| Basic Information | |
|---|---|
| Family ID | F035924 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 171 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MVRHLHHWLDMVEALLIIGILLAIAWVTWQALTQAYSPVFNLFNKF |
| Number of Associated Samples | 118 |
| Number of Associated Scaffolds | 171 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 79.53 % |
| % of genes near scaffold ends (potentially truncated) | 23.98 % |
| % of genes from short scaffolds (< 2000 bps) | 71.93 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (52.632 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (19.298 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.579 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.895 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 59.46% β-sheet: 0.00% Coil/Unstructured: 40.54% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 171 Family Scaffolds |
|---|---|---|
| PF01966 | HD | 43.27 |
| PF13602 | ADH_zinc_N_2 | 8.77 |
| PF00005 | ABC_tran | 7.02 |
| PF01551 | Peptidase_M23 | 2.92 |
| PF14329 | DUF4386 | 2.34 |
| PF02909 | TetR_C_1 | 1.75 |
| PF03009 | GDPD | 1.17 |
| PF07883 | Cupin_2 | 1.17 |
| PF02810 | SEC-C | 1.17 |
| PF02687 | FtsX | 1.17 |
| PF02771 | Acyl-CoA_dh_N | 1.17 |
| PF01243 | Putative_PNPOx | 1.17 |
| PF13011 | LZ_Tnp_IS481 | 1.17 |
| PF00196 | GerE | 1.17 |
| PF02358 | Trehalose_PPase | 0.58 |
| PF02729 | OTCace_N | 0.58 |
| PF00127 | Copper-bind | 0.58 |
| PF03737 | RraA-like | 0.58 |
| PF00528 | BPD_transp_1 | 0.58 |
| PF07969 | Amidohydro_3 | 0.58 |
| PF10418 | DHODB_Fe-S_bind | 0.58 |
| PF00480 | ROK | 0.58 |
| PF13683 | rve_3 | 0.58 |
| PF13495 | Phage_int_SAM_4 | 0.58 |
| PF07685 | GATase_3 | 0.58 |
| PF13473 | Cupredoxin_1 | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 171 Family Scaffolds |
|---|---|---|---|
| COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 1.75 |
| COG0584 | Glycerophosphoryl diester phosphodiesterase | Lipid transport and metabolism [I] | 1.17 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.17 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 1.17 |
| COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.63 % |
| Unclassified | root | N/A | 47.37 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000878|AL9A1W_1322546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 763 | Open in IMG/M |
| 3300001086|JGI12709J13192_1005331 | Not Available | 1310 | Open in IMG/M |
| 3300001086|JGI12709J13192_1012425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Gloeobacteria → Gloeobacterales → Gloeobacteraceae → Gloeobacter → Gloeobacter kilaueensis → Gloeobacter kilaueensis JS1 | 676 | Open in IMG/M |
| 3300001174|JGI12679J13547_1003181 | Not Available | 914 | Open in IMG/M |
| 3300001536|A1565W1_10355524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1682 | Open in IMG/M |
| 3300001661|JGI12053J15887_10231161 | Not Available | 926 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100128144 | Not Available | 2393 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101351615 | Not Available | 604 | Open in IMG/M |
| 3300002557|JGI25381J37097_1004089 | All Organisms → cellular organisms → Bacteria | 2520 | Open in IMG/M |
| 3300002915|JGI25387J43893_1040876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 634 | Open in IMG/M |
| 3300005166|Ga0066674_10127765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1192 | Open in IMG/M |
| 3300005166|Ga0066674_10471842 | Not Available | 570 | Open in IMG/M |
| 3300005167|Ga0066672_10092357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1831 | Open in IMG/M |
| 3300005167|Ga0066672_10590770 | Not Available | 719 | Open in IMG/M |
| 3300005171|Ga0066677_10013859 | All Organisms → cellular organisms → Bacteria | 3573 | Open in IMG/M |
| 3300005171|Ga0066677_10187709 | Not Available | 1151 | Open in IMG/M |
| 3300005171|Ga0066677_10737069 | Not Available | 549 | Open in IMG/M |
| 3300005174|Ga0066680_10047120 | All Organisms → cellular organisms → Bacteria | 2517 | Open in IMG/M |
| 3300005174|Ga0066680_10393758 | Not Available | 881 | Open in IMG/M |
| 3300005174|Ga0066680_10439912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 825 | Open in IMG/M |
| 3300005176|Ga0066679_10345895 | Not Available | 971 | Open in IMG/M |
| 3300005176|Ga0066679_11012932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 516 | Open in IMG/M |
| 3300005177|Ga0066690_10266941 | Not Available | 1151 | Open in IMG/M |
| 3300005179|Ga0066684_10327134 | Not Available | 1022 | Open in IMG/M |
| 3300005435|Ga0070714_100014324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6368 | Open in IMG/M |
