Basic Information | |
---|---|
Family ID | F035939 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 171 |
Average Sequence Length | 42 residues |
Representative Sequence | VSTDNHFFAVRAVGKNGARSIAVPTEMERRPPPLPAPSKQ |
Number of Associated Samples | 146 |
Number of Associated Scaffolds | 171 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.59 % |
% of genes near scaffold ends (potentially truncated) | 97.66 % |
% of genes from short scaffolds (< 2000 bps) | 91.23 % |
Associated GOLD sequencing projects | 138 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.15 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (94.152 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (29.825 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.749 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.953 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 171 Family Scaffolds |
---|---|---|
PF07876 | Dabb | 8.77 |
PF11731 | Cdd1 | 7.02 |
PF00450 | Peptidase_S10 | 5.85 |
PF08447 | PAS_3 | 5.26 |
PF00903 | Glyoxalase | 3.51 |
PF00989 | PAS | 1.75 |
PF03551 | PadR | 1.75 |
PF12681 | Glyoxalase_2 | 1.75 |
PF01694 | Rhomboid | 1.17 |
PF13442 | Cytochrome_CBB3 | 1.17 |
PF02687 | FtsX | 1.17 |
PF08448 | PAS_4 | 1.17 |
PF13426 | PAS_9 | 1.17 |
PF14321 | DUF4382 | 1.17 |
PF01425 | Amidase | 0.58 |
PF12867 | DinB_2 | 0.58 |
PF13537 | GATase_7 | 0.58 |
PF13188 | PAS_8 | 0.58 |
PF13669 | Glyoxalase_4 | 0.58 |
PF01509 | TruB_N | 0.58 |
PF02786 | CPSase_L_D2 | 0.58 |
PF01784 | NIF3 | 0.58 |
PF11987 | IF-2 | 0.58 |
PF15919 | HicB_lk_antitox | 0.58 |
PF01738 | DLH | 0.58 |
PF12680 | SnoaL_2 | 0.58 |
PF01436 | NHL | 0.58 |
PF16198 | TruB_C_2 | 0.58 |
PF04255 | DUF433 | 0.58 |
COG ID | Name | Functional Category | % Frequency in 171 Family Scaffolds |
---|---|---|---|
COG2939 | Carboxypeptidase C (cathepsin A) | Amino acid transport and metabolism [E] | 5.85 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.75 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.75 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.75 |
COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 1.17 |
COG0130 | tRNA U55 pseudouridine synthase TruB, may also work on U342 of tmRNA | Translation, ribosomal structure and biogenesis [J] | 0.58 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.58 |
COG0327 | Putative GTP cyclohydrolase 1 type 2, NIF3 family | Coenzyme transport and metabolism [H] | 0.58 |
COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.58 |
COG3323 | PII-like insert in the uncharacterized protein YqfO, YbgI/NIF3 family | Function unknown [S] | 0.58 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 94.15 % |
Unclassified | root | N/A | 5.85 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002910|JGI25615J43890_1001428 | All Organisms → cellular organisms → Bacteria | 3235 | Open in IMG/M |
3300002917|JGI25616J43925_10212858 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300004080|Ga0062385_10075013 | Not Available | 1558 | Open in IMG/M |
3300004080|Ga0062385_10653997 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300004092|Ga0062389_102646418 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300005167|Ga0066672_10095208 | All Organisms → cellular organisms → Bacteria | 1807 | Open in IMG/M |
3300005167|Ga0066672_10847239 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 571 | Open in IMG/M |
3300005332|Ga0066388_100402545 | All Organisms → cellular organisms → Bacteria | 2014 | Open in IMG/M |
3300005332|Ga0066388_100619654 | All Organisms → cellular organisms → Bacteria | 1702 | Open in IMG/M |
3300005526|Ga0073909_10057047 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
3300005542|Ga0070732_10194443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1212 | Open in IMG/M |
3300005560|Ga0066670_10421527 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 821 | Open in IMG/M |
3300005568|Ga0066703_10128954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1509 | Open in IMG/M |
3300005591|Ga0070761_10720699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
3300005712|Ga0070764_10980464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
3300005712|Ga0070764_11031228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
3300006032|Ga0066696_10596462 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
3300006050|Ga0075028_100564657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
3300006052|Ga0075029_100935670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
3300006059|Ga0075017_100427937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 996 | Open in IMG/M |
