| Basic Information | |
|---|---|
| Family ID | F035923 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 171 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MTGTTGDIEALSMWAGQSVALARQPQSAADIVAELTSRL |
| Number of Associated Samples | 142 |
| Number of Associated Scaffolds | 171 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 16.96 % |
| % of genes near scaffold ends (potentially truncated) | 77.78 % |
| % of genes from short scaffolds (< 2000 bps) | 85.96 % |
| Associated GOLD sequencing projects | 135 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.795 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa (12.281 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.637 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.784 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.79% β-sheet: 0.00% Coil/Unstructured: 58.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 171 Family Scaffolds |
|---|---|---|
| PF07859 | Abhydrolase_3 | 9.94 |
| PF00903 | Glyoxalase | 8.77 |
| PF02426 | MIase | 4.09 |
| PF12680 | SnoaL_2 | 4.09 |
| PF00106 | adh_short | 3.51 |
| PF13561 | adh_short_C2 | 3.51 |
| PF00196 | GerE | 3.51 |
| PF00732 | GMC_oxred_N | 2.92 |
| PF00578 | AhpC-TSA | 2.92 |
| PF03060 | NMO | 2.92 |
| PF03795 | YCII | 1.75 |
| PF00108 | Thiolase_N | 1.75 |
| PF00881 | Nitroreductase | 1.17 |
| PF13335 | Mg_chelatase_C | 1.17 |
| PF13185 | GAF_2 | 1.17 |
| PF05345 | He_PIG | 1.17 |
| PF08281 | Sigma70_r4_2 | 1.17 |
| PF00795 | CN_hydrolase | 1.17 |
| PF13191 | AAA_16 | 1.17 |
| PF13360 | PQQ_2 | 1.17 |
| PF00723 | Glyco_hydro_15 | 0.58 |
| PF00313 | CSD | 0.58 |
| PF01381 | HTH_3 | 0.58 |
| PF12681 | Glyoxalase_2 | 0.58 |
| PF00484 | Pro_CA | 0.58 |
| PF13531 | SBP_bac_11 | 0.58 |
| PF00487 | FA_desaturase | 0.58 |
| PF07690 | MFS_1 | 0.58 |
| PF00083 | Sugar_tr | 0.58 |
| PF07366 | SnoaL | 0.58 |
| PF01425 | Amidase | 0.58 |
| PF03807 | F420_oxidored | 0.58 |
| PF03061 | 4HBT | 0.58 |
| PF16925 | TetR_C_13 | 0.58 |
| PF00664 | ABC_membrane | 0.58 |
| PF00248 | Aldo_ket_red | 0.58 |
| PF03595 | SLAC1 | 0.58 |
| PF01717 | Meth_synt_2 | 0.58 |
| PF00848 | Ring_hydroxyl_A | 0.58 |
| PF01180 | DHO_dh | 0.58 |
| PF06078 | DUF937 | 0.58 |
| PF13570 | PQQ_3 | 0.58 |
| PF07992 | Pyr_redox_2 | 0.58 |
| PF00596 | Aldolase_II | 0.58 |
| PF01738 | DLH | 0.58 |
| PF11578 | DUF3237 | 0.58 |
| PF02909 | TetR_C_1 | 0.58 |
| PF07971 | Glyco_hydro_92 | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 171 Family Scaffolds |
|---|---|---|---|
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 9.94 |
| COG4829 | Muconolactone delta-isomerase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 4.09 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 3.51 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 2.92 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 2.92 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 1.75 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.75 |
| COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 1.17 |
| COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 0.58 |
| COG3753 | Uncharacterized conserved protein YidB, DUF937 family | Function unknown [S] | 0.58 |
| COG3537 | Putative alpha-1,2-mannosidase | Carbohydrate transport and metabolism [G] | 0.58 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.58 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.58 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.58 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.58 |
| COG1275 | Tellurite resistance protein TehA and related permeases | Defense mechanisms [V] | 0.58 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.58 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.58 |
| COG0167 | Dihydroorotate dehydrogenase | Nucleotide transport and metabolism [F] | 0.58 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.80 % |
| Unclassified | root | N/A | 15.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003505|JGIcombinedJ51221_10224552 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300004479|Ga0062595_100832525 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300005435|Ga0070714_100212989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1772 | Open in IMG/M |
| 3300005435|Ga0070714_102038013 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005467|Ga0070706_100258092 | All Organisms → cellular organisms → Bacteria | 1627 | Open in IMG/M |
| 3300005538|Ga0070731_10095716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1967 | Open in IMG/M |
| 3300005569|Ga0066705_10586413 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300005602|Ga0070762_10810004 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300005602|Ga0070762_10969762 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300005602|Ga0070762_10988941 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300005615|Ga0070702_100732335 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300005618|Ga0068864_101135218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 779 | Open in IMG/M |