| 3300005445|Ga0070708_100015982 | All Organisms → cellular organisms → Bacteria | 6215 | Open in IMG/M |
| 3300005445|Ga0070708_101057242 | Not Available | 761 | Open in IMG/M |
| 3300005445|Ga0070708_101407320 | Not Available | 650 | Open in IMG/M |
| 3300005454|Ga0066687_10006244 | All Organisms → cellular organisms → Bacteria | 4301 | Open in IMG/M |
| 3300005454|Ga0066687_10052604 | All Organisms → cellular organisms → Bacteria | 1905 | Open in IMG/M |
| 3300005454|Ga0066687_10410698 | Not Available | 785 | Open in IMG/M |
| 3300005467|Ga0070706_100005051 | All Organisms → cellular organisms → Bacteria | 12611 | Open in IMG/M |
| 3300005468|Ga0070707_100000113 | All Organisms → cellular organisms → Bacteria | 74709 | Open in IMG/M |
| 3300005468|Ga0070707_100001236 | All Organisms → cellular organisms → Bacteria | 25083 | Open in IMG/M |
| 3300005468|Ga0070707_100005446 | All Organisms → cellular organisms → Bacteria | 11904 | Open in IMG/M |
| 3300005468|Ga0070707_101506226 | Not Available | 639 | Open in IMG/M |
| 3300005471|Ga0070698_100010173 | All Organisms → cellular organisms → Bacteria | 10049 | Open in IMG/M |
| 3300005536|Ga0070697_100000008 | All Organisms → cellular organisms → Bacteria | 191922 | Open in IMG/M |
| 3300005536|Ga0070697_100107323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2323 | Open in IMG/M |
| 3300005536|Ga0070697_100709563 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300005542|Ga0070732_10572524 | Not Available | 685 | Open in IMG/M |
| 3300005555|Ga0066692_10482897 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300005558|Ga0066698_10105936 | All Organisms → cellular organisms → Bacteria | 1860 | Open in IMG/M |
| 3300005561|Ga0066699_10003927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 6272 | Open in IMG/M |
| 3300005937|Ga0081455_10236783 | Not Available | 1344 | Open in IMG/M |
| 3300006028|Ga0070717_10090464 | All Organisms → cellular organisms → Bacteria | 2583 | Open in IMG/M |
| 3300006028|Ga0070717_10176665 | Not Available | 1859 | Open in IMG/M |
| 3300006032|Ga0066696_10528326 | Not Available | 773 | Open in IMG/M |
| 3300006041|Ga0075023_100106860 | Not Available | 976 | Open in IMG/M |
| 3300006173|Ga0070716_100082244 | All Organisms → cellular organisms → Bacteria | 1925 | Open in IMG/M |
| 3300006173|Ga0070716_101203367 | Not Available | 608 | Open in IMG/M |
| 3300006173|Ga0070716_101532283 | Not Available | 546 | Open in IMG/M |
| 3300007740|Ga0104326_123233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1699 | Open in IMG/M |
| 3300007982|Ga0102924_1064877 | All Organisms → cellular organisms → Bacteria | 2025 | Open in IMG/M |
| 3300007982|Ga0102924_1258144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 715 | Open in IMG/M |
| 3300009012|Ga0066710_101679897 | Not Available | 968 | Open in IMG/M |
| 3300009038|Ga0099829_10342758 | Not Available | 1229 | Open in IMG/M |
| 3300009038|Ga0099829_11229419 | Not Available | 620 | Open in IMG/M |
| 3300009038|Ga0099829_11387431 | Not Available | 580 | Open in IMG/M |
| 3300009088|Ga0099830_10517483 | Not Available | 974 | Open in IMG/M |
| 3300009089|Ga0099828_10075538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2864 | Open in IMG/M |
| 3300009089|Ga0099828_11787209 | Not Available | 540 | Open in IMG/M |
| 3300009090|Ga0099827_10303563 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
| 3300010113|Ga0127444_1120440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 582 | Open in IMG/M |
| 3300010333|Ga0134080_10589634 | Not Available | 539 | Open in IMG/M |
| 3300010336|Ga0134071_10009296 | All Organisms → cellular organisms → Bacteria | 3895 | Open in IMG/M |
| 3300011269|Ga0137392_10052623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3070 | Open in IMG/M |
| 3300011269|Ga0137392_10632313 | Not Available | 888 | Open in IMG/M |
| 3300011270|Ga0137391_10015718 | Not Available | 6155 | Open in IMG/M |
| 3300011270|Ga0137391_11368439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 554 | Open in IMG/M |
| 3300011401|Ga0153984_1046917 | Not Available | 926 | Open in IMG/M |
| 3300011992|Ga0120146_1005833 | All Organisms → cellular organisms → Bacteria | 3005 | Open in IMG/M |
| 3300011996|Ga0120156_1023120 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300011998|Ga0120114_1043510 | Not Available | 889 | Open in IMG/M |
| 3300012001|Ga0120167_1049215 | Not Available | 932 | Open in IMG/M |
| 3300012014|Ga0120159_1071851 | Not Available | 1035 | Open in IMG/M |
| 3300012096|Ga0137389_10833446 | Not Available | 792 | Open in IMG/M |
| 3300012198|Ga0137364_10457373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 958 | Open in IMG/M |
