NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F035923

Metagenome / Metatranscriptome Family F035923

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F035923
Family Type Metagenome / Metatranscriptome
Number of Sequences 171
Average Sequence Length 39 residues
Representative Sequence MTGTTGDIEALSMWAGQSVALARQPQSAADIVAELTSRL
Number of Associated Samples 142
Number of Associated Scaffolds 171

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 16.96 %
% of genes near scaffold ends (potentially truncated) 77.78 %
% of genes from short scaffolds (< 2000 bps) 85.96 %
Associated GOLD sequencing projects 135
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.795 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa
(12.281 % of family members)
Environment Ontology (ENVO) Unclassified
(21.637 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.784 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 41.79%    β-sheet: 0.00%    Coil/Unstructured: 58.21%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 171 Family Scaffolds
PF07859Abhydrolase_3 9.94
PF00903Glyoxalase 8.77
PF02426MIase 4.09
PF12680SnoaL_2 4.09
PF00106adh_short 3.51
PF13561adh_short_C2 3.51
PF00196GerE 3.51
PF00732GMC_oxred_N 2.92
PF00578AhpC-TSA 2.92
PF03060NMO 2.92
PF03795YCII 1.75
PF00108Thiolase_N 1.75
PF00881Nitroreductase 1.17
PF13335Mg_chelatase_C 1.17
PF13185GAF_2 1.17
PF05345He_PIG 1.17
PF08281Sigma70_r4_2 1.17
PF00795CN_hydrolase 1.17
PF13191AAA_16 1.17
PF13360PQQ_2 1.17
PF00723Glyco_hydro_15 0.58
PF00313CSD 0.58
PF01381HTH_3 0.58
PF12681Glyoxalase_2 0.58
PF00484Pro_CA 0.58
PF13531SBP_bac_11 0.58
PF00487FA_desaturase 0.58
PF07690MFS_1 0.58
PF00083Sugar_tr 0.58
PF07366SnoaL 0.58
PF01425Amidase 0.58
PF03807F420_oxidored 0.58
PF030614HBT 0.58
PF16925TetR_C_13 0.58
PF00664ABC_membrane 0.58
PF00248Aldo_ket_red 0.58
PF03595SLAC1 0.58
PF01717Meth_synt_2 0.58
PF00848Ring_hydroxyl_A 0.58
PF01180DHO_dh 0.58
PF06078DUF937 0.58
PF13570PQQ_3 0.58
PF07992Pyr_redox_2 0.58
PF00596Aldolase_II 0.58
PF01738DLH 0.58
PF11578DUF3237 0.58
PF02909TetR_C_1 0.58
PF07971Glyco_hydro_92 0.58

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 171 Family Scaffolds
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 9.94
COG4829Muconolactone delta-isomeraseSecondary metabolites biosynthesis, transport and catabolism [Q] 4.09
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 3.51
COG0516IMP dehydrogenase/GMP reductaseNucleotide transport and metabolism [F] 2.92
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 2.92
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 1.75
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 1.75
COG4638Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunitInorganic ion transport and metabolism [P] 1.17
COG1309DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmATranscription [K] 0.58
COG3753Uncharacterized conserved protein YidB, DUF937 familyFunction unknown [S] 0.58
COG3537Putative alpha-1,2-mannosidaseCarbohydrate transport and metabolism [G] 0.58
COG3387Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 familyCarbohydrate transport and metabolism [G] 0.58
COG3239Fatty acid desaturaseLipid transport and metabolism [I] 0.58
COG1398Fatty-acid desaturaseLipid transport and metabolism [I] 0.58
COG0042tRNA-dihydrouridine synthaseTranslation, ribosomal structure and biogenesis [J] 0.58
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 0.58
COG1275Tellurite resistance protein TehA and related permeasesDefense mechanisms [V] 0.58
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 0.58
COG0288Carbonic anhydraseInorganic ion transport and metabolism [P] 0.58
COG0167Dihydroorotate dehydrogenaseNucleotide transport and metabolism [F] 0.58
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.58
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 0.58


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.80 %
UnclassifiedrootN/A15.20 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003505|JGIcombinedJ51221_10224552All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300004479|Ga0062595_100832525All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300005435|Ga0070714_100212989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1772Open in IMG/M
3300005435|Ga0070714_102038013All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300005467|Ga0070706_100258092All Organisms → cellular organisms → Bacteria1627Open in IMG/M
3300005538|Ga0070731_10095716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1967Open in IMG/M