3300006086|Ga0075019_10173428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1268 | Open in IMG/M |
3300006172|Ga0075018_10322176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
3300006176|Ga0070765_100822353 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300006176|Ga0070765_101137238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
3300006237|Ga0097621_100291312 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
3300006755|Ga0079222_10771170 | Not Available | 778 | Open in IMG/M |
3300006797|Ga0066659_11577920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
3300006806|Ga0079220_10386201 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 907 | Open in IMG/M |
3300006881|Ga0068865_100579133 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
3300006903|Ga0075426_10655571 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 786 | Open in IMG/M |
3300007255|Ga0099791_10365778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
3300007258|Ga0099793_10651958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
3300007788|Ga0099795_10488206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
3300009012|Ga0066710_104257042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
3300009038|Ga0099829_10130681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1987 | Open in IMG/M |
3300009038|Ga0099829_11052336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
3300009038|Ga0099829_11572749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
3300009088|Ga0099830_11051251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
3300009089|Ga0099828_10146295 | All Organisms → cellular organisms → Bacteria | 2085 | Open in IMG/M |
3300009090|Ga0099827_11168998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
3300009545|Ga0105237_11139379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
3300009792|Ga0126374_10859327 | Not Available | 699 | Open in IMG/M |
3300010046|Ga0126384_10006566 | All Organisms → cellular organisms → Bacteria | 7120 | Open in IMG/M |
3300010048|Ga0126373_10901293 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
3300010325|Ga0134064_10098319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 960 | Open in IMG/M |
3300010335|Ga0134063_10340817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
3300010360|Ga0126372_10370988 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 21-71-4 | 1293 | Open in IMG/M |
3300010361|Ga0126378_10535422 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
3300010361|Ga0126378_11329518 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 813 | Open in IMG/M |
3300010376|Ga0126381_101610381 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 938 | Open in IMG/M |
3300010858|Ga0126345_1123018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
3300011120|Ga0150983_13450147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
3300011120|Ga0150983_13727218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
3300011269|Ga0137392_10732434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
3300011270|Ga0137391_10521762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1004 | Open in IMG/M |
3300011270|Ga0137391_10802559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
3300011270|Ga0137391_11453125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
3300011271|Ga0137393_10342019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1277 | Open in IMG/M |
3300011271|Ga0137393_11420756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
3300012096|Ga0137389_10171154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1792 | Open in IMG/M |
3300012169|Ga0153990_1046465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 988 | Open in IMG/M |
3300012189|Ga0137388_10376439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1312 | Open in IMG/M |
3300012189|Ga0137388_10803295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 872 | Open in IMG/M |
3300012200|Ga0137382_10286836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1146 | Open in IMG/M |
3300012203|Ga0137399_10316491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1291 | Open in IMG/M |
3300012205|Ga0137362_10608614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 942 | Open in IMG/M |
3300012208|Ga0137376_11232473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
3300012211|Ga0137377_10492384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1164 | Open in IMG/M |
3300012285|Ga0137370_10105752 | All Organisms → cellular organisms → Bacteria | 1589 | Open in IMG/M |