| 3300012205|Ga0137362_10524390 | Not Available | 1024 | Open in IMG/M |
| 3300012206|Ga0137380_10039236 | All Organisms → cellular organisms → Bacteria | 4367 | Open in IMG/M |
| 3300012208|Ga0137376_10109409 | All Organisms → cellular organisms → Bacteria | 2349 | Open in IMG/M |
| 3300012208|Ga0137376_10285292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1433 | Open in IMG/M |
| 3300012208|Ga0137376_11253819 | Not Available | 631 | Open in IMG/M |
| 3300012359|Ga0137385_10403942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1164 | Open in IMG/M |
| 3300012363|Ga0137390_10936099 | Not Available | 820 | Open in IMG/M |
| 3300012388|Ga0134031_1015685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 605 | Open in IMG/M |
| 3300012409|Ga0134045_1079117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 996 | Open in IMG/M |
| 3300012685|Ga0137397_10370625 | Not Available | 1067 | Open in IMG/M |
| 3300012917|Ga0137395_10173151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1490 | Open in IMG/M |
| 3300012917|Ga0137395_10823444 | Not Available | 672 | Open in IMG/M |
| 3300012923|Ga0137359_10775704 | Not Available | 832 | Open in IMG/M |
| 3300012927|Ga0137416_10007473 | All Organisms → cellular organisms → Bacteria | 6341 | Open in IMG/M |
| 3300012927|Ga0137416_11394004 | Not Available | 635 | Open in IMG/M |
| 3300012927|Ga0137416_11668584 | Not Available | 581 | Open in IMG/M |
| 3300012927|Ga0137416_12178847 | Not Available | 510 | Open in IMG/M |
| 3300013763|Ga0120179_1001182 | All Organisms → cellular organisms → Bacteria | 9089 | Open in IMG/M |
| 3300014058|Ga0120149_1159137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 624 | Open in IMG/M |
| 3300014058|Ga0120149_1176084 | Not Available | 594 | Open in IMG/M |
| 3300015356|Ga0134073_10103068 | Not Available | 846 | Open in IMG/M |
| 3300018431|Ga0066655_10022412 | All Organisms → cellular organisms → Bacteria | 2960 | Open in IMG/M |
| 3300018433|Ga0066667_10438204 | Not Available | 1065 | Open in IMG/M |
| 3300018433|Ga0066667_10539945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 966 | Open in IMG/M |
| 3300018468|Ga0066662_10206072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1561 | Open in IMG/M |
| 3300018468|Ga0066662_10886842 | Not Available | 874 | Open in IMG/M |
| 3300018468|Ga0066662_12552383 | Not Available | 539 | Open in IMG/M |
| 3300018468|Ga0066662_12853241 | Not Available | 513 | Open in IMG/M |
| 3300018482|Ga0066669_10608367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 958 | Open in IMG/M |
| 3300018482|Ga0066669_12400628 | Not Available | 505 | Open in IMG/M |
| 3300021046|Ga0215015_10105887 | All Organisms → cellular organisms → Bacteria | 4098 | Open in IMG/M |
| 3300021046|Ga0215015_10194477 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300021046|Ga0215015_11100664 | All Organisms → cellular organisms → Bacteria | 2307 | Open in IMG/M |
| 3300021479|Ga0210410_10126001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2273 | Open in IMG/M |
| 3300022557|Ga0212123_10000916 | All Organisms → cellular organisms → Bacteria | 88536 | Open in IMG/M |
| 3300022557|Ga0212123_10041648 | All Organisms → cellular organisms → Bacteria | 4406 | Open in IMG/M |
| 3300022557|Ga0212123_10163794 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
| 3300025910|Ga0207684_10000071 | All Organisms → cellular organisms → Bacteria | 185783 | Open in IMG/M |
| 3300025910|Ga0207684_10002182 | All Organisms → cellular organisms → Bacteria | 20034 | Open in IMG/M |
| 3300025922|Ga0207646_10000406 | All Organisms → cellular organisms → Bacteria | 57756 | Open in IMG/M |
| 3300025922|Ga0207646_10001036 | All Organisms → cellular organisms → Bacteria | 35478 | Open in IMG/M |
| 3300025939|Ga0207665_10408102 | Not Available | 1036 | Open in IMG/M |
| 3300025939|Ga0207665_11165713 | Not Available | 615 | Open in IMG/M |
| 3300026295|Ga0209234_1029585 | All Organisms → cellular organisms → Bacteria | 2079 | Open in IMG/M |
| 3300026296|Ga0209235_1040303 | All Organisms → cellular organisms → Bacteria | 2332 | Open in IMG/M |
| 3300026310|Ga0209239_1365628 | Not Available | 506 | Open in IMG/M |
| 3300026315|Ga0209686_1000283 | All Organisms → cellular organisms → Bacteria | 26618 | Open in IMG/M |
| 3300026315|Ga0209686_1056559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1420 | Open in IMG/M |
| 3300026318|Ga0209471_1185218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 813 | Open in IMG/M |
| 3300026322|Ga0209687_1137997 | Not Available | 785 | Open in IMG/M |
| 3300026328|Ga0209802_1251965 | Not Available | 605 | Open in IMG/M |