3300005569|Ga0066705_10586413All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300005602|Ga0070762_10810004All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300005602|Ga0070762_10969762All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300005602|Ga0070762_10988941All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300005615|Ga0070702_100732335All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300005618|Ga0068864_101135218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae779Open in IMG/M
3300006028|Ga0070717_10083022All Organisms → cellular organisms → Bacteria2693Open in IMG/M
3300006028|Ga0070717_10726764Not Available902Open in IMG/M
3300006059|Ga0075017_100059620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2582Open in IMG/M
3300006059|Ga0075017_101427568All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300006173|Ga0070716_100157625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1467Open in IMG/M
3300006755|Ga0079222_11429463All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300006804|Ga0079221_10279396All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300009098|Ga0105245_12786822All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300009520|Ga0116214_1063382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → unclassified Actinospica → Actinospica sp. MGRD01-021345Open in IMG/M
3300009521|Ga0116222_1339728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium651Open in IMG/M
3300009525|Ga0116220_10521963All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300009644|Ga0116121_1214413All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300009665|Ga0116135_1242242Not Available699Open in IMG/M
3300009824|Ga0116219_10656901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → unclassified Actinospica → Actinospica sp. MGRD01-02575Open in IMG/M
3300010361|Ga0126378_11998070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia661Open in IMG/M
3300010361|Ga0126378_12776711All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300010379|Ga0136449_102962356All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter → unclassified Anaeromyxobacter → Anaeromyxobacter sp. SG22664Open in IMG/M
3300010396|Ga0134126_12164646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium607Open in IMG/M
3300010866|Ga0126344_1016227All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300010880|Ga0126350_11521861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1180Open in IMG/M
3300010880|Ga0126350_12186307All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300010880|Ga0126350_12228768All Organisms → cellular organisms → Bacteria1157Open in IMG/M
3300011003|Ga0138514_100013943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1359Open in IMG/M
3300011120|Ga0150983_15797356All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300012469|Ga0150984_103579060All Organisms → cellular organisms → Bacteria973Open in IMG/M
3300012930|Ga0137407_10671523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → unclassified Actinospica → Actinospica sp. MGRD01-02975Open in IMG/M
3300014156|Ga0181518_10068202All Organisms → cellular organisms → Bacteria2060Open in IMG/M
3300014164|Ga0181532_10314903All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300014168|Ga0181534_10566224All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300014200|Ga0181526_10078728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2100Open in IMG/M
3300014201|Ga0181537_11238560All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300014487|Ga0182000_10667934Not Available509Open in IMG/M
3300014495|Ga0182015_10358460All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300014495|Ga0182015_10551172Not Available734Open in IMG/M
3300014501|Ga0182024_12184096Not Available606Open in IMG/M
3300016341|Ga0182035_12105303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides panacis512Open in IMG/M
3300016371|Ga0182034_10590679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii936Open in IMG/M
3300017821|Ga0187812_1016434All Organisms → cellular organisms → Bacteria2555Open in IMG/M
3300017924|Ga0187820_1277972All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300017926|Ga0187807_1089937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia962Open in IMG/M
3300017928|Ga0187806_1006896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3127Open in IMG/M
3300017928|Ga0187806_1232089Not Available634Open in IMG/M