| 3300006028|Ga0070717_10083022 | All Organisms → cellular organisms → Bacteria | 2693 | Open in IMG/M |
| 3300006028|Ga0070717_10726764 | Not Available | 902 | Open in IMG/M |
| 3300006059|Ga0075017_100059620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2582 | Open in IMG/M |
| 3300006059|Ga0075017_101427568 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300006173|Ga0070716_100157625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1467 | Open in IMG/M |
| 3300006755|Ga0079222_11429463 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300006804|Ga0079221_10279396 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300009098|Ga0105245_12786822 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300009520|Ga0116214_1063382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → unclassified Actinospica → Actinospica sp. MGRD01-02 | 1345 | Open in IMG/M |
| 3300009521|Ga0116222_1339728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 651 | Open in IMG/M |
| 3300009525|Ga0116220_10521963 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300009644|Ga0116121_1214413 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300009665|Ga0116135_1242242 | Not Available | 699 | Open in IMG/M |
| 3300009824|Ga0116219_10656901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → unclassified Actinospica → Actinospica sp. MGRD01-02 | 575 | Open in IMG/M |
| 3300010361|Ga0126378_11998070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 661 | Open in IMG/M |
| 3300010361|Ga0126378_12776711 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300010379|Ga0136449_102962356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter → unclassified Anaeromyxobacter → Anaeromyxobacter sp. SG22 | 664 | Open in IMG/M |
| 3300010396|Ga0134126_12164646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 607 | Open in IMG/M |
| 3300010866|Ga0126344_1016227 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300010880|Ga0126350_11521861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1180 | Open in IMG/M |
| 3300010880|Ga0126350_12186307 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300010880|Ga0126350_12228768 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300011003|Ga0138514_100013943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1359 | Open in IMG/M |
| 3300011120|Ga0150983_15797356 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300012469|Ga0150984_103579060 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300012930|Ga0137407_10671523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → unclassified Actinospica → Actinospica sp. MGRD01-02 | 975 | Open in IMG/M |
| 3300014156|Ga0181518_10068202 | All Organisms → cellular organisms → Bacteria | 2060 | Open in IMG/M |
| 3300014164|Ga0181532_10314903 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300014168|Ga0181534_10566224 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300014200|Ga0181526_10078728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2100 | Open in IMG/M |
| 3300014201|Ga0181537_11238560 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300014487|Ga0182000_10667934 | Not Available | 509 | Open in IMG/M |
| 3300014495|Ga0182015_10358460 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300014495|Ga0182015_10551172 | Not Available | 734 | Open in IMG/M |
| 3300014501|Ga0182024_12184096 | Not Available | 606 | Open in IMG/M |
| 3300016341|Ga0182035_12105303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides panacis | 512 | Open in IMG/M |
| 3300016371|Ga0182034_10590679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 936 | Open in IMG/M |
| 3300017821|Ga0187812_1016434 | All Organisms → cellular organisms → Bacteria | 2555 | Open in IMG/M |
| 3300017924|Ga0187820_1277972 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300017926|Ga0187807_1089937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 962 | Open in IMG/M |
| 3300017928|Ga0187806_1006896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3127 | Open in IMG/M |
| 3300017928|Ga0187806_1232089 | Not Available | 634 | Open in IMG/M |
| 3300017932|Ga0187814_10101204 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300017932|Ga0187814_10158947 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300017932|Ga0187814_10223502 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300017938|Ga0187854_10503353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → unclassified Actinospica → Actinospica sp. MGRD01-02 | 501 | Open in IMG/M |
| 3300017942|Ga0187808_10116215 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300017943|Ga0187819_10629652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis acidiphila | 607 | Open in IMG/M |
| 3300017946|Ga0187879_10017172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4500 | Open in IMG/M |