| 3300026328|Ga0209802_1331040 | Not Available | 503 | Open in IMG/M |
| 3300026335|Ga0209804_1113166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1237 | Open in IMG/M |
| 3300026335|Ga0209804_1166519 | Not Available | 970 | Open in IMG/M |
| 3300026524|Ga0209690_1085962 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
| 3300026527|Ga0209059_1032413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2360 | Open in IMG/M |
| 3300026527|Ga0209059_1130806 | Not Available | 943 | Open in IMG/M |
| 3300026528|Ga0209378_1187988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 714 | Open in IMG/M |
| 3300026542|Ga0209805_1380367 | Not Available | 541 | Open in IMG/M |
| 3300026548|Ga0209161_10211406 | Not Available | 1059 | Open in IMG/M |
| 3300026551|Ga0209648_10620435 | Not Available | 593 | Open in IMG/M |
| 3300026552|Ga0209577_10018911 | All Organisms → cellular organisms → Bacteria | 6122 | Open in IMG/M |
| 3300027480|Ga0208993_1028532 | Not Available | 988 | Open in IMG/M |
| 3300027521|Ga0209524_1001905 | All Organisms → cellular organisms → Bacteria | 3614 | Open in IMG/M |
| 3300027521|Ga0209524_1056549 | Not Available | 825 | Open in IMG/M |
| 3300027535|Ga0209734_1000360 | All Organisms → cellular organisms → Bacteria | 6447 | Open in IMG/M |
| 3300027537|Ga0209419_1109199 | Not Available | 551 | Open in IMG/M |
| 3300027546|Ga0208984_1008110 | All Organisms → cellular organisms → Bacteria | 1950 | Open in IMG/M |
| 3300027565|Ga0209219_1051956 | Not Available | 1023 | Open in IMG/M |
| 3300027587|Ga0209220_1004435 | All Organisms → cellular organisms → Bacteria | 3761 | Open in IMG/M |
| 3300027591|Ga0209733_1049193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1117 | Open in IMG/M |
| 3300027629|Ga0209422_1139184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 548 | Open in IMG/M |
| 3300027633|Ga0208988_1087397 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300027651|Ga0209217_1119189 | Not Available | 744 | Open in IMG/M |
| 3300027674|Ga0209118_1081366 | Not Available | 927 | Open in IMG/M |
| 3300027681|Ga0208991_1116938 | Not Available | 796 | Open in IMG/M |
| 3300027748|Ga0209689_1060423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2079 | Open in IMG/M |
| 3300027835|Ga0209515_10386183 | Not Available | 754 | Open in IMG/M |
| 3300027842|Ga0209580_10133548 | Not Available | 1215 | Open in IMG/M |
| 3300027846|Ga0209180_10150773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1339 | Open in IMG/M |
| 3300027875|Ga0209283_10482108 | Not Available | 800 | Open in IMG/M |
| 3300027882|Ga0209590_10063588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2101 | Open in IMG/M |
| 3300027903|Ga0209488_10515064 | Not Available | 875 | Open in IMG/M |
| 3300028047|Ga0209526_10246453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1224 | Open in IMG/M |
| 3300028047|Ga0209526_10348731 | Not Available | 992 | Open in IMG/M |
| 3300028536|Ga0137415_10658902 | Not Available | 859 | Open in IMG/M |
| 3300028673|Ga0257175_1120430 | Not Available | 523 | Open in IMG/M |
| 3300030991|Ga0073994_12062635 | Not Available | 644 | Open in IMG/M |
| 3300031753|Ga0307477_10138915 | All Organisms → cellular organisms → Bacteria | 1695 | Open in IMG/M |
| 3300031820|Ga0307473_10353829 | Not Available | 946 | Open in IMG/M |
| 3300031962|Ga0307479_10001002 | All Organisms → cellular organisms → Bacteria | 25552 | Open in IMG/M |
| 3300031962|Ga0307479_10081440 | All Organisms → cellular organisms → Bacteria | 3133 | Open in IMG/M |
| 3300032180|Ga0307471_100232098 | All Organisms → cellular organisms → Bacteria | 1881 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 18.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 13.45% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 12.87% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 9.36% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 5.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.34% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.75% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.17% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.58% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.58% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.58% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.58% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000878 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-5 cm-9A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001086 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 | Environmental | Open in IMG/M |