3300012349|Ga0137387_11142845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
3300012350|Ga0137372_10825052 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300012356|Ga0137371_10537680 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 900 | Open in IMG/M |
3300012359|Ga0137385_11427990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
3300012362|Ga0137361_10850129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
3300012362|Ga0137361_11236159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
3300012582|Ga0137358_10598198 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300012917|Ga0137395_10134209 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
3300012922|Ga0137394_10250143 | All Organisms → cellular organisms → Bacteria | 1515 | Open in IMG/M |
3300012924|Ga0137413_11543617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
3300012925|Ga0137419_10184276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1534 | Open in IMG/M |
3300012927|Ga0137416_11799366 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300012927|Ga0137416_12002352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
3300012929|Ga0137404_10805720 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 853 | Open in IMG/M |
3300012929|Ga0137404_11369621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
3300012929|Ga0137404_11535772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
3300012930|Ga0137407_10487530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1150 | Open in IMG/M |
3300012944|Ga0137410_10228696 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
3300012961|Ga0164302_11450432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella pectinivorans | 563 | Open in IMG/M |
3300012975|Ga0134110_10535610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
3300012977|Ga0134087_10046735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1695 | Open in IMG/M |
3300015052|Ga0137411_1168211 | All Organisms → cellular organisms → Bacteria | 3641 | Open in IMG/M |
3300015245|Ga0137409_11023303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
3300015371|Ga0132258_12795170 | Not Available | 1216 | Open in IMG/M |
3300015373|Ga0132257_101291262 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
3300016294|Ga0182041_12013721 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 538 | Open in IMG/M |
3300016371|Ga0182034_11669324 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300017823|Ga0187818_10390879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
3300017947|Ga0187785_10203535 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
3300020021|Ga0193726_1354909 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300020199|Ga0179592_10343159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
3300020579|Ga0210407_11064641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella paludicola | 614 | Open in IMG/M |
3300020580|Ga0210403_10509658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 977 | Open in IMG/M |
3300020580|Ga0210403_10666898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
3300020580|Ga0210403_10907892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
3300020580|Ga0210403_11181961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella paludicola | 590 | Open in IMG/M |
3300020581|Ga0210399_10644250 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300020583|Ga0210401_10401319 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
3300021086|Ga0179596_10002530 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5050 | Open in IMG/M |
3300021168|Ga0210406_10219199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1572 | Open in IMG/M |
3300021168|Ga0210406_11022039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
3300021171|Ga0210405_10257679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1380 | Open in IMG/M |
3300021171|Ga0210405_10585972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 869 | Open in IMG/M |
3300021178|Ga0210408_10036621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3862 | Open in IMG/M |
3300021401|Ga0210393_10690103 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300021402|Ga0210385_10269862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1255 | Open in IMG/M |
3300021404|Ga0210389_10889792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
3300021420|Ga0210394_10228967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1625 | Open in IMG/M |
3300021432|Ga0210384_11295142 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 633 | Open in IMG/M |