3300017932|Ga0187814_10101204All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300017932|Ga0187814_10158947All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300017932|Ga0187814_10223502All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300017938|Ga0187854_10503353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → unclassified Actinospica → Actinospica sp. MGRD01-02501Open in IMG/M
3300017942|Ga0187808_10116215All Organisms → cellular organisms → Bacteria1168Open in IMG/M
3300017943|Ga0187819_10629652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis acidiphila607Open in IMG/M
3300017946|Ga0187879_10017172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4500Open in IMG/M
3300017946|Ga0187879_10622881All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300017948|Ga0187847_10064435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2058Open in IMG/M
3300017961|Ga0187778_11202723All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300017970|Ga0187783_10502991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium878Open in IMG/M
3300017974|Ga0187777_10645912All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300018019|Ga0187874_10229782All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300018033|Ga0187867_10005998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria9108Open in IMG/M
3300018033|Ga0187867_10038604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2930Open in IMG/M
3300018034|Ga0187863_10880499All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300018035|Ga0187875_10078054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1900Open in IMG/M
3300018035|Ga0187875_10425589Not Available708Open in IMG/M
3300018042|Ga0187871_10652622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia585Open in IMG/M
3300018058|Ga0187766_10474332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae839Open in IMG/M
3300018058|Ga0187766_10618014All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300018062|Ga0187784_11459377Not Available542Open in IMG/M
3300018062|Ga0187784_11674684All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300018085|Ga0187772_10317128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1071Open in IMG/M
3300019786|Ga0182025_1189084All Organisms → cellular organisms → Bacteria2221Open in IMG/M
3300019890|Ga0193728_1153242All Organisms → cellular organisms → Bacteria1012Open in IMG/M
3300020581|Ga0210399_10654612Not Available866Open in IMG/M
3300021170|Ga0210400_10345827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella panacisegetis1224Open in IMG/M
3300021181|Ga0210388_11287152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia617Open in IMG/M
3300021401|Ga0210393_10753665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces olivochromogenes793Open in IMG/M
3300021403|Ga0210397_10004190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8845Open in IMG/M
3300021404|Ga0210389_11486574Not Available515Open in IMG/M
3300021474|Ga0210390_10743561Not Available815Open in IMG/M
3300021477|Ga0210398_11216433All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300024176|Ga0224565_1047689All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300024225|Ga0224572_1108052All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter → unclassified Anaeromyxobacter → Anaeromyxobacter sp. SG22515Open in IMG/M
3300024227|Ga0228598_1045446All Organisms → cellular organisms → Bacteria869Open in IMG/M
3300025921|Ga0207652_11623514Not Available551Open in IMG/M
3300026067|Ga0207678_11575007All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300026294|Ga0209839_10025958Not Available2255Open in IMG/M
3300027080|Ga0208237_1023182Not Available935Open in IMG/M
3300027117|Ga0209732_1090227All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300027307|Ga0209327_1074665All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300027497|Ga0208199_1055909All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300027568|Ga0208042_1135034All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300027648|Ga0209420_1083238All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300027817|Ga0209112_10052696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. CME 231246Open in IMG/M
3300027853|Ga0209274_10327317Not Available788Open in IMG/M
3300027869|Ga0209579_10068162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1883Open in IMG/M
3300027879|Ga0209169_10080414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1684Open in IMG/M
3300027895|Ga0209624_10325518All Organisms → cellular organisms → Bacteria1024Open in IMG/M
