQILNGTPAKNVLPGMQSKLNQIIK |
| Ga0247772_10807571 | 3300023264 | Plant Litter | NEGSKAIYQGINQILNGRPASSVLPSIQSKLNRILR |
| Ga0247789_10349811 | 3300023266 | Soil | TRPANSLKTHYNEGSKAIYQGINQILNGRPASSVLPSIQSKLDRILR |
| Ga0247681_10309111 | 3300024310 | Soil | EASKVIYQGVNQILNGASAKSVLPGMKSKLQQILKSK |
| Ga0207643_108756361 | 3300025908 | Miscanthus Rhizosphere | LKAHYNEGSKDIYQGINQILNGDSADSVLPTIQRKLEQLVQ |
| Ga0207660_103150333 | 3300025917 | Corn Rhizosphere | YNEASKAIYQGINQILNGTPASSVLPGVQSKLNQILKEH |
| Ga0207649_112313191 | 3300025920 | Corn Rhizosphere | AKYLKTHYNEGSKDIYQGISQILNGTPASSVLPSIASKLNALVK |
| Ga0207652_101345111 | 3300025921 | Corn Rhizosphere | NILGAHYNEGSKAIYQGINQILNGRSASSVLPGVQAKLQRILR |
| Ga0207652_104428381 | 3300025921 | Corn Rhizosphere | SLKTHYNEGSKAIYQGINQILNGKSANSVLPGIQSQLNRILR |
| Ga0207650_106737781 | 3300025925 | Switchgrass Rhizosphere | THYNEGSKAIYQGINQILNGRSASSVLPGIQSKLERILR |
| Ga0207687_115929722 | 3300025927 | Miscanthus Rhizosphere | VTRPARYLGTHYNEGSKVIYQGVSQILNGASASSVLPSIQSKLEQLVK |
| Ga0207709_110662262 | 3300025935 | Miscanthus Rhizosphere | YLKTHYNEGSKAIYQGINQILNGTPAKSVLPSIQSKLQRLLR |
| Ga0207661_115797982 | 3300025944 | Corn Rhizosphere | THYNEGSKDIYQGISQILNGKPAKNVLPTVQAQLERIVR |
| Ga0207703_110946191 | 3300026035 | Switchgrass Rhizosphere | VTRPANSLKTHYNEGSKAIYQGINQILNGRPASSVLPSIQSKLDRILR |
| Ga0207639_102443121 | 3300026041 | Corn Rhizosphere | THYNEASKVIYQGINQILNGTPAKNVLPGVQSKLNQILKQK |
| Ga0207676_117828621 | 3300026095 | Switchgrass Rhizosphere | RPAKYLKAHYNEGSKDIYQGINQILNGDSADSVLPTIQRKLEQLVQ |
| Ga0207683_103108371 | 3300026121 | Miscanthus Rhizosphere | RYLGTHYNEGSKIIYQGISQILNGQDANSVLPSIQSKLDRLVK |
| Ga0207683_113718862 | 3300026121 | Miscanthus Rhizosphere | HYNEGSKDIYQGISQILNGKPAKDVLPTIQAQLDRIVK |
| Ga0207698_113671111 | 3300026142 | Corn Rhizosphere | PARDLKTHYNEGSKAIYQGINQILNGRPASSVLPSIESKLNRILR |
| Ga0207698_119494812 | 3300026142 | Corn Rhizosphere | NSLKSHYNEGSKAIYEGINQILNGRSASSVLPGVESKLNRILR |
| Ga0207698_120874091 | 3300026142 | Corn Rhizosphere | ARVTRPARYLGTHYNEGSKDIYQGISQILNGTPASSVLPSIASKLNALVK |
| Ga0209801_10597911 | 3300026326 | Soil | RPSKFLKTHYNEASKAIYQGINQILNGASASSQLPQIKSKLQQILQGA |
| Ga0209159_10619663 | 3300026343 | Soil | FLKTHYNEASKVIYQGINQILNGRSAKSVLPGIQAKLNQIIKRH |
| Ga0209807_11098002 | 3300026530 | Soil | YNAGSKVIYQGVNEILQGQSASRVLPSIKSKLQRLLR |