3300021476|Ga0187846_10437158 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300021477|Ga0210398_11155970 | Not Available | 613 | Open in IMG/M |
3300021478|Ga0210402_10713180 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
3300021479|Ga0210410_10578669 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
3300021560|Ga0126371_11219892 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 888 | Open in IMG/M |
3300021560|Ga0126371_13251809 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300024246|Ga0247680_1033312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
3300024310|Ga0247681_1042752 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300024330|Ga0137417_1435638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1982 | Open in IMG/M |
3300025906|Ga0207699_10106902 | All Organisms → cellular organisms → Bacteria | 1787 | Open in IMG/M |
3300025916|Ga0207663_10292402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1214 | Open in IMG/M |
3300026035|Ga0207703_10042050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3663 | Open in IMG/M |
3300026095|Ga0207676_11577523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
3300026308|Ga0209265_1057478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1184 | Open in IMG/M |
3300026334|Ga0209377_1248304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
3300026496|Ga0257157_1095619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
3300026499|Ga0257181_1035250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
3300026547|Ga0209156_10056587 | All Organisms → cellular organisms → Bacteria | 2060 | Open in IMG/M |
3300026547|Ga0209156_10394238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
3300026551|Ga0209648_10426257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
3300026552|Ga0209577_10517020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 783 | Open in IMG/M |
3300026555|Ga0179593_1243200 | All Organisms → cellular organisms → Bacteria | 2204 | Open in IMG/M |
3300027050|Ga0209325_1036296 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 593 | Open in IMG/M |
3300027629|Ga0209422_1048252 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1025 | Open in IMG/M |
3300027643|Ga0209076_1001633 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4652 | Open in IMG/M |
3300027701|Ga0209447_10036391 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
3300027853|Ga0209274_10074583 | All Organisms → cellular organisms → Bacteria | 1644 | Open in IMG/M |
3300027855|Ga0209693_10588792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
3300027882|Ga0209590_11071434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
3300028536|Ga0137415_10183701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1915 | Open in IMG/M |
3300029636|Ga0222749_10728679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
3300031057|Ga0170834_100555443 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300031057|Ga0170834_105528433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
3300031446|Ga0170820_14618064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 780 | Open in IMG/M |
3300031715|Ga0307476_10300104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1178 | Open in IMG/M |
3300031716|Ga0310813_11256928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
3300031718|Ga0307474_10935639 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
3300031719|Ga0306917_10651305 | Not Available | 828 | Open in IMG/M |
3300031720|Ga0307469_10197857 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
3300031753|Ga0307477_10660605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
3300031777|Ga0318543_10390959 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 623 | Open in IMG/M |
3300031782|Ga0318552_10636915 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 544 | Open in IMG/M |
3300031846|Ga0318512_10096468 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 21-71-4 | 1385 | Open in IMG/M |
3300031890|Ga0306925_10092890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3206 | Open in IMG/M |
3300031981|Ga0318531_10538939 | Not Available | 529 | Open in IMG/M |
3300032052|Ga0318506_10133167 | Not Available | 1081 | Open in IMG/M |
3300032174|Ga0307470_10355855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1017 | Open in IMG/M |
3300032180|Ga0307471_100660694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1208 | Open in IMG/M |
3300032205|Ga0307472_100252255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1384 | Open in IMG/M |