3300027895|Ga0209624_11003070All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300027898|Ga0209067_10938270All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300027908|Ga0209006_10503932All Organisms → cellular organisms → Bacteria1009Open in IMG/M
3300028755|Ga0307316_10312842All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300028789|Ga0302232_10168615Not Available1099Open in IMG/M
3300028801|Ga0302226_10423538All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300028877|Ga0302235_10010190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5739Open in IMG/M
3300029882|Ga0311368_10209425All Organisms → cellular organisms → Bacteria1538Open in IMG/M
3300029939|Ga0311328_10256641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1316Open in IMG/M
3300029944|Ga0311352_10686066Not Available810Open in IMG/M
3300029944|Ga0311352_11375670All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300029951|Ga0311371_11198107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium878Open in IMG/M
3300029951|Ga0311371_11943022All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300029999|Ga0311339_11417713Not Available623Open in IMG/M
3300030007|Ga0311338_10113949All Organisms → cellular organisms → Bacteria3320Open in IMG/M
3300030013|Ga0302178_10395983All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300030043|Ga0302306_10267689All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300030053|Ga0302177_10407474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora lupini → Micromonospora lupini str. Lupac 08711Open in IMG/M
3300030503|Ga0311370_12451816All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300030520|Ga0311372_10387581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2128Open in IMG/M
3300030617|Ga0311356_10542878All Organisms → cellular organisms → Bacteria1131Open in IMG/M
3300030688|Ga0311345_10755474Not Available771Open in IMG/M
3300030739|Ga0302311_10875290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Planctomonas → unclassified Planctomonas → Planctomonas sp. JC2975578Open in IMG/M
3300030743|Ga0265461_12388892All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300031234|Ga0302325_10084144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae6062Open in IMG/M
3300031234|Ga0302325_10752365All Organisms → cellular organisms → Bacteria1388Open in IMG/M
3300031234|Ga0302325_12476638All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300031525|Ga0302326_11506075All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300031573|Ga0310915_10656382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides panacis742Open in IMG/M
3300031708|Ga0310686_103109165All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300031708|Ga0310686_104939335Not Available3230Open in IMG/M
3300031708|Ga0310686_106417758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium nebraskense523Open in IMG/M
3300031708|Ga0310686_113082220Not Available1305Open in IMG/M
3300031708|Ga0310686_119105180All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300031712|Ga0265342_10236644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae979Open in IMG/M
3300031718|Ga0307474_10028507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4084Open in IMG/M
3300031724|Ga0318500_10389992All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides panacis691Open in IMG/M
3300031751|Ga0318494_10158748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1276Open in IMG/M
3300031753|Ga0307477_10583372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales755Open in IMG/M
3300031768|Ga0318509_10200416All Organisms → cellular organisms → Bacteria1110Open in IMG/M
3300031771|Ga0318546_10832368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium650Open in IMG/M
3300031779|Ga0318566_10449072All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300031792|Ga0318529_10038685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus2014Open in IMG/M
3300031831|Ga0318564_10167892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia979Open in IMG/M
3300031894|Ga0318522_10023779All Organisms → cellular organisms → Bacteria2018Open in IMG/M
3300031912|Ga0306921_10107604All Organisms → cellular organisms → Bacteria → Terrabacteria group3237Open in IMG/M
3300031997|Ga0315278_10783319All Organisms → cellular organisms → Bacteria → Proteobacteria964Open in IMG/M
3300032066|Ga0318514_10625009Not Available573Open in IMG/M
3300032076|Ga0306924_12312087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides panacis545Open in IMG/M
3300032160|Ga0311301_10773929All Organisms → cellular organisms → Bacteria1326Open in IMG/M