| 3300017946|Ga0187879_10622881 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300017948|Ga0187847_10064435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2058 | Open in IMG/M |
| 3300017961|Ga0187778_11202723 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300017970|Ga0187783_10502991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 878 | Open in IMG/M |
| 3300017974|Ga0187777_10645912 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300018019|Ga0187874_10229782 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300018033|Ga0187867_10005998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9108 | Open in IMG/M |
| 3300018033|Ga0187867_10038604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2930 | Open in IMG/M |
| 3300018034|Ga0187863_10880499 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300018035|Ga0187875_10078054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1900 | Open in IMG/M |
| 3300018035|Ga0187875_10425589 | Not Available | 708 | Open in IMG/M |
| 3300018042|Ga0187871_10652622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 585 | Open in IMG/M |
| 3300018058|Ga0187766_10474332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 839 | Open in IMG/M |
| 3300018058|Ga0187766_10618014 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300018062|Ga0187784_11459377 | Not Available | 542 | Open in IMG/M |
| 3300018062|Ga0187784_11674684 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300018085|Ga0187772_10317128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1071 | Open in IMG/M |
| 3300019786|Ga0182025_1189084 | All Organisms → cellular organisms → Bacteria | 2221 | Open in IMG/M |
| 3300019890|Ga0193728_1153242 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300020581|Ga0210399_10654612 | Not Available | 866 | Open in IMG/M |
| 3300021170|Ga0210400_10345827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella panacisegetis | 1224 | Open in IMG/M |
| 3300021181|Ga0210388_11287152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 617 | Open in IMG/M |
| 3300021401|Ga0210393_10753665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces olivochromogenes | 793 | Open in IMG/M |
| 3300021403|Ga0210397_10004190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8845 | Open in IMG/M |
| 3300021404|Ga0210389_11486574 | Not Available | 515 | Open in IMG/M |
| 3300021474|Ga0210390_10743561 | Not Available | 815 | Open in IMG/M |
| 3300021477|Ga0210398_11216433 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300024176|Ga0224565_1047689 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300024225|Ga0224572_1108052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter → unclassified Anaeromyxobacter → Anaeromyxobacter sp. SG22 | 515 | Open in IMG/M |
| 3300024227|Ga0228598_1045446 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300025921|Ga0207652_11623514 | Not Available | 551 | Open in IMG/M |
| 3300026067|Ga0207678_11575007 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300026294|Ga0209839_10025958 | Not Available | 2255 | Open in IMG/M |
| 3300027080|Ga0208237_1023182 | Not Available | 935 | Open in IMG/M |
| 3300027117|Ga0209732_1090227 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300027307|Ga0209327_1074665 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300027497|Ga0208199_1055909 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300027568|Ga0208042_1135034 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300027648|Ga0209420_1083238 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300027817|Ga0209112_10052696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. CME 23 | 1246 | Open in IMG/M |
| 3300027853|Ga0209274_10327317 | Not Available | 788 | Open in IMG/M |
| 3300027869|Ga0209579_10068162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1883 | Open in IMG/M |
| 3300027879|Ga0209169_10080414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1684 | Open in IMG/M |
| 3300027895|Ga0209624_10325518 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300027895|Ga0209624_11003070 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300027898|Ga0209067_10938270 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300027908|Ga0209006_10503932 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300028755|Ga0307316_10312842 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300028789|Ga0302232_10168615 | Not Available | 1099 | Open in IMG/M |
| 3300028801|Ga0302226_10423538 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300028877|Ga0302235_10010190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5739 | Open in IMG/M |
| 3300029882|Ga0311368_10209425 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
| 3300029939|Ga0311328_10256641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1316 | Open in IMG/M |
| 3300029944|Ga0311352_10686066 | Not Available | 810 | Open in IMG/M |
| 3300029944|Ga0311352_11375670 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300029951|Ga0311371_11198107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 878 | Open in IMG/M |