| 3300001174 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 | Environmental | Open in IMG/M |
| 3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300007740 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-9-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300010113 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011401 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA068 MetaG | Host-Associated | Open in IMG/M |
| 3300011992 | Permafrost microbial communities from Nunavut, Canada - A23_65cm_12M | Environmental | Open in IMG/M |
| 3300011996 | Permafrost microbial communities from Nunavut, Canada - A39_65cm_12M | Environmental | Open in IMG/M |
| 3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
| 3300012001 | Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012388 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012409 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
| 3300014058 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AL9A1W_13225463 | 3300000878 | Permafrost | MARHMHHWIDMVEAVLIIGILLAIAWLSWQAFTQAYTPVFNIFNKFGG* |
| JGI12709J13192_10053312 | 3300001086 | Forest Soil | MARHLHHWLEMVEALLVIGILLAIAWVTWLALTQAYAPVFNLFNKF* |
| JGI12709J13192_10124253 | 3300001086 | Forest Soil | MVRHLHHWLDMVEALLIIGVLLAIAWVTWLALTQAYSPVFNLFNRL* |
| JGI12679J13547_10031813 | 3300001174 | Forest Soil | MVRHLHHWLDMVEALLIIGVLLAIAWVTWLALTQAYSPVFNLFNKL* |
| A1565W1_103555241 | 3300001536 | Permafrost | MARHMHHWIDMVEAVLIIGILLTIAWLSWQAFTQAYTPV |
| JGI12053J15887_102311612 | 3300001661 | Forest Soil | MVRHLHHWLEMVEALLIIGILLAIAWVTWLALTQAYSPVFNLFNKF* |
| JGIcombinedJ26739_1001281445 | 3300002245 | Forest Soil | MARHLHHWLDLVEAVLIIGILLAIAWVTWQALTQAYSPVFNLFNRF* |
| JGIcombinedJ26739_1013516152 | 3300002245 | Forest Soil | MARHLHHWLEMVEALLIIGILLAIAWLTWQALTQAXSPVFNLFXKF* |
| JGI25381J37097_10040894 | 3300002557 | Grasslands Soil | MARHLHHWLDMVEAVLIIGILLAIAWVTWQALTQAYSPVFNIFSRF* |
| JGI25387J43893_10408761 | 3300002915 | Grasslands Soil | MARHLHHWLDMVEAVLIIGILLAIAWVTWQALTQAXSPVFNIFSRF* |
| Ga0066674_101277652 | 3300005166 | Soil | MVRHLHHWLDMVEALLIIGILLAIGWVTWLALTQAYSPVFNLFNKL* |
| Ga0066674_104718422 | 3300005166 | Soil | MTRHLHHWLDMVEAVLIIGILLAIAWVTWQALTQAYSPVFNIFSRF* |
| Ga0066672_100923572 | 3300005167 | Soil | MARHLHHWIEMVEALLIIGILLAIAWITWQALTQAYSPVFNLFNKF* |
| Ga0066672_105907702 | 3300005167 | Soil | MARHLHHWLDMVEAVLIIGILLAIAWLSWQALTTAYSPVFNLLNKF* |
| Ga0066677_100138594 | 3300005171 | Soil | MVRHVGHWIDMVEAVLIIGVLLVIAWLAWQAVTQAYGPVVNILGKF* |
| Ga0066677_101877093 | 3300005171 | Soil | MARHLHHWLDMVEAVLIIGILLAIAWLTWQALTQAYSPVFNIFSRF* |
| Ga0066677_107370692 | 3300005171 | Soil | MARHLHHWLEMVEALLIIGILLAIAWVTWQALSQAYSPVFNLFNKF* |
| Ga0066680_100471204 | 3300005174 | Soil | LARHLHHWLEMVEALLIIGILLAIAWVTWQALTQAYSPVFNLFNKF* |
| Ga0066680_103937582 | 3300005174 | Soil | MARHLHHWLDMVEALLIIGILLAIAWVTWQALSQAYSPVFNLFNRF* |
| Ga0066680_104399123 | 3300005174 | Soil | MARHLHHWLDLVEAVLIIGILLAIAWVTWQALTQAYSPVFNIFSRF* |
| Ga0066679_103458952 | 3300005176 | Soil | MARHLHHWLEMVEALLIIGILLAIAWITWQALTQAYSPVFNLFNKF* |
| Ga0066679_110129321 | 3300005176 | Soil | MARHLHHWIEMVEALLIIGILLAIAWVTWQALTQAYSPVFNLFNKF* |
| Ga0066690_102669412 | 3300005177 | Soil | MVRHVGHWLDTLEAVAIIGVLLAIAWLSWQALSSAYTPVLHLLGGL* |
| Ga0066684_103271342 | 3300005179 | Soil | MVRHVGHWLDTLEAVAIIGVLLAIAWLSWQALSSAYAPVMHLLGGL* |
| Ga0070714_1000143249 | 3300005435 | Agricultural Soil | MARHLHHWLDLVEAVLIIGILLAIAWVTWQALSQAYSPVFNLFHKF* |
| Ga0070708_1000159824 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MARHLHHWLEMVEALLIIGILLAIAWVTWQALTQAYSPVFNLFSKF* |
| Ga0070708_1010572421 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MARHLHHWLEMVEALLIIGILLAIAWVTWLALTQAYSPVFNLFNKL* |
| Ga0070708_1014073202 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MARHLHHWLEMVEAVLIIGILLAIAWLSWQALTQAYSPVFNLLNKF* |
| Ga0066687_100062443 | 3300005454 | Soil | MVRHLHHWLDLVEAVLIIGILLAVAWFTWQAMTQAYTPVFNILNKF* |
| Ga0066687_100526042 | 3300005454 | Soil | LLTRHLHHWLDMVEAVLIIGILLAIAWLTWQALTQAYSPVFNLLNKF* |
| Ga0066687_104106982 | 3300005454 | Soil | MVRHLHHWLDMVEAVLIIGILLAIAWFTWQAVTQAYSPVFNILNKF* |
| Ga0070706_1000050515 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MARHLHHWLEMVEALLIIGILIAIAWVTWQALTQAYSPVFNLFSKF* |
| Ga0070707_10000011365 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRHLHHWLDMVEALLIIGILLAIAWVTLQALTQAYSPVFNLFNKF* |
| Ga0070707_1000012368 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MARHLHHWLEMVEALLIIGILLVIAWVTWQALTQAYSPVFNLFSKF* |
| Ga0070707_10000544613 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | FMARHLHHWLEMVEAVLIIGILLAIAWLSWQALTQAYSPVFNLLNKF* |