3300032893|Ga0335069_10017290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 10052 | Open in IMG/M |
3300032955|Ga0335076_10367041 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 29.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.43% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.26% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.68% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.09% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.34% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.34% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.34% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.34% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.92% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.75% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.75% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.17% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.17% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.17% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.17% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.17% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.17% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.17% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.58% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.58% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.58% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.58% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.58% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.58% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.58% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.58% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.58% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012169 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC074 MetaG | Host-Associated | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25615J43890_10014281 | 3300002910 | Grasslands Soil | VSTDNHFFAIRAVGKNGARSIAVPTEIERRPPPLPAGAKQ* |
JGI25616J43925_102128581 | 3300002917 | Grasslands Soil | VLKGVSTDNHFFAVRAVGKNGARSIAVPTEIERRPPPLPSPSKQ* |
Ga0062385_100750132 | 3300004080 | Bog Forest Soil | LKSVSTDNHFFAVRAVGKNGARSIAVPTEIERRPPPLPAQQAQPKS* |
Ga0062385_106539971 | 3300004080 | Bog Forest Soil | KDVSTDNHYFAVRSVGKNGARSLAVVSEAERRAPPLPTATPKQ* |
Ga0062389_1026464182 | 3300004092 | Bog Forest Soil | DVSTDNHYFAVRSVGKNGARSLAVVSEAERRAPPLPTATPKQ* |
Ga0066672_100952082 | 3300005167 | Soil | AVLKGVSTDNHFFAVRSVGKNGARSIAVPTEMERRAPPGPTRSSQ* |
Ga0066672_108472392 | 3300005167 | Soil | GVSTDNHFFAVRSVGKNGARSIAVPTEMERRPPPGPTRSNQ* |
Ga0066388_1004025453 | 3300005332 | Tropical Forest Soil | VLKGVSTDNHFFAVRSVGKNGARSIAVPTEIERRPPPLPSTPK* |
Ga0066388_1006196542 | 3300005332 | Tropical Forest Soil | KGVSTDNHFFALRAVGKNGARSIAVPTEMERRPPPGPTPAKQ* |
Ga0073909_100570471 | 3300005526 | Surface Soil | NHFFAVRSVGRNGARSIAVPTEMEKRPPPLPAKAKN* |
Ga0070732_101944431 | 3300005542 | Surface Soil | GETALKGVSTDNHFFAVRSVGKNGSRSIAVPTEMERRPPPLPSGTKQ* |
Ga0066670_104215271 | 3300005560 | Soil | STDNHFFAVRAVGKNGARSIAVPTELERRPPPLPTPAKQ* |
Ga0066703_101289544 | 3300005568 | Soil | STDNHFFAVRAVGKNAARSIAVPTEIERRPPPQPTPTK* |
Ga0070761_107206992 | 3300005591 | Soil | KDVSTDNHYFAVRSVGKNGARSLAVISEAERRAPPLPTTPKQ* |
Ga0070764_109804642 | 3300005712 | Soil | ILKDVSTDNHYFAVRSIGKNGARSIAVISEAERRAPPTPSNAPKQ* |
Ga0070764_110312281 | 3300005712 | Soil | GVSTDNHFFAVRSVGKNGARSIAVPTEMERRPIPGTTKK* |
Ga0066696_105964622 | 3300006032 | Soil | STDNHFFAVRAVGKNGARSIAVPTEMERRAPPLPTPSKQ* |
Ga0075028_1005646572 | 3300006050 | Watersheds | DNHFFAVRAVGKNGARSIAIPTEIERRQPPSPSKQ* |
Ga0075029_1009356702 | 3300006052 | Watersheds | STDNHFFAVRAVGKNGARSIAVPTEMERRPPPLPTPTKQ* |
Ga0075017_1004279372 | 3300006059 | Watersheds | SVSTDNHFFAVRAVGKNGARSIAVPTEMERRPPPQPTPAKQ* |
Ga0075019_101734281 | 3300006086 | Watersheds | FFAVRAVGKNGARSIAVPTEMERRPPPQPTPAKQ* |
Ga0075018_103221762 | 3300006172 | Watersheds | TDNHFFAVRAVGKNGARSIAVPTEMERRPLPTPAKQ* |
Ga0070765_1008223532 | 3300006176 | Soil | GETVLNGVSTDNHFFAVRAVGKNGARSIAVPTDVERLPIPGTTRK* |
Ga0070765_1011372383 | 3300006176 | Soil | VLKDVSTDNHYFAVRSVGKNGARSIAVIAEAERRAPPLPSNAPKQ* |
Ga0097621_1002913123 | 3300006237 | Miscanthus Rhizosphere | ETVLKGVSTDNHFYAVRAVGKNGARSIAVPTEMERRGPPLPTK* |
Ga0079222_107711702 | 3300006755 | Agricultural Soil | AVRSVGKNGARSIAVVAEAERRAPPALPSNAPKQ* |
Ga0066659_115779201 | 3300006797 | Soil | TVLKGVSTDNHFFAVRAVGKNGARSIAVPTEIERRPPPLPSESKQ* |
Ga0079220_103862012 | 3300006806 | Agricultural Soil | GVSTDNHFFAVRSVGKNGARSIAVPTEMERRTPPGPTRSNQ* |