3300032160|Ga0311301_10783446All Organisms → cellular organisms → Bacteria1315Open in IMG/M
3300032164|Ga0315283_10613535Not Available1177Open in IMG/M
3300032275|Ga0315270_10722104All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300032828|Ga0335080_11671676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales625Open in IMG/M
3300032892|Ga0335081_12551608All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300032896|Ga0335075_10385195All Organisms → cellular organisms → Bacteria1501Open in IMG/M
3300032898|Ga0335072_10901173Not Available828Open in IMG/M
3300032955|Ga0335076_10150718All Organisms → cellular organisms → Bacteria2241Open in IMG/M
3300032955|Ga0335076_10935092All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter → unclassified Anaeromyxobacter → Anaeromyxobacter sp. SG22749Open in IMG/M
3300033134|Ga0335073_10002917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria23623Open in IMG/M
3300033290|Ga0318519_11059113All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300033475|Ga0310811_11118420Not Available665Open in IMG/M
3300033824|Ga0334840_129992Not Available676Open in IMG/M
3300034065|Ga0334827_214032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea rhodomycinica573Open in IMG/M
3300034163|Ga0370515_0270671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Herbidospora → Herbidospora sakaeratensis720Open in IMG/M
3300034163|Ga0370515_0336288All Organisms → cellular organisms → Bacteria638Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa12.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.70%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland6.43%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.26%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment5.85%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.68%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.68%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.34%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil2.34%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.92%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.92%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.75%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.75%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.17%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.17%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.17%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.17%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.17%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.17%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa1.17%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.17%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.17%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.17%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.17%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.58%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.58%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.58%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.58%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.58%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.58%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.58%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.58%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.58%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.58%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.58%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010866Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300024176Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1EnvironmentalOpen in IMG/M
3300024225Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5Host-AssociatedOpen in IMG/M
3300024227Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300027080Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes)EnvironmentalOpen in IMG/M
3300027117Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027307Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027497Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027568Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027817Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028801Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029939I_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030043Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033824Peat soil microbial communities from Stordalen Mire, Sweden - 714 S2 5-9EnvironmentalOpen in IMG/M
3300034065Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ51221_1022455213300003505Forest SoilEPAPPMAGTTGEIEALSMWAGQSVALARRSQSAADIVAELTAGL*