| 3300029951|Ga0311371_11943022 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300029999|Ga0311339_11417713 | Not Available | 623 | Open in IMG/M |
| 3300030007|Ga0311338_10113949 | All Organisms → cellular organisms → Bacteria | 3320 | Open in IMG/M |
| 3300030013|Ga0302178_10395983 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300030043|Ga0302306_10267689 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300030053|Ga0302177_10407474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora lupini → Micromonospora lupini str. Lupac 08 | 711 | Open in IMG/M |
| 3300030503|Ga0311370_12451816 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300030520|Ga0311372_10387581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2128 | Open in IMG/M |
| 3300030617|Ga0311356_10542878 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300030688|Ga0311345_10755474 | Not Available | 771 | Open in IMG/M |
| 3300030739|Ga0302311_10875290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Planctomonas → unclassified Planctomonas → Planctomonas sp. JC2975 | 578 | Open in IMG/M |
| 3300030743|Ga0265461_12388892 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300031234|Ga0302325_10084144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 6062 | Open in IMG/M |
| 3300031234|Ga0302325_10752365 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
| 3300031234|Ga0302325_12476638 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300031525|Ga0302326_11506075 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300031573|Ga0310915_10656382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides panacis | 742 | Open in IMG/M |
| 3300031708|Ga0310686_103109165 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300031708|Ga0310686_104939335 | Not Available | 3230 | Open in IMG/M |
| 3300031708|Ga0310686_106417758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium nebraskense | 523 | Open in IMG/M |
| 3300031708|Ga0310686_113082220 | Not Available | 1305 | Open in IMG/M |
| 3300031708|Ga0310686_119105180 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300031712|Ga0265342_10236644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 979 | Open in IMG/M |
| 3300031718|Ga0307474_10028507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4084 | Open in IMG/M |
| 3300031724|Ga0318500_10389992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides panacis | 691 | Open in IMG/M |
| 3300031751|Ga0318494_10158748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1276 | Open in IMG/M |
| 3300031753|Ga0307477_10583372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales | 755 | Open in IMG/M |
| 3300031768|Ga0318509_10200416 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300031771|Ga0318546_10832368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 650 | Open in IMG/M |
| 3300031779|Ga0318566_10449072 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300031792|Ga0318529_10038685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus | 2014 | Open in IMG/M |
| 3300031831|Ga0318564_10167892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 979 | Open in IMG/M |
| 3300031894|Ga0318522_10023779 | All Organisms → cellular organisms → Bacteria | 2018 | Open in IMG/M |
| 3300031912|Ga0306921_10107604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 3237 | Open in IMG/M |
| 3300031997|Ga0315278_10783319 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 964 | Open in IMG/M |
| 3300032066|Ga0318514_10625009 | Not Available | 573 | Open in IMG/M |
| 3300032076|Ga0306924_12312087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides panacis | 545 | Open in IMG/M |
| 3300032160|Ga0311301_10773929 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300032160|Ga0311301_10783446 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
| 3300032164|Ga0315283_10613535 | Not Available | 1177 | Open in IMG/M |
| 3300032275|Ga0315270_10722104 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300032828|Ga0335080_11671676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 625 | Open in IMG/M |
| 3300032892|Ga0335081_12551608 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300032896|Ga0335075_10385195 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
| 3300032898|Ga0335072_10901173 | Not Available | 828 | Open in IMG/M |
| 3300032955|Ga0335076_10150718 | All Organisms → cellular organisms → Bacteria | 2241 | Open in IMG/M |
| 3300032955|Ga0335076_10935092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter → unclassified Anaeromyxobacter → Anaeromyxobacter sp. SG22 | 749 | Open in IMG/M |
| 3300033134|Ga0335073_10002917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 23623 | Open in IMG/M |
| 3300033290|Ga0318519_11059113 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300033475|Ga0310811_11118420 | Not Available | 665 | Open in IMG/M |