Ga0068865_1005791331 | 3300006881 | Miscanthus Rhizosphere | VSTDNHFFAVRSVGRNGARSIAIPTEIERRPPPLPAKAKQ* |
Ga0075426_106555711 | 3300006903 | Populus Rhizosphere | VSTDNHFFAVRSVGKNGARSIAVPTEMERRPPPGPTPAKQ* |
Ga0099791_103657782 | 3300007255 | Vadose Zone Soil | GETVLKGVSTDNHFFAVRAVGKNGARSIAVPTEIERRPPPQPAPAKQ* |
Ga0099793_106519581 | 3300007258 | Vadose Zone Soil | HFFAVRAVGKNGARSIAEPTEIERRPPPEPAPTKQ* |
Ga0099795_104882061 | 3300007788 | Vadose Zone Soil | GVSTDNHFFAVRSVGKNGARSIAVPTEMERRPPPTPTGKKQ* |
Ga0066710_1042570421 | 3300009012 | Grasslands Soil | HFFAVRAVGKNGARSIAVPTEMERRPPPLPTPSKQ |
Ga0099829_101306814 | 3300009038 | Vadose Zone Soil | GETVLKGVSTDNHFFAVRAVGKNGARSIAVPTEMERRPPPLPSAPKQ* |
Ga0099829_110523361 | 3300009038 | Vadose Zone Soil | TVLKNVSTDNHFFAVRAVGKNGARSIAVPTEIERRPPPLPSPSKQ* |
Ga0099829_115727492 | 3300009038 | Vadose Zone Soil | ETVLMGIYTDNHFYAVRAVGMNGARSIAVPTEIERRPLPLPAPTKQ* |
Ga0099830_110512512 | 3300009088 | Vadose Zone Soil | STDNHFFAVRAVGKNGARSIAVPTEIERRPPPLPTPSKQ* |
Ga0099828_101462951 | 3300009089 | Vadose Zone Soil | TDNHFFAVRAVGKNGARSIAVPTEMERRPPPLPSAPKQ* |
Ga0099827_111689981 | 3300009090 | Vadose Zone Soil | PGETVLKGVSTDNHFFAVRSVGKNGARSIAVPTEMERRPPALPTGTKQ* |
Ga0105237_111393792 | 3300009545 | Corn Rhizosphere | DNHFFAVRSVGKNGARSIAVVTEMERRPIPGTQKK* |
Ga0126374_108593271 | 3300009792 | Tropical Forest Soil | AGETVLKGVSTDNHFFAVRSVGKTGARSIAVPTEIERRGPPAPAKSKE* |
Ga0126384_100065667 | 3300010046 | Tropical Forest Soil | LKGVSTDNHFFAVRSVGKNGARSIAVPTEMERRAPPGPTPSNQ* |
Ga0126373_109012931 | 3300010048 | Tropical Forest Soil | TVLEAVSTDNHFFAVRSVGKTGARSLAVPTEIERRGPPAPAKSKE* |
Ga0134064_100983191 | 3300010325 | Grasslands Soil | GVSTDNHFFAVRAVGKNGARSIAVPTEMERRAPPLPTPSKQ* |
Ga0134063_103408172 | 3300010335 | Grasslands Soil | ILQGVSTDNHFFAVRAVGKNGARSIAVPTEIERRPPPLPAPSKP* |
Ga0126372_103709881 | 3300010360 | Tropical Forest Soil | GVSTDNHFFAVRSVGKNGARSIAVLTEMERRTPPGPTPAKQ* |
Ga0126378_105354223 | 3300010361 | Tropical Forest Soil | VSTDNHFFAVRSVGKNGARSIAVPSEMERRGPPLPTKAKE* |
Ga0126378_113295181 | 3300010361 | Tropical Forest Soil | NHFFAVRSVGKNGARSIAVPTEMERRTPPGPTPARQ* |
Ga0126381_1016103812 | 3300010376 | Tropical Forest Soil | VSTDNHFFAVRSVGKNGARSIAVLTEMERRTPPGPTPAKQ* |
Ga0126345_11230181 | 3300010858 | Boreal Forest Soil | AAGETVLKGVSTDNHFFAVRAVGKNGSRSIAVPTEMERRPPPLPAPSKQ* |
Ga0150983_134501472 | 3300011120 | Forest Soil | DNHFFAVRAVGKNGARSIAVPTEIERRPPPLSTPSKQ* |
Ga0150983_137272181 | 3300011120 | Forest Soil | TDNHFFAVRAVGKNGARSIAVPTEMERRPPPLPAGTKQ* |
Ga0137392_107324342 | 3300011269 | Vadose Zone Soil | HFFAVRAVGKNGARSIAVPTEIERRAPPLPSPSKQ* |
Ga0137391_105217622 | 3300011270 | Vadose Zone Soil | ETVLKNVSTDNHFFAVRAVGKNGARSIAVPTEIERRPPPLPSPSKQ* |
Ga0137391_108025591 | 3300011270 | Vadose Zone Soil | DNHFFAVRAVGKNGARSIAVPTEMERRPPPTPTGTKQ* |
Ga0137391_114531251 | 3300011270 | Vadose Zone Soil | VSTDNHFFAVRAVGKNGARSIAVPTEMERRPPPLPAPSKQ* |
Ga0137393_103420192 | 3300011271 | Vadose Zone Soil | TLLKGVSTDNHFFAVRAVGKNGARSIAVPTEIERRPPPLPSPSKQ* |
Ga0137393_114207561 | 3300011271 | Vadose Zone Soil | DNHFFAVRAVGKNGARSIAVPTEVERRPPPLPAGTKQ* |
Ga0137389_101711541 | 3300012096 | Vadose Zone Soil | ETVLRGVSTDNHFFAVRAVGKNGARSIAVPTEMERRPPPLPAGTKQ* |
Ga0153990_10464652 | 3300012169 | Attine Ant Fungus Gardens | HFFAVRSVGKNGARSIAVPTEMERRPPPLPAGTKQ* |
Ga0137388_103764392 | 3300012189 | Vadose Zone Soil | RGVSTDNHFFAVRAVGKNGARSIAVPTEMERRPPPLPAGIKQ* |
Ga0137388_108032951 | 3300012189 | Vadose Zone Soil | TVLHGVSTDNHFFAVRAVGKNGARSIAVPTEVERRPPPLPVGTKQ* |
Ga0137382_102868363 | 3300012200 | Vadose Zone Soil | ILKGVSTDNHFFAIRAAGKNGARSIAVPTEMERRSPPLPAASKQ* |
Ga0137399_103164912 | 3300012203 | Vadose Zone Soil | KGASTDNHFFAVRAVGKNGARSIAVPTEIERRPPPSASTK* |
Ga0137362_106086141 | 3300012205 | Vadose Zone Soil | TDNHFFAIRAAGKNGARSIAVPTEMERRSSPLPAASKQ* |
Ga0137376_112324731 | 3300012208 | Vadose Zone Soil | NHFFAIRAAGKNGARSIAVPTEMERRSPPLPAASKQ* |
Ga0137377_104923841 | 3300012211 | Vadose Zone Soil | DNHFFAIRAAGKNGARSIAVPTEMERRPPPLPAASKQ* |
Ga0137370_101057523 | 3300012285 | Vadose Zone Soil | STDNHFFAVRAVGKNGARSIAVPTEMERRPPPLPAASKQ* |
Ga0137387_111428452 | 3300012349 | Vadose Zone Soil | TDNHFFAVRAVGKNGARSIAVPTEMERRPPPLPASPKQ* |
Ga0137372_108250521 | 3300012350 | Vadose Zone Soil | TVLKGVSTDNHFFAVRAVGKNGARSIAVATEIERRPSPMPTGTKQ* |
Ga0137371_105376801 | 3300012356 | Vadose Zone Soil | GVSTDNHFFAVRSVGKNGARSIAVPTEMERRPPPLPSGTKQ* |
Ga0137385_114279902 | 3300012359 | Vadose Zone Soil | KGVSTDNHFFAVRAVGKNGARSIAVPTEMERRPPPLPASPKQ* |
Ga0137361_108501292 | 3300012362 | Vadose Zone Soil | VSTDNHFFAIRAAGKNGARSIAVPTEMERRPPLPASKQ* |