| Ga0070707_1015062262 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LVSLARHLHHWLEMVEALLIIGILLAIAWVTWQALTQAYSPVFNLFNKF* |
| Ga0070698_1000101733 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRHLHHWLDMVEALLIIGILLAIAWVTWLALTQAYSPVFNLFNKL* |
| Ga0070697_10000000824 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRHLHHWLDMVEALLIIGILLAIAWVTWQALTQAYSPVFNLFNKF* |
| Ga0070697_1001073235 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MARHLHHWLEMVEALLIVGILLAIAWVTWQALTQAYSPVFNLFNKF* |
| Ga0070697_1007095632 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MARHLHHWLDMVEAVLIIGILLAIAWLTWQALTMAYSPVFNLLNKF* |
| Ga0070732_105725242 | 3300005542 | Surface Soil | MVRHLHHWIDLVEAVLVIGILLAIAWFTWQAFSTAYSPVFNILNKF* |
| Ga0066692_104828971 | 3300005555 | Soil | SMARHLHHWLDMVEAVLIIGILLAIAWLSWQALTTAYSPVFNLLNKF* |
| Ga0066698_101059362 | 3300005558 | Soil | MVEAVLIIGILLAIAWVTWQALTQAYSPVFNIFSRF* |
| Ga0066699_100039277 | 3300005561 | Soil | MVEAVLIIGILLAIAWLTWQALTQAYSPVFNLLNKF* |
| Ga0081455_102367832 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MARHIHHWLDMVEAVLIIGILLAIAWLTWQALVLAYTPVFKILSRL* |
| Ga0070717_100904644 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MVEALLIIGILLAIAWVTWQALTQAYSPVFNLFNKF* |
| Ga0070717_101766654 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MARHLHHWLEMVEALLIIGILLAIAWVTWQALTQAYSPVFNLFNKF* |
| Ga0066696_105283262 | 3300006032 | Soil | MVRHLHHWLDMVEAVLIIGILLAIAWLTWQAVGQAYSPVVNILNKF* |
| Ga0075023_1001068602 | 3300006041 | Watersheds | MARHLHHWLEMVEALLIIGILLAIAWLTWQALTQAYSPVFNLFNKF* |
| Ga0070716_1000822445 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | DLVEAVLIIGILLAIAWVTWQALSQAYSPVFNLFHKF* |
| Ga0070716_1012033672 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MARHLHHWLDLVEAVLIIGILLAIAWVTWQALSQAYSPVFNLFHRF* |
| Ga0070716_1015322832 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRHLHHWLDMVEALLIIGILLAIGWVTWLALTQAYSPVFNLFN |
| Ga0104326_1232331 | 3300007740 | Soil | MHHWIDMVEAVLIIGILLAIAWLSWQAFTQAYTPVFNIFNKFGG* |
| Ga0102924_10648774 | 3300007982 | Iron-Sulfur Acid Spring | MVRHLHHWLDMAEALLIIGILLAIGWVTWLALTQAYSPVFNLFNKL* |
| Ga0102924_12581441 | 3300007982 | Iron-Sulfur Acid Spring | MVEAVLIIGILLAIAWLSWQAFMQAYTPVINIFNKFGG* |
| Ga0066710_1016798971 | 3300009012 | Grasslands Soil | MVEAVLIIGILLAIAWVTWQALTQAYSPVFNIFSRF |
| Ga0099829_103427583 | 3300009038 | Vadose Zone Soil | MARHLHHWLDMVEAVLIIGILLAIAWVTWQALSQAYSPVFNLFHRF* |
| Ga0099829_112294192 | 3300009038 | Vadose Zone Soil | MVRHLHHWLDMVEALLIIGILLAIAWVTWLALTQAYSPVFNLFNRL* |
| Ga0099829_113874312 | 3300009038 | Vadose Zone Soil | MAGGLVSMARHLHHWLEMVEALVIIGILLAIAWVTWLALTQAYSPVFNLFNKL* |
| Ga0099830_105174833 | 3300009088 | Vadose Zone Soil | MVEALLIIGILLAIGWVTWLALTQAYSPVFNLFNKL* |
| Ga0099828_100755381 | 3300009089 | Vadose Zone Soil | MARHLHHWLEMVEALLIIGILLAIAWATWQALTQAYSPVFNLFNKF* |
| Ga0099828_117872092 | 3300009089 | Vadose Zone Soil | MVRHLHHWLDMVEALLIIGILLAIAWVTWLALTQAYSPVFNLFKML* |
| Ga0099827_103035632 | 3300009090 | Vadose Zone Soil | MKGGLVYMVRHLHHWLDMVEALLIIGILLAIAWVTWLALTQAYSPVFNLFNKL* |
| Ga0127444_11204403 | 3300010113 | Grasslands Soil | EAVLIIGILLAIAWVTWQALTQAYSPVFNIFSRF* |
| Ga0134080_105896342 | 3300010333 | Grasslands Soil | MTRHLHHWLDMVEAVLIIGILFAIAWVTWQALTQAYSPVFNIFSRF* |
| Ga0134071_100092965 | 3300010336 | Grasslands Soil | MARHLHHWLDMVEAVLIIGILLAIAWVTWQALTQAYS |
| Ga0137392_100526236 | 3300011269 | Vadose Zone Soil | EALLIIGILLAIAWVTWQALTQAYSPVFNLFNKF* |
| Ga0137392_106323132 | 3300011269 | Vadose Zone Soil | MVRHLHHWLDMVEALLVIGILLAIGWVTWLALTQAYSPVFNLFNKL* |
| Ga0137391_100157182 | 3300011270 | Vadose Zone Soil | MEGGLVYMVRHLHHWLDMVEALLVIGILLAIGWVTWLALTQAYSPVFNLFNKL* |
| Ga0137391_113684391 | 3300011270 | Vadose Zone Soil | LDMVEALLIIGILLAIGWVTWLALTQAYSPVFNLFNKL* |
| Ga0153984_10469172 | 3300011401 | Attine Ant Fungus Gardens | MARHLHHWLEMVEALLIIGILLAIAWVTWLALTQAYSPVFNLFNKF* |
| Ga0120146_10058334 | 3300011992 | Permafrost | MHHWIDMVEAVLIIGILLAIAWLSWLAFTQAYTPVFNIFNKFGG* |
| Ga0120156_10231203 | 3300011996 | Permafrost | MHHWIDMVEAVLIIGILLTIAWLSWQAFTQAYTPVFNIFNKFGG* |
| Ga0120114_10435103 | 3300011998 | Permafrost | MHHWIDMVEAVLIIGILLAIAWLSWQAFTQAYTPVFNIFN |
| Ga0120167_10492152 | 3300012001 | Permafrost | MAQHMHHWIDMVEAVLIIGILLAIAWLSWQAFSQAYTPVFNIFNKFGG* |
| Ga0120159_10718513 | 3300012014 | Permafrost | MHHWIDMVEAVLIIGILLAIAWLSWQAFSQAYTPVFNIFNKFGG* |
| Ga0137389_108334462 | 3300012096 | Vadose Zone Soil | MEGGLVYMVRHLHHWLDMVEALLIIGILLAIGWVTWLALTQAYSPVFNLFNKL* |
| Ga0137364_104573734 | 3300012198 | Vadose Zone Soil | WLDMVEALLIIGILLAIGWVTWLALTQAYSPVFNLFNKL* |
| Ga0137362_105243902 | 3300012205 | Vadose Zone Soil | LISLARHLHHWLEMVEALLIIGILLAIAWVTWQALTQAYSPVFNLFNKF* |