Ga0062595_10083252513300004479SoilEGTTGDIGALSLWAGQSVALAKSRRPAAEIVSELVSRLD*
Ga0070714_10021298923300005435Agricultural SoilMVGATSEIEALLMWAGQGVALARQSQSAAEIVAELCSGL*
Ga0070714_10203801323300005435Agricultural SoilYEPAPPMAGTTGEIEALSMWAGQSVALARQPQSAADIVTELTSRL*
Ga0070706_10025809213300005467Corn, Switchgrass And Miscanthus RhizosphereYEPAPPMAGTTGDIEALSMWAGQSVALARQPQSAADIVTELTSRL*
Ga0070731_1009571623300005538Surface SoilMTGTTGDIEALSMWAGQSVALARAPQPAADIVAELTSRL*
Ga0066705_1058641323300005569SoilTTGEIEALSMWAGQGVALARQPQSAADIVTELTSHLSPGP*
Ga0070762_1081000413300005602SoilPPMIGTTGDIEALSMWAGQSVALARQPQSAADIVTELTSHL*
Ga0070762_1096976213300005602SoilTGDIEALSMWAGQSVALVREPQSAAEIVTELTSRL*
Ga0070762_1098894113300005602SoilYEPAPPMVGTTGDIEALSQWAGQSVALARQPPQPAAEIVAELVARL*
Ga0070702_10073233513300005615Corn, Switchgrass And Miscanthus RhizosphereMAGTTGEIEALSMWAGQSVALARQPQSAADIVTELTSRL*
Ga0068864_10113521833300005618Switchgrass RhizosphereTTGEIEALSMWAGQSVALARQVQPAAQIVAELVSGL*
Ga0070717_1008302243300006028Corn, Switchgrass And Miscanthus RhizosphereTGTTGDIEALSMWAGQSVALARQPQPAAGIVAELTSRL*
Ga0070717_1072676413300006028Corn, Switchgrass And Miscanthus RhizosphereTGEIEPLSLWAGQSVALANRTQPAADIVAELVSRL*
Ga0075017_10005962053300006059WatershedsSAADGGTTGDIEALSMWAGQSVALARQPRPAADIVAELVSRL*
Ga0075017_10142756823300006059WatershedsGDIEALSMWAGQGVALARQSQSAADIVTELTSRL*
Ga0070716_10015762543300006173Corn, Switchgrass And Miscanthus RhizosphereMAGTTGEIEALSMWAGQSVALARQPQAAADIVTELTSRL*
Ga0079222_1142946313300006755Agricultural SoilAGTTGDIEALSMWAGQSVALARQPQPAADIVAELTSRL*
Ga0079221_1027939613300006804Agricultural SoilGDIEALSMWAGQSVALARQPQPVADIVAELTSRL*
Ga0105245_1278682223300009098Miscanthus RhizosphereTGDIDALSLWAGQSVALARRRQPASEILADLVSRLD*
Ga0116214_106338213300009520Peatlands SoilMAGTTGEIEALSMWAGQGVALAGQSQSAADIVTELCSRL*
Ga0116222_133972813300009521Peatlands SoilTGEIEALSLWAGQSVALAKQPQPAAEIIAELISRL*
Ga0116220_1052196313300009525Peatlands SoilGEIEALSMWAGQGVALARQPQSAADIVTELTSRL*
Ga0116121_121441313300009644PeatlandTGEIEALSMSAGQSVALAKKSQSAADIVTELTSRL*
Ga0116135_124224223300009665PeatlandAAPMVGTIGDIEALSLWAGQSVALARQPQSAAEIVAELVSGL*
Ga0116219_1065690123300009824Peatlands SoilMAGTTGEIEALSMWAGQGVALAGQSQSAADIVTELTSRL*
Ga0126378_1199807023300010361Tropical Forest SoilPGRSPWNWHLSGTTGEIEALSMWAGQSVALARQSQSAAEIVAELTSEL*
Ga0126378_1277671113300010361Tropical Forest SoilMTGTTGDIEVLSMWAGQGVTLARQPQPAADIVTELTSRL*
Ga0136449_10296235613300010379Peatlands SoilGTTGDIEALSMWAGQSVALARKPQSAAEIVTELTSRL*
Ga0134126_1216464613300010396Terrestrial SoilMTGDIDALSLWAGQSVALARARRPAAEIVADLVSRL*
Ga0126344_101622713300010866Boreal Forest SoilTGDIEALSMWAGQGVALMHQDQSAADIVKELTSRL*
Ga0126350_1152186123300010880Boreal Forest SoilMVGTTGEIEALSMWAGQDVALARKSESAADIVAELTSRL*
Ga0126350_1218630713300010880Boreal Forest SoilTGDIEALSMWAGQSVALARAPQSAAEIVTELTSRL*
Ga0126350_1222876813300010880Boreal Forest SoilTTGEIEALSMWAGQDVALARKSQSAADIVAELTSRL*
Ga0138514_10001394333300011003SoilMVGTIGEIEALSLWAGQSVALAKQSQPAAEIVAELVSRL*
Ga0150983_1579735623300011120Forest SoilAPPMIGTTGDIEALSMWAGQGVALAKLSQSAADIVSELTSRL*
Ga0150984_10357906033300012469Avena Fatua RhizosphereMVGTTGEIEALSLWAGQSVALAKQPQPAEEVVAELVSRL*
Ga0137407_1067152323300012930Vadose Zone SoilMVGTTGDIEALSMWAGQDVALATKSQSAADIVAELTSHL*
Ga0181518_1006820213300014156BogMVGTTGDIEALSLWAGQSVALAREPQSAAGIVAELVSGLESKSA*
Ga0181532_1031490323300014164BogMVGTTGEIEALSMWAGQSVALAKKSQSAADIVTELTSRL*
Ga0181534_1056622413300014168BogEPAPPMVGTTGDIEALSMWAGQSVALARQPQSAADIVAELVSGL*
Ga0181526_1007872853300014200BogPMVGTTGDIEAISLWAGQSVALARQPQSAADIVAELVSGL*
Ga0181537_1123856013300014201BogMVGTTGEIEALSQWAGQSVALAKQSQPAAEIVAELVSRL*
Ga0182000_1066793423300014487SoilMAGTTGDIEALSMWAGQSVALARKPQSAAEIVTELTSHL*
Ga0182015_1035846013300014495PalsaTTGDIEALSMWAGQSVALARQPRPAAEIVAELVSRL*
Ga0182015_1055117223300014495PalsaAGTTGDIEALSMWAGQSVALARQPQSAAEIVTELTSRL*
Ga0182024_1218409613300014501PermafrostTGEIEALSMWAGQSVALARQPQSAAEIVTELTSRL*
Ga0182035_1210530313300016341SoilSSALALEGTTGDVGALSMWAGQSVALAKRTQPAADIIAELTT
Ga0182034_1059067913300016371SoilMSPIEALSMWAGQGVALARKSQSAADIVTELTSHL
Ga0187812_101643423300017821Freshwater SedimentMAGTTGEIEALSMWAGQGVALAGQSQSAADIVTELCSRL
Ga0187820_127797223300017924Freshwater SedimentAPPMVGTTGEIEALSMWAGQGVALARQSQSAADIVTELTSRL
Ga0187807_108993713300017926Freshwater SedimentTGEIEALSMWAGQGIALARKSQSAADIVAELTSRL
Ga0187806_100689633300017928Freshwater SedimentMLGTTGDIEALSMWAGQDIALVRHSQSAAEIVTELIYRL
Ga0187806_123208913300017928Freshwater SedimentTTGDIEALSMWAGQSVALARAPQPAADIVAELTSRL