Ga0137361_112361591 | 3300012362 | Vadose Zone Soil | VSTDNHFFAVRAVGKNGARSIAVPTEMERRPPPQPTPSKQ* |
Ga0137358_105981983 | 3300012582 | Vadose Zone Soil | TDNHFFAMRAVGKNGARSIAVATEIERHPPPTGTKQ* |
Ga0137395_101342091 | 3300012917 | Vadose Zone Soil | SGETVLQGVSTDNHFFAVRSVGKNGALSIAVPTEMKRRPQPLPSGTKQ* |
Ga0137394_102501431 | 3300012922 | Vadose Zone Soil | TVLKGVSTDNHFFAVRAVGRNGARSIAVPTEIERRPPPQPAPTKQ* |
Ga0137413_115436171 | 3300012924 | Vadose Zone Soil | VLKGVSTDNHFFAVRAVGKNGARSIAVPTEIERRPPPLPTPAKQ* |
Ga0137419_101842763 | 3300012925 | Vadose Zone Soil | ETVLNGVSTDNHFFAVRAVGKNGARSIAVPTEMERRPPPLPTPGKQ* |
Ga0137416_117993662 | 3300012927 | Vadose Zone Soil | VSTDNHFFAVRSVGKNGARSIAVIAEAERRAPPLPTKQKQ* |
Ga0137416_120023522 | 3300012927 | Vadose Zone Soil | DNHFFAVRAVGKNGARSIAVPTEIERRAPPLPTPSKQ* |
Ga0137404_108057203 | 3300012929 | Vadose Zone Soil | LKGVSTDNHFFAVRAVGKNGARSIAVATEIERRPPPMPTGTKQ* |
Ga0137404_113696212 | 3300012929 | Vadose Zone Soil | STDNHFFAVRAVGKNGARSIAVVTEIERRPPPLPTKK* |
Ga0137404_115357721 | 3300012929 | Vadose Zone Soil | TVLKGVSTDNHFFAVRAVGKNGARTIAVPTEIERRPPPQPTPTK* |
Ga0137407_104875302 | 3300012930 | Vadose Zone Soil | DNHFFAVRAVGKNGARSIAVPTEMERRPPPQPTPSKQ* |
Ga0137410_102286961 | 3300012944 | Vadose Zone Soil | DVSTDNHFFAVRSVGKNGARSIATASQPQVRRAPPIDKK* |
Ga0164302_114504323 | 3300012961 | Soil | GQTVLKNVSTDNHFFAVRSVGRNGARSIAVVTEIERRPIPGAQNK* |
Ga0134110_105356101 | 3300012975 | Grasslands Soil | ETVLKGVSTDNHFFAVRAVGKNGARSIAVPTEMERRAPPLPTPSKQ* |
Ga0134087_100467353 | 3300012977 | Grasslands Soil | STDNHFFAVRAVGKNGARSIAVPTEMERRALPLPTPSKQ* |
Ga0137411_11682116 | 3300015052 | Vadose Zone Soil | GETVLKGVSTDNHFFAIRAAGKNGARSIAVPTEMERRRPPLPASKQ* |
Ga0137409_110233031 | 3300015245 | Vadose Zone Soil | ISTDNHFFAVRAVGKNGARSIAVPTEIERRAPPLPTPSKQ* |
Ga0132258_127951703 | 3300015371 | Arabidopsis Rhizosphere | GKTVLKNVSTDNHFFAVRSVGRNGARSIAVVTEIERRPIPGTQKK* |
Ga0132257_1012912623 | 3300015373 | Arabidopsis Rhizosphere | LKAVSTDNHFFAVRAVGRNGARSLAVPTEMERRGPPLPTATKQ* |
Ga0182041_120137212 | 3300016294 | Soil | STDNHFFAVRAVGKNGARSLAVPTEMERRAPPGPTPAKQ |
Ga0182034_116693241 | 3300016371 | Soil | RVSTDNHFFAVRAVGKNGARSIAVPTEIERRPPPLPTNK |
Ga0187818_103908792 | 3300017823 | Freshwater Sediment | STDNHFFAVRSVGKNGARSIAVPTEMERRPPPGPTATKQ |
Ga0187785_102035351 | 3300017947 | Tropical Peatland | ETILKGVSTDNHFFAVRALGKNGARSIAVPTEPGQRTTPSVVKK |
Ga0193726_13549091 | 3300020021 | Soil | HFFAVRSVGKNGARSIAVISEAERRAPPLPAKQKQ |
Ga0179592_103431591 | 3300020199 | Vadose Zone Soil | TVLKGVSTDNHFFAVRSVGKNGARSIAVPTEMEHRPIPGTKK |
Ga0210407_110646411 | 3300020579 | Soil | KGGATDNHFFAVRSVGKNGARSIAVIAEAERRAPPLPTAPKQ |
Ga0210403_105096581 | 3300020580 | Soil | ETVLKSISTDNHFFAVRAVGKNGARSIAVPTEMERRPPPLPTPAPTKQ |
Ga0210403_106668981 | 3300020580 | Soil | DNHFFAVRAVGKNGARSIAVPTEIERRPPPLPAATKQQ |
Ga0210403_109078922 | 3300020580 | Soil | TDNHFFAVRAVGKNGARSIAVVTEIERRPSPLPTKR |
Ga0210403_111819612 | 3300020580 | Soil | VSTDNHFFAVRSVGKNGARSIAVIAEAERRAPPLPTAPKQ |
Ga0210399_106442503 | 3300020581 | Soil | KGVSTDNHFFAVRAVGKNGARSIAVPTEMERRGPPLPAGTKQ |
Ga0210401_104013193 | 3300020583 | Soil | VLKGVSTDNHFFAVRSVGKNGARSIAVPTEMERRPIPGTTKK |
Ga0179596_100025301 | 3300021086 | Vadose Zone Soil | GEAVLKGVSTDNHFFAVRAVGKNGARSIAVPTEMERRPPPLPSAPKQ |
Ga0210406_102191991 | 3300021168 | Soil | HFFAVRAVGKNGARSIAVPTEMERRPPPLPAGTKQ |
Ga0210406_110220392 | 3300021168 | Soil | AGETVLHGVSTDNHFFAVRAVGKNGARSIAVPTEMERRPPPLPAGTKQ |
Ga0210405_102576791 | 3300021171 | Soil | RGVSTDNHFFAVRAVGKNGARSIAVPTEMERRPPPLPAGTKHQ |
Ga0210405_105859721 | 3300021171 | Soil | VLKGVSTDNHFFAVRAVGKNGARSIAVPTEIERRPPPVPAPSKQ |
Ga0210408_100366215 | 3300021178 | Soil | TVLHGVSTDNHFFAVRAVGKNGARSIAVPTEMERRPPPLPAGTKQ |
Ga0210393_106901033 | 3300021401 | Soil | LLKGVSTDNHFFAVRSVGKNGARSIAVPTEMERRPIPGTTKK |
Ga0210385_102698621 | 3300021402 | Soil | VLKDVSTDNHFFAVRSVGKNGARSIAVISEAERRAPPTPTAPKQ |
Ga0210389_108897921 | 3300021404 | Soil | KGVSTDNHFFAVRAVGKNGARSIAVPTEMERRPPPLPSAPKQ |
Ga0210394_102289675 | 3300021420 | Soil | LKGVSTDNHFFAVRSVGKNGARSIAVIAEAERRAPPLPSNAPKQ |
Ga0210384_112951422 | 3300021432 | Soil | ETVLKSVSTDNHFFAVRAVGKNGARSIAVPTEMERRPPPLPSQPKQ |
Ga0187846_104371582 | 3300021476 | Biofilm | NVSTDNHFFAVRSVGKNGARSIAVITEMQRRPPPLPANTPKQ |
Ga0210398_111559702 | 3300021477 | Soil | LNGVSTDNHFFAVRAVGKNGARSIAVPTDVERLPIPGTTRK |
Ga0210402_107131801 | 3300021478 | Soil | NGVSTDNHFFAVRAVGKNGARSIATASQPEVRRAPPIDKK |
Ga0210410_105786691 | 3300021479 | Soil | VSTDNHFFAVRSVGKNGARSIAVPTEMERRPIPGTTKK |
Ga0126371_112198921 | 3300021560 | Tropical Forest Soil | TDNHFFAVRAVGRNGARSIAVPTEIERRAPPGPTPAKQ |