| Ga0137380_100392363 | 3300012206 | Vadose Zone Soil | MARHLHHWLDLVEAVLIIGILLAIAWVTWQALAQAYSPVFNIFGRF* |
| Ga0137376_101094092 | 3300012208 | Vadose Zone Soil | MARHLHHWLDMVEAVLIIGLLLAIAWVTWQALTQAYSPVFNIFSRF* |
| Ga0137376_102852922 | 3300012208 | Vadose Zone Soil | MARHLHHWLDMVEALLIIGILLAIAWVTWQALTQAYSPVFNLFNRF* |
| Ga0137376_112538191 | 3300012208 | Vadose Zone Soil | MVRHLHHWLDMVEALLIIGILLAIGWVTWLALTQA |
| Ga0137385_104039424 | 3300012359 | Vadose Zone Soil | VRHLHHWLDMVEALLIIGILLAIGWVTWLALTQAYSPVFNLFNKL* |
| Ga0137390_109360992 | 3300012363 | Vadose Zone Soil | MVEALLIIGILLAIAWVTWQALTQAYSPVFDLFNKF* |
| Ga0134031_10156853 | 3300012388 | Grasslands Soil | SGGLVYMARHLHHWLDMVEAVLIIGILLAIAWVTWQALTQAYSPVFNIFSRF* |
| Ga0134045_10791173 | 3300012409 | Grasslands Soil | TRHLHHWLDMVEAVLIIGILLAIAWVTWQALTQAYSPVFNIFSRF* |
| Ga0137397_103706253 | 3300012685 | Vadose Zone Soil | MVRHLHHWLDMVEALLIIGILLAIGWVTWLALTQAYSPVFNLFNRL* |
| Ga0137395_101731513 | 3300012917 | Vadose Zone Soil | MARHLHHWVEMVEALLIIGILLAIAWVTWQALTQAYSPVFNLFNKF* |
| Ga0137395_108234441 | 3300012917 | Vadose Zone Soil | MVRHLHHWLDMVEALLIIGILLAIGWVTWLALTQAYSPV |
| Ga0137359_107757042 | 3300012923 | Vadose Zone Soil | MARHLHHWIEMVEALLIIGILLAIGWVTWLALTQAYSPVFNLFNKL* |
| Ga0137416_100074734 | 3300012927 | Vadose Zone Soil | MVEALLIIGILLAIAWITWQALTQAYSPVFNLFNKF* |
| Ga0137416_113940042 | 3300012927 | Vadose Zone Soil | MARHLHHWLEMVEALLIIGILLAIAWVTWLALTQAYSPVFNLF |
| Ga0137416_116685842 | 3300012927 | Vadose Zone Soil | MVRHLHHWLDMVEALLIIGILLAIAWVTWLALTQA |
| Ga0137416_121788472 | 3300012927 | Vadose Zone Soil | MVEALLIIGILLAIAWVTWLALTQAYSPVFNLFNRL* |
| Ga0120179_10011821 | 3300013763 | Permafrost | MHHWIDMVEAVLIIGILLAIAWLSWQAFTQAYTPVFNIFNK |
| Ga0120149_11591371 | 3300014058 | Permafrost | MAGGLVYMARHLHHWLDMVEALLIIGILLAIAWVTWQALTQAYSPVFDLFHKF* |
| Ga0120149_11760842 | 3300014058 | Permafrost | MVRHLHHWLDMVEALLIIGILLAIAWVTWQALTQAYSPV |
| Ga0134073_101030681 | 3300015356 | Grasslands Soil | ARHLHHWLDMVEAVLIIGILLAIAWVTWQALTQAYSPVFNIFSRF* |
| Ga0066655_100224124 | 3300018431 | Grasslands Soil | MARHLHHWLDMVEAVLIIGILLAIAWVTWQALTQAYSPVFNIFSRF |
| Ga0066667_104382043 | 3300018433 | Grasslands Soil | MVRHLHHWLDMVEALLIIGILLAIGWVTWLALTQAYSPVFNLFNKL |
| Ga0066667_105399452 | 3300018433 | Grasslands Soil | MARHLHHWLDMVEALLIIGILLAIAWVTWQALSQAYSPVFNLFNRF |
| Ga0066662_102060722 | 3300018468 | Grasslands Soil | MVRHLHHWLDLVEAVLIIGILLAVAWFTWQAMTQAYTPVFNILNKF |
| Ga0066662_108868422 | 3300018468 | Grasslands Soil | MVRHVGHWLDTLEAVAIIGVLLAIAWLSWQALSSAYAPVMHLLGGL |
| Ga0066662_125523832 | 3300018468 | Grasslands Soil | MVRHVGHWIDMVEAVLIIGVLLVIAWLAWQAVTQAYGPVVNILGKF |
| Ga0066662_128532411 | 3300018468 | Grasslands Soil | MARHLHHWLDLAEAVLIIGILLAIAWVTWQALTQAYSPVFNIFSRF |
| Ga0066669_106083673 | 3300018482 | Grasslands Soil | MTRHLHHWLDMVEAVLIIGILLAIAWVTWQALTQAYSPVFNIFSRF |
| Ga0066669_124006281 | 3300018482 | Grasslands Soil | MARHLHHWLDMVEALLIIGILLAIAWVTWQALTQAYSPVFNLFNRF |
| Ga0215015_101058874 | 3300021046 | Soil | MVRHLHHWLDMVEALLVIAILLAIGWVTWLALTQAYSPVFNLFNKL |
| Ga0215015_101944771 | 3300021046 | Soil | MVRHLHHWLDMVEAVLIIGILLAIAWLTWQAFNQAYTPVFNILNKL |
| Ga0215015_111006643 | 3300021046 | Soil | MARHLHHWLDMVEALLIIGILLAIAWLTWQALTQAYSPVFNLLNKF |
| Ga0210410_101260011 | 3300021479 | Soil | LHHWLEMVEALLIIGILLAIAWVTWQALTQAYSPVFNLFNKF |
| Ga0212123_1000091680 | 3300022557 | Iron-Sulfur Acid Spring | MARHMHHWIDMVEAVLIIGILLAIAWLSWQAFMQAYTPVINIFNKFGG |
| Ga0212123_100416485 | 3300022557 | Iron-Sulfur Acid Spring | MARHMHHWIDMVEAVLIIGILLAIAWLSWQAFTQAYTPVFNIFNKFGG |
| Ga0212123_101637943 | 3300022557 | Iron-Sulfur Acid Spring | MVRHLHHWLDMAEALLIIGILLAIGWVTWLALTQAYSPVFNLFNKL |
| Ga0207684_1000007176 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MARHLHHWLEMVEAVLIIGILLAIAWLSWQALTQAYSPVFNLLNKF |
| Ga0207684_1000218211 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MARHLHHWLEMVEALLIIGILIAIAWVTWQALTQAYSPVFNLFSKF |
| Ga0207646_1000040663 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRHLHHWLDMVEALLIIGILLAIAWVTLQALTQAYSPVFNLFNKF |
| Ga0207646_1000103633 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MARHLHHWLEMVEALLIIGILLVIAWVTWQALTQAYSPVFNLFSKF |
| Ga0207665_104081022 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRHLHHWLDMVEALLIIGILLAIAWVTWLALTQAYSPVFNLFNRL |
| Ga0207665_111657132 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MARHLHHWLDLVEAVLIIGILLAIAWVTWQALSQAYSPVFNLFHRF |
| Ga0209234_10295851 | 3300026295 | Grasslands Soil | MVRHLHHWLDLVEAVLIIGILLAVAWFTWQALTQAYSPVFNILNKF |
| Ga0209235_10403034 | 3300026296 | Grasslands Soil | MARHLHHWLDMVEAVLIIGILLAIAWLTWQALTQAYSPVFNIFSRF |