| Ga0247749_10057241 | 3300027993 | Soil | LKTHYNEASKVIYQGVNQILNGTPAKNVLPGMQSKLNQIIK |
| Ga0268265_101693483 | 3300028380 | Switchgrass Rhizosphere | HYNEGSKAIYQGINQILNGRPASSVLPSIESKLNRILR |
| Ga0268265_116659982 | 3300028380 | Switchgrass Rhizosphere | TRPAKFLKTHYNEASKVIYQGINQILNGTPAKNVLPGVQSKLNQILKQK |
| Ga0307303_100282491 | 3300028713 | Soil | HYNEASKVIYQGINQILNGTPAKNVLPGVQSKLNQILKQK |
| Ga0307313_100058735 | 3300028715 | Soil | KYLKTHYNEGSKDIYQGISQILNGTPAGSVLPGVASKLNALVK |
| Ga0307313_100548862 | 3300028715 | Soil | GAHYNEASKIIYQGVNQILNGTPAKSVLPSMQSKLNTLLKQK |
| Ga0307317_100478901 | 3300028720 | Soil | EASKVIYQGINQILNGTPAKNVLPGVQSKLNQILKQK |
| Ga0307315_100916421 | 3300028721 | Soil | GAKYNEGSKAIYQAINRILNGASASSVLPGLQSQLQALLK |
| Ga0307280_100235431 | 3300028768 | Soil | RATRPSKYLKASYNEGSKDIYQGISQILNGTPAKNVLPSISSKLQRLVK |
| Ga0307282_100493173 | 3300028784 | Soil | VTRATRPSKYLKASYNEGSKDIYQGISQILNGTPAKNVLPSISSKLQRLVK |
| Ga0307323_101706572 | 3300028787 | Soil | GKFFGTHYNEASKIVYQGINQILTGSPASSVLPQIKSRLQQIKK |
| Ga0307284_100238411 | 3300028799 | Soil | TRATRPSKYLKASYNEGSKDIYQGISQILNGTPAKNVLPSISSKLQRLVK |
| Ga0307292_100601863 | 3300028811 | Soil | TRPAKYLGTHYNEGSKAIYQGISQILNGQKANKVLPSIKAKLERLLR |
| Ga0307302_100509103 | 3300028814 | Soil | GAHYNEGSKAIYQGISQILNGQKANKVLPSIKAKLERLLR |
| Ga0307310_103290461 | 3300028824 | Soil | NEGSKAIYQGISQILNGQKANKVLPSIKAKLERLLR |
| Ga0307312_100157765 | 3300028828 | Soil | YNEASKVVYQGINQILTGSSASQVLPQIKSRLEQILKSK |
| Ga0307312_100622854 | 3300028828 | Soil | KFFGTHYNEASKIVYQGINQILTGSPASSVLPQIKSRLQQIKK |
| Ga0308194_101185552 | 3300031421 | Soil | FLKGHYNEGSKIIYQGINQILNGADAKSVLPGIQSRLNRLLK |
| Ga0310886_100754271 | 3300031562 | Soil | KTHYNEGSKAIYQGINQILNGRPASSVLPSIESKLNRILR |
| Ga0318555_107750161 | 3300031640 | Soil | GSKDIYQAISRILNGSTAQSVLPGLQSQLNALLKK |
| Ga0310907_102181321 | 3300031847 | Soil | THYNEGSKAIYQGINQILNGRPASSVLPSIESKLNRILR |
| Ga0307410_120584141 | 3300031852 | Rhizosphere | KFLKTHYNEASKVVYQGVNQILNGTPAKNVLPGVESKLNRIIK |
| Ga0308175_1023011922 | 3300031938 | Soil | KTHYNEGSKAIYQGINQILNGRSANSVLPGIQSKLNRILR |
| Ga0308176_101131364 | 3300031996 | Soil | AKFLKTHYNEASKVIYQGVNQILNGTPAKNVLPSMQSKLNQIIK |
| Ga0335070_105278032 | 3300032829 | Soil | THYNEGSKDIYQGISQILNGKPAKDVLPTIQSQLEQLVK |
| Ga0247830_105860522 | 3300033551 | Soil | THYNEGSKDIYQGISQILNGTPASSVLPSIASKLNALVK |
| ⦗Top⦘ |