Ga0187814_1010120423300017932Freshwater SedimentMLGTTGDIEALSMWAGQDIALVRHSQSAAEIVTELISRL
Ga0187814_1015894713300017932Freshwater SedimentTGEIEALSMWAGQSVALATKAQPAAAIVAELTSRL
Ga0187814_1022350223300017932Freshwater SedimentAPPMTGTTGDIEALSMWAGQSVALARQPQAAADIVAELTSRL
Ga0187854_1050335323300017938PeatlandMVGTTGEIEALSMWAGQSVALAKKSQSAADIVTELTSRL
Ga0187808_1011621513300017942Freshwater SedimentMAGTTGQIEALSMWAGQSVALARQPQSAADIVTELTSRL
Ga0187819_1062965213300017943Freshwater SedimentELLGVPRTTGEVEALSMWAGQSVALPRRAQPAAEIVSELVSGF
Ga0187879_1001717223300017946PeatlandMAGTTGDIEALSMWAGQGVALARQPQSAADIVAELTSGL
Ga0187879_1062288123300017946PeatlandAGTTGDIEALSMWAGQSVALARQPQSAADIVTELTSHL
Ga0187847_1006443523300017948PeatlandMVGTTGESEALSLWAGQSVALAKRPQPAAEIVAELVSRF
Ga0187778_1120272313300017961Tropical PeatlandTGDIEALSMWAGQSVALARASQPAADIVAELTSRL
Ga0187783_1050299113300017970Tropical PeatlandTTGEIEALSMWAGQSVALARQSQSAADIVAELPSRL
Ga0187777_1064591223300017974Tropical PeatlandGTTGEIEALSMWAGQAVALARKSQSAAEIVAELTSRL
Ga0187874_1022978223300018019PeatlandVIAHFASGESIVRYEPAPPMAGTTGDIEALSMWARQSAALARQPQSAADIVTELT
Ga0187867_1000599813300018033PeatlandMIGTTGDIEALSMWAGQDVALARQTQSAADIVAELTSRL
Ga0187867_1003860433300018033PeatlandMAGTTGDIEALSMWAGQSVALARQPQSAADIVTELTSHL
Ga0187863_1088049923300018034PeatlandMVGTTGEIEALSMWAGQGVALARESRSAADIVTELTSRL
Ga0187875_1007805413300018035PeatlandMVGTTGEIEALSMWAGQSVALARRVQPAAEIVTELTSRLGDRLV
Ga0187875_1042558933300018035PeatlandAPMVGTTGDIEALSLWAGQSVALAREPQSAAGIVAELVSGLESKSA
Ga0187871_1065262213300018042PeatlandTTGQIEALSMWAGQGVALAKERQSAADIVTELTSHL
Ga0187766_1047433213300018058Tropical PeatlandTTGEIEALSQWAGQSVALAKQSRPAAQIVGELVSRL
Ga0187766_1061801423300018058Tropical PeatlandMVGTTPEIETLSLWAGQSVALAKRSQPAAEIVAEPVSRL
Ga0187784_1145937713300018062Tropical PeatlandTGDVEALSLWAGQSVALAKQPQTAAEIVAELVSGL
Ga0187784_1167468413300018062Tropical PeatlandTGEIEALSMWAGQSVALARQPQSAADIVAELTTRL
Ga0187772_1031712813300018085Tropical PeatlandGTTGEIEPLSMWAGQGVALARESQSAADIVAELTSRL
Ga0182025_118908443300019786PermafrostMAGTTGEIEALSMWAGQGIALARQPQSAAEIVAELTSHL
Ga0193728_115324213300019890SoilEGDIDAMSLWAGQSVALARAVEPAAAIVAELVSRL
Ga0210399_1065461223300020581SoilPMAGTTGDIEALSMWAGQSVALARTPQSAADIVAELTSRL
Ga0210400_1034582713300021170SoilMVGTTGEIEALSLWAGQSVALARQSQPAAAIVAELVSCF
Ga0210388_1128715223300021181SoilTGDIEALSMWAGQSVALARQPQPAADIVAELTSRL
Ga0210393_1075366523300021401SoilEATSMWAGQSVALARKSQPAAEIVAELTSALSAARR
Ga0210397_1000419013300021403SoilLFPAPPMVGTTGEIEALSLWAGQSVALANRRQPAAAIVAELVSRL
Ga0210389_1148657413300021404SoilTGEIEALSQWAGQSVALAKQPQPAAEIISELVSHL
Ga0210390_1074356123300021474SoilDEPAPPMVGTTGDIEALSMWAGQSVALARQPQSAAEIVAELCSRL
Ga0210398_1121643323300021477SoilPMAGTTGDIEALSMWTGQGVALARQPQSAADIVKELTSRL
Ga0224565_104768913300024176Plant LitterPMVGTTGNIEALSMWAGQGVALTRESQSTADIVAELTSRL
Ga0224572_110805213300024225RhizospherePPMVGTTGNIEALSMWAGQGVALTRESQSTADIVAELTSRL
Ga0228598_104544633300024227RhizosphereGTTGEIEALSMWAGQGVALARQPQSAAEIVTELTSRL
Ga0207652_1162351413300025921Corn RhizosphereMVGATSEIEALLMWAGQGVALARQSQSAAEIVAELC
Ga0207678_1157500713300026067Corn RhizosphereLPLEGTTGDIGALSLWAGQSVALAKSRRPAAEIVSELVSRLD
Ga0209839_1002595813300026294SoilMAGTTGEIEALSMWAGQGVALARQPQSAADIVTELTSHL
Ga0208237_102318213300027080Forest SoilMAGTTGDIEALSMWAGQSVALARQTQSAAEIVTELTSRLTGS
Ga0209732_109022713300027117Forest SoilPAPPMTGTTGEIEALSMWAGQGVALARATQSAADIVTELTSRL
Ga0209327_107466523300027307Forest SoilTTGEIEALSMWAGQSVALARQPQSAADIVTELTSRL
Ga0208199_105590913300027497Peatlands SoilPAAPMVGTTGDIEAISLWAGQSVALARQPQPAAAIVAELVSRL
Ga0208042_113503413300027568Peatlands SoilYEPAPPMTGTTGQIEALSMWAGQSVALARRPQSAADIVTELTSRL
Ga0209420_108323823300027648Forest SoilEPAPPMAGTTGDIEALSMWAGQSVALATQPQSAADIVAELTSRL
Ga0209112_1005269623300027817Forest SoilPAPPMAGTTGDIEALSMWAGQSVALARQPQSAADIVAELTSRL
Ga0209274_1032731723300027853SoilEIEALSMWAGQGVALARQSQSAAEIVTELTSRLTGS
Ga0209579_1006816213300027869Surface SoilMTGTTGDIEALSMWAGQSVALARAPQPAADIVAELTSRL
Ga0209169_1008041413300027879SoilMAGTTGDIEALSMWAGQGVALARQPQSAADIVKELTSRL
Ga0209624_1032551833300027895Forest SoilTGDIEALSMWAGQGVALTRESQSTADIVAELTSRL
Ga0209624_1100307013300027895Forest SoilPGAPMVGTTGDIEALSLWAGQSVALAKQTQTSAEIVAELVSGL
Ga0209067_1093827023300027898WatershedsMVGTTGEIEALSMWAGQSVALARQPQSAADIVTELTSRL
Ga0209006_1050393233300027908Forest SoilLGTTGDIEALSLWAGQSVGLARQTQPVSEIVAELVSGL
Ga0307316_1031284213300028755SoilPAPPMAGTTGDIEALSMWAGQSVALARQPQSAADIVSELTSRL
Ga0302232_1016861523300028789PalsaTTGDIEALSMWAGQSVALARQTQSAADIVAELTSRL
Ga0302226_1042353813300028801PalsaAGTTGSIEALSMWAGQSVALATQPQSAADIVAELTSRL