Ga0126371_132518092 | 3300021560 | Tropical Forest Soil | STDNHFFAVRSVGKNGARSIAVPSEMERRGPPLPTKAKE |
Ga0247680_10333122 | 3300024246 | Soil | QTVLKNVSTDNHFFAVRSVGKNGARSIAVIAEAERRAPPLPSAPKQ |
Ga0247681_10427521 | 3300024310 | Soil | SVSTDNHFFAVRAVGKNGARSVAVPTEMERRGPPLPAGTKQ |
Ga0137417_14356383 | 3300024330 | Vadose Zone Soil | LKGVSTDNHFFAVRAVGKNGARSIAVPTEIERRTPPQPAPTKQ |
Ga0207699_101069024 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | ISTDNHYFAVRAVGKNGARSIAIPTEPLRRRPAPEKK |
Ga0207663_102924021 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | PGETVLRGVSTDNHFFAVRSVGKNGARSIAVPTEMERRPPPQPTPNKQ |
Ga0207703_100420506 | 3300026035 | Switchgrass Rhizosphere | STDNHFFAVRAVGKSGARSIAVPTEMERRGPPLPATPK |
Ga0207676_115775232 | 3300026095 | Switchgrass Rhizosphere | AAGQTVLKGVSTDNHFFAVRSVGKNGARSIAVVTEMERRPIPGTQKK |
Ga0209265_10574781 | 3300026308 | Soil | NHFFAVRSVGKNGARSIAVPTEMERRPPPGPTRSNQ |
Ga0209377_12483042 | 3300026334 | Soil | PGETILKGVSTDNHFFALRAVGKNGARSIAVPTELERRPPPLPTPAKQ |
Ga0257157_10956191 | 3300026496 | Soil | LKGVSTDNHFFAVRAVGKNGARSIAMPTEMERRPPPLPTSTK |
Ga0257181_10352503 | 3300026499 | Soil | VLKGVSTDNHFFAVRAVGKNGARSIAVPTEMERRPPPLPSGTKQ |
Ga0209156_100565875 | 3300026547 | Soil | GVSTDNHFFAVRAVGKNAARSIAVPTEIERRPPPQPTPTK |
Ga0209156_103942381 | 3300026547 | Soil | STDNHFFAVRAVGKSGARSIAIPTEIERRPPPLPSAPNQ |
Ga0209648_104262571 | 3300026551 | Grasslands Soil | TDNHFFAVRAVGKNGARSIAAPTEMERRPPPLPTGTKQ |
Ga0209577_105170202 | 3300026552 | Soil | NHFFAVRSVGKNGARSLAVPTEMERTGPPLPTPPKQ |
Ga0179593_12432001 | 3300026555 | Vadose Zone Soil | VAGETVLKGVSTDNHFFAVRAVGKNGARSIAVPTEMERRPPPLPSPSKQ |
Ga0209325_10362962 | 3300027050 | Forest Soil | AILQGVSTDNHFFAVRSVGKNGARSIAVPTEMERRTPPGPAKQ |
Ga0209422_10482521 | 3300027629 | Forest Soil | GETVLKGVSTDNHFFAVRSVGKNGARSIAAPTEMERRPPPLPAGAKQ |
Ga0209076_10016331 | 3300027643 | Vadose Zone Soil | LKNVSTDNHFFAVRAVGKNGARSIAVPTEIERRPPPLPSPSKQ |
Ga0209447_100363913 | 3300027701 | Bog Forest Soil | LKDVSTDNHYFAVRSVGKNGARSIAVISEAERRAPPTPTTPKQ |
Ga0209274_100745834 | 3300027853 | Soil | ETVLKGVSTDNHFFAVRSVGKNGARSIAVPTEMERRPVPGTTKK |
Ga0209693_105887921 | 3300027855 | Soil | VLKDVSTDNHFFAVRSVGKNGARSIAVISEAERRAPPLPSAPKQ |
Ga0209590_110714342 | 3300027882 | Vadose Zone Soil | TVLKGVSTDNHFFAVRAVDKNGARSIAAPTEMERRPPPLPTGTKQ |
Ga0209624_105877931 | 3300027895 | Forest Soil | STDNHFFAVRSVGKNGARSIAVPTEMERRPIPGTTKK |
Ga0137415_101837011 | 3300028536 | Vadose Zone Soil | KGVSTDNHFFAVRAVGKNGARSIAVPTEMERRPPPLPSPSKQ |
Ga0222749_107286791 | 3300029636 | Soil | TDNHFFAVRSVGKNGARSIAVISEAERRAPPLPSAPKQ |
Ga0170834_1005554432 | 3300031057 | Forest Soil | GQTVLKGVSTDNHFFAVRAVGKNGARSIAVVTEIERRPPPLPTKK |
Ga0170834_1055284331 | 3300031057 | Forest Soil | TDNHFFAVRAVGKNGARSIAVVTEIERRPPPLPTKK |
Ga0170820_146180642 | 3300031446 | Forest Soil | SAWQTVLKGVSTDNHFFAVRAVGKNGARSIAVVTEIERRPPPMPTKK |
Ga0307476_103001041 | 3300031715 | Hardwood Forest Soil | TVLKGVSTDNHFFAVRSVGENGARSIAVPTEMERRPPPQPTPSKQ |
Ga0310813_112569281 | 3300031716 | Soil | VSTDNHFFAVRSVGKNGARSIAVIAEAERRAPPLPSAPKQ |
Ga0307474_109356392 | 3300031718 | Hardwood Forest Soil | RGVSTDNHFFAVRAVGKNGARSIAVPTEMERRPPPQPAGTKQ |
Ga0306917_106513051 | 3300031719 | Soil | NHFFAVRSVGKTGARSIAVPTEIEPRGPLAPAKSKQ |
Ga0307469_101978571 | 3300031720 | Hardwood Forest Soil | TDNHFFAVRAVGKNGARSIAVVTEIERRPPPMPTGTKQ |
Ga0307477_106606051 | 3300031753 | Hardwood Forest Soil | TDNHFFAVRAVGKNGARSIAVPTEIERRPPPLPAATKQQ |
Ga0318543_103909592 | 3300031777 | Soil | AVLKGVSTDNHFFAVRSVGKNGARSIAVPTEMERRTPPGPTPTKQ |
Ga0318552_106369152 | 3300031782 | Soil | PGEAVLKGVSTDNHFFAVRSVGKNGARSIAVPTEMERRTPPGPTPAKQ |
Ga0318512_100964682 | 3300031846 | Soil | GEAVLKGVSTDNHFFAVRSVGKNGARSIAVPTEMERRTPPGPTPAKQ |
Ga0306925_100928901 | 3300031890 | Soil | ALPRVSTDNHFFAVRAVGKNGARSIAVPTEIERRPPPLPTNK |
Ga0307479_119038111 | 3300031962 | Hardwood Forest Soil | LKGVSTDNHFFAVRSVGKNGARSIAIPASAPRTPPFPTSGQPAK |
Ga0318531_105389391 | 3300031981 | Soil | VLKGVSTDNHFFAVRSVGKTGARSIAVPTEIEPRGPLAPAKSKQ |
Ga0318506_101331671 | 3300032052 | Soil | VSTDNHFFAVRSVGKNGARSIAVPTEMERRTPPGPTPAKQ |
Ga0307470_103558551 | 3300032174 | Hardwood Forest Soil | KGVSTDNHFFAVRAVGKNGARSIAVVTEIERRPPPLPTKK |
Ga0307471_1006606942 | 3300032180 | Hardwood Forest Soil | VSTDNHFFAVRAVGKNGARSIAVPTEIERRPPPLPAGTKQ |
Ga0307472_1002522552 | 3300032205 | Hardwood Forest Soil | PGETVLKGVSTDNHFFAVRAAGKNGARSIAVPTEMERRPPPLPAGTKQ |
Ga0335069_1001729011 | 3300032893 | Soil | TDNHFFAVRSVGKNGARSIAVPTEMERRGPPGPAKAKQ |
Ga0335076_103670414 | 3300032955 | Soil | TDNHYFAVRSVGKNGARSIAVVAEAERRAPPTPTNAPKQ |
⦗Top⦘ |