| Ga0209239_13656283 | 3300026310 | Grasslands Soil | HWLDMVEAVLIIGILLAIAWVTWQALTQAYSPVFNIFSRF |
| Ga0209686_100028310 | 3300026315 | Soil | MVEAVLIIGILLAIAWLTWQALTQAYSPVFNIFSRF |
| Ga0209686_10565593 | 3300026315 | Soil | FMVRHLHHWLDLVEAVLIIGILLAVAWFTWQAMTQAYTPVFNILNKF |
| Ga0209471_11852181 | 3300026318 | Soil | LEMVEALLIIGILLAIAWITWQALTQAYSPVFNLFNKF |
| Ga0209687_11379971 | 3300026322 | Soil | MVRHLHHWLDMVEAVLIIGILLAIAWFTWQAVTQAYSPVFNILNKF |
| Ga0209802_12519652 | 3300026328 | Soil | MARHLHHWLDMVEAVLIIGILLAIAWLSWQALTTAYSPVF |
| Ga0209802_13310402 | 3300026328 | Soil | MGRRLVSLARHLHHWLEMVEALLIIGILLAIAWVTWQALTQAYSPVFNLFNKF |
| Ga0209804_11131663 | 3300026335 | Soil | MARHLHHWLDMVEAVLIIGILLAIAWLSWQALTTAYSPVFNL |
| Ga0209804_11665192 | 3300026335 | Soil | LLTRHLHHWLDMVEAVLIIGILLAIAWLTWQALTQAYSPVFNLLNKF |
| Ga0209690_10859623 | 3300026524 | Soil | MARHLHHWLDLVEAVLIIGILLAIAWVTWQALTQAYSPVFNIFSRF |
| Ga0209059_10324134 | 3300026527 | Soil | MVEAVLIIGILLAIAWLTWQALTQAYSPVFNLLNKF |
| Ga0209059_11308061 | 3300026527 | Soil | MARHLHHWLDMVEAVLIIGILLAIAWVTWQALTQAYSP |
| Ga0209378_11879883 | 3300026528 | Soil | WLDLVEAVLIIGILLAIAWVTWQALTQAYSPVFNIFSRF |
| Ga0209805_13803673 | 3300026542 | Soil | GHWLDTLEAVAIIGVLLAIAWLSWQALSSAYTPVLHLLGGL |
| Ga0209161_102114062 | 3300026548 | Soil | MARHLHHWLEMVEALLIIRILLAIAWVTWQALSQAYSPVFNLFNKF |
| Ga0209648_106204352 | 3300026551 | Grasslands Soil | MARHLHHWLEMVEALLIIGILIAIAWLTWLALTQAYSPVFNLFNRL |
| Ga0209577_100189113 | 3300026552 | Soil | MVRHVGHWLDTLEAVAIIGVLLAIAWLSWQALSSAYTPVLHLLGGL |
| Ga0208993_10285322 | 3300027480 | Forest Soil | MVRHLHHWLDMVEALLIIGILLAIGWVTWLALTQAYSPVFNLFNKF |
| Ga0209524_10019054 | 3300027521 | Forest Soil | MVRHLHHWLDMVEALLIIGVLLAIAWVTWLALTQAYSPVFNLFNKL |
| Ga0209524_10565492 | 3300027521 | Forest Soil | MARHLHHWLEMVEALLVIGILLAIAWVTWLALTQAYAPVFNLFNKF |
| Ga0209734_10003605 | 3300027535 | Forest Soil | MVRHLHHWLDMVEALLIIGILLAIAWVTWLALTQAYSPVFNLFNKL |
| Ga0209419_11091992 | 3300027537 | Forest Soil | MARHLHHWLDLVEAVLIIGILLAIAWVTWQALTQAYSPVFNLFNRF |
| Ga0208984_10081103 | 3300027546 | Forest Soil | MARHLHHWIDMVEALLIIGILLAIAWVTWQALTQAYSPVFNLFNKF |
| Ga0209219_10519562 | 3300027565 | Forest Soil | MVRHLHHWLDMVEALLIIGILLAIAWVTWQALTQAYSPVFNLFNKF |
| Ga0209220_10044355 | 3300027587 | Forest Soil | MVRHLHHWLDMVEALLIIGVLLAIAWVTWLALTQAYSPVFNLFNRL |
| Ga0209733_10491931 | 3300027591 | Forest Soil | PPTLIAGGLVSMARHLHHWLEMVEALLIIGILLAIAWLTWQALTQAYSPVFNLFNKF |
| Ga0209422_11391843 | 3300027629 | Forest Soil | LIAGGLVSMARHLHHWLEMVEALLIIGILLAIAWLTWQALTQAYSPVFNLFNKF |
| Ga0208988_10873971 | 3300027633 | Forest Soil | MVRHLHHWLDMVEALLIIGILLAIGWVTWLALTQAYSPVFNLFNRF |
| Ga0209217_11191892 | 3300027651 | Forest Soil | MARHLHHWLEMVEALLVIGILLAIAWVTWLALTQAY |
| Ga0209118_10813661 | 3300027674 | Forest Soil | AGGLVSMARHLHHWLEMVEALLVIGILLAIAWVTWLALTQAYAPVFNLFNKF |
| Ga0208991_11169382 | 3300027681 | Forest Soil | MVRHLHHWLEMVEALLIIGILLAIAWVTWLALTQAYSPVFNLFNKF |
| Ga0209689_10604234 | 3300027748 | Soil | MARHLHHWLDMVEAVLIIGILLAIAWLSWQALTTAYSPVFNLLNKF |
| Ga0209515_103861832 | 3300027835 | Groundwater | MVESLLIIGILLAIAWLSWLAVSQAYGPVFNLINRP |
| Ga0209580_101335483 | 3300027842 | Surface Soil | MVRHLHHWIDLVEAVLVIGILLAIAWFTWQAFSTAYSPVFNILNKF |
| Ga0209180_101507732 | 3300027846 | Vadose Zone Soil | MVRHLHHWLDMVEALLIIGILLAIGWVTWLALTQAYSPVFSLFNKL |
| Ga0209283_104821082 | 3300027875 | Vadose Zone Soil | MVRHLHHWLEMVEALLIIGILLAIAWATWQALTQAYSPVFNLFNKF |
| Ga0209590_100635882 | 3300027882 | Vadose Zone Soil | LARHLHHWLEMVEALLIIGILLAIAWVTWQALTQAYSPVFNLFNKF |
| Ga0209488_105150643 | 3300027903 | Vadose Zone Soil | MARHLHHWVEMVEALLIIGILLAIAWVTWQALTQAYSPVFNLFNKF |
| Ga0209526_102464533 | 3300028047 | Forest Soil | MVRHLHHWLDMVEALLIIGVLLAIAWVTWLALTQAYSPVFNLFNKV |
| Ga0209526_103487311 | 3300028047 | Forest Soil | RHLHHWLDMVEALLIIGILLAIAWVTWLALTQAYSPVFNLFNRL |
| Ga0137415_106589021 | 3300028536 | Vadose Zone Soil | MARHLHHWLEMVEALLIIGILLAIAWVTWLALTQAYSPVFNLFNRL |
| Ga0257175_11204303 | 3300028673 | Soil | PRLIEGGLVYMVRHLHHWLDMVEALLIIGILLAIGWVTWLALTQAYSPVFNLFNKL |
| Ga0073994_120626353 | 3300030991 | Soil | MARHLHHWLEMVEALLIIGILLAIAWVTWLALTQAYSPVFNLFNKL |
| Ga0307477_101389154 | 3300031753 | Hardwood Forest Soil | MARHLHHWLDMVEAVLIIGILLAIAWLTWQALTQAYSPVFNLLNKF |
| Ga0307473_103538292 | 3300031820 | Hardwood Forest Soil | MARHLHHWVDMVEAVLIIGILLAIAWLTWQALTQAYSPVFNLLNRF |
| Ga0307479_100010027 | 3300031962 | Hardwood Forest Soil | MARHLHHWLDLVEAVLIIGILLAIAWLSWQALTQAYSPVFNLLNKF |
| Ga0307479_100814404 | 3300031962 | Hardwood Forest Soil | MARHLHHWLEMVEALLIIGILLAIAWLTWQALTQAYSPVFNLLNKF |
| Ga0307471_1002320982 | 3300032180 | Hardwood Forest Soil | MARHLHHWLDMVEAVLIIGILLAIAWLTWQALTQAYSPVFNLLNRF |
| ⦗Top⦘ |