Ga0302235_1001019063300028877PalsaMAGTTGDIEALSMWAGQSVAVARKPQSAADIVTELTSRL
Ga0311368_1020942513300029882PalsaTTGDIEALSMWAGQGVALARQPQSAADIVTELTSRL
Ga0311328_1025664113300029939BogPMVGTTGEIEALSMWAGQGVALARQSQSAADIVTELTSHL
Ga0311352_1068606623300029944PalsaTGDIEALSQWAGQSVALAKQTQSAAEIVAELVSGL
Ga0311352_1137567023300029944PalsaTTGDIEALSMWAGQGVALARQPQSAADIVKELTSRL
Ga0311371_1119810723300029951PalsaTGEIEALSMWAGQSVALARQPQSAADIVAELTSRL
Ga0311371_1194302223300029951PalsaPMEGTTGAIEALSLWAGQSVALVKERQPVAEIVAELVSGL
Ga0311339_1141771313300029999PalsaPMVGTTGEIEALSHWAGQSVALAKQTQSAAEIVAELVSGL
Ga0311338_1011394943300030007PalsaAGTTGEIEALSMWAGQGVALARQSQSAADIVKELTSRL
Ga0302178_1039598313300030013PalsaTGEIEALSMWAGQSVALARQPQSAADIVTELTSRL
Ga0302306_1026768923300030043PalsaMVGTTGEIEALSLWAGQSVALIRETKSCADIVAELVSAL
Ga0302177_1040747413300030053PalsaTGEIEALSMWAGQSVALAREPQSAADIVTELTSHL
Ga0311370_1245181623300030503PalsaTGDIEALSMWAGQDVALARKSQSAADIVAELTSRL
Ga0311372_1038758133300030520PalsaTGEIEPLSLWAGQSVALAKQQQPAAEIVAELVARL
Ga0311356_1054287833300030617PalsaGAPMVGTTGDIEALSLWAGQSVALARQPQSAADIVAELVSGL
Ga0311345_1075547423300030688BogGAPMVGTTGDIEGLSLWAGQSVALVSHPQPAADIVTELVSCL
Ga0302311_1087529013300030739PalsaVRYEPAPPMVGTTGDIEALSQWAGQSVALATQPQSAAEIVAELTSRL
Ga0265461_1238889213300030743SoilGTTGDIEALSMWAGQGVALARQSQSAADIVAELTSRL
Ga0302325_1008414413300031234PalsaAPPMAGTTGEIEALSMWAGQGVALARQSQSAADIVKELTSRL
Ga0302325_1075236513300031234PalsaPAPPMAGTTGDIEALSMWAGQSVALARQPQSAADIVKELTSRL
Ga0302325_1247663823300031234PalsaPMVGTTGDIEAISLWAGQSVALTRQPQTAAEIVAELVSGL
Ga0302326_1150607533300031525PalsaTGDIEALSMWAGQSVALARAPQPAADIVAELTSRL
Ga0310915_1065638223300031573SoilGALSLWAGQGVALANRTQPAADIIAELTSQPQARP
Ga0310686_10310916523300031708SoilTGDIEALSMWAGQSVALARQSQPAADIVAELTSRL
Ga0310686_10493933513300031708SoilMTGTTGEIEALSMWAGQSVALARKSQSAADIVAELTSRL
Ga0310686_10641775823300031708SoilVGTTGDIEALSMWAGQSVALARKPQSAAEIVTELTSRL
Ga0310686_11308222033300031708SoilGTTGDIEALSMWAGQSVALATQPQPAADIVAELTSRL
Ga0310686_11910518013300031708SoilGTTGDIEALSMWAGQSVALARKSQSAADIVKELTSHL
Ga0265342_1023664413300031712RhizosphereGAPMAGTTGDIEGLSLWAGQSVALARQPQSAAEIVAELVSRL
Ga0307474_1002850723300031718Hardwood Forest SoilMTGTTGDIEALSMWAGQSVALARQPQSAADIVAELTSRL
Ga0318500_1038999213300031724SoilGTTGDVGALSLWAGQGVALANRTQPAADIIAELTSQPPARP
Ga0318494_1015874823300031751SoilDNPDAIMSPIEALSMWAGQGVALARKSQSAADIVTELISLL
Ga0307477_1058337213300031753Hardwood Forest SoilMSGTTGDIEALSMWAGQSVALARQPQSAADIVAELTSRL
Ga0318509_1020041623300031768SoilGDTGDIGALSLWAGQSVALAQRIQPAADIIAELASCLPGQP
Ga0318546_1083236823300031771SoilTTDDIEALSMWAGQGVALAKKSQPAADIVTELTSHL
Ga0318566_1044907223300031779SoilMSPIEALSMWAGQGVALARKSQSAADIVTELISLL
Ga0318529_1003868523300031792SoilMVGTTGEIEALSMWAGQSVALARKSQSAADIVAELTSRL
Ga0318564_1016789223300031831SoilAIMSPIEALSMWAGQGVALARKSQSAADIVTELISLL
Ga0318522_1002377913300031894SoilGDIGALSLWAGQSVALAQRIQPAADIIAELASCLPGQP
Ga0306921_1010760443300031912SoilGALSLWAGQSVALAQRIQPAADIIAELASCLPGQP
Ga0315278_1078331913300031997SedimentLEGTTGDIDALSLWAGQSVALATNTQAAADIVAELVSII
Ga0318514_1062500923300032066SoilLALEGTTGDVGALSLWAGQGVALANRTQPAADIIAELTSQPPARP
Ga0306924_1231208723300032076SoilDVGALSLWAGQGVALANRTQPAADIIAELTSQPPARP
Ga0311301_1077392923300032160Peatlands SoilAPLMVGTTGEIEALSMWAGQSVALARQPQSAADIVTELTSRL
Ga0311301_1078344613300032160Peatlands SoilPAPPMGGTTGEIEALSMWAGQSVALARESQSAADIVTELTSRL
Ga0315283_1061353533300032164SedimentTTGDIGALSLWAGQSVALATRTQAAADIVAELVSRI
Ga0315270_1072210413300032275SedimentSTMPLEGTTGDIGALSLWAGQSVALATNTQAAADIVAELVSII
Ga0335080_1167167613300032828SoilAGTTGEIEALSMWAGQGVALAKRSLSAADIVSELTSRL
Ga0335081_1255160813300032892SoilMAGTIGEIEALSIWAGPGIALARQPQSAADIVTELTSNL
Ga0335075_1038519513300032896SoilMAGTTGDIEALSMWAGQSVALARQPQPAADIVAELTSRL
Ga0335072_1090117313300032898SoilAPPMVGTTGDIEALSMWAGQSVALASKSQSAADIVTELTSRL
Ga0335076_1015071813300032955SoilMVGTTGEIEALSMWAGQSVALARRTQPAAAIVAELVSRL
Ga0335076_1093509223300032955SoilTGTTGEIEALSMWAGQSVALARQPQPAADIVAELTSRL
Ga0335073_1000291713300033134SoilGTTGEIEPLSLWAGQSVALAKRSQSAAEIVAELVSQL
Ga0318519_1105911323300033290SoilGALSLWAGQSVALAKRTQPAADIIAELTSQLQARR
Ga0310811_1111842013300033475SoilTTGDIEALSMWAGQDVALARQVQPAADIVAELTSRL
Ga0334840_129992_514_6333300033824SoilMVGTTGEIEALSMWAGQGVALARQSQSAADIVTELTSHL
Ga0334827_214032_1_1203300034065SoilMVGTTGEIEALSMWAGQGVALAKESQSAADIVKELTSRL
Ga0370515_0270671_468_5873300034163Untreated Peat SoilMVGTTGEIEALSLWAGQSVALAKHSQPAAEIVAELVSRL
Ga0370515_0336288_40_1593300034163Untreated Peat SoilMAGTTGEIEALSMWAGQDVALARKSQSAADIVTELTSRL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.