| 3300033824|Ga0334840_129992 | Not Available | 676 | Open in IMG/M |
| 3300034065|Ga0334827_214032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea rhodomycinica | 573 | Open in IMG/M |
| 3300034163|Ga0370515_0270671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Herbidospora → Herbidospora sakaeratensis | 720 | Open in IMG/M |
| 3300034163|Ga0370515_0336288 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 12.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.70% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.43% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.26% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.68% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.68% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.34% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.34% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.92% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.75% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.75% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.17% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.17% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.17% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.17% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.17% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.17% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.17% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.17% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.17% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.17% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.58% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.58% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.58% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.58% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.58% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.58% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.58% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300024176 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300027080 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes) | Environmental | Open in IMG/M |
| 3300027117 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027307 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033824 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S2 5-9 | Environmental | Open in IMG/M |
| 3300034065 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ51221_102245521 | 3300003505 | Forest Soil | EPAPPMAGTTGEIEALSMWAGQSVALARRSQSAADIVAELTAGL* |
| Ga0062595_1008325251 | 3300004479 | Soil | EGTTGDIGALSLWAGQSVALAKSRRPAAEIVSELVSRLD* |
| Ga0070714_1002129892 | 3300005435 | Agricultural Soil | MVGATSEIEALLMWAGQGVALARQSQSAAEIVAELCSGL* |
| Ga0070714_1020380132 | 3300005435 | Agricultural Soil | YEPAPPMAGTTGEIEALSMWAGQSVALARQPQSAADIVTELTSRL* |
| Ga0070706_1002580921 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | YEPAPPMAGTTGDIEALSMWAGQSVALARQPQSAADIVTELTSRL* |
| Ga0070731_100957162 | 3300005538 | Surface Soil | MTGTTGDIEALSMWAGQSVALARAPQPAADIVAELTSRL* |
| Ga0066705_105864132 | 3300005569 | Soil | TTGEIEALSMWAGQGVALARQPQSAADIVTELTSHLSPGP* |
| Ga0070762_108100041 | 3300005602 | Soil | PPMIGTTGDIEALSMWAGQSVALARQPQSAADIVTELTSHL* |
| Ga0070762_109697621 | 3300005602 | Soil | TGDIEALSMWAGQSVALVREPQSAAEIVTELTSRL* |
| Ga0070762_109889411 | 3300005602 | Soil | YEPAPPMVGTTGDIEALSQWAGQSVALARQPPQPAAEIVAELVARL* |
| Ga0070702_1007323351 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGTTGEIEALSMWAGQSVALARQPQSAADIVTELTSRL* |
| Ga0068864_1011352183 | 3300005618 | Switchgrass Rhizosphere | TTGEIEALSMWAGQSVALARQVQPAAQIVAELVSGL* |
| Ga0070717_100830224 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | TGTTGDIEALSMWAGQSVALARQPQPAAGIVAELTSRL* |
| Ga0070717_107267641 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | TGEIEPLSLWAGQSVALANRTQPAADIVAELVSRL* |
| Ga0075017_1000596205 | 3300006059 | Watersheds | SAADGGTTGDIEALSMWAGQSVALARQPRPAADIVAELVSRL* |
| Ga0075017_1014275682 | 3300006059 | Watersheds | GDIEALSMWAGQGVALARQSQSAADIVTELTSRL* |
| Ga0070716_1001576254 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGTTGEIEALSMWAGQSVALARQPQAAADIVTELTSRL* |
| Ga0079222_114294631 | 3300006755 | Agricultural Soil | AGTTGDIEALSMWAGQSVALARQPQPAADIVAELTSRL* |
| Ga0079221_102793961 | 3300006804 | Agricultural Soil | GDIEALSMWAGQSVALARQPQPVADIVAELTSRL* |
| Ga0105245_127868222 | 3300009098 | Miscanthus Rhizosphere | TGDIDALSLWAGQSVALARRRQPASEILADLVSRLD* |
| Ga0116214_10633821 | 3300009520 | Peatlands Soil | MAGTTGEIEALSMWAGQGVALAGQSQSAADIVTELCSRL* |
| Ga0116222_13397281 | 3300009521 | Peatlands Soil | TGEIEALSLWAGQSVALAKQPQPAAEIIAELISRL* |
| Ga0116220_105219631 | 3300009525 | Peatlands Soil | GEIEALSMWAGQGVALARQPQSAADIVTELTSRL* |
| Ga0116121_12144131 | 3300009644 | Peatland | TGEIEALSMSAGQSVALAKKSQSAADIVTELTSRL* |
| Ga0116135_12422422 | 3300009665 | Peatland | AAPMVGTIGDIEALSLWAGQSVALARQPQSAAEIVAELVSGL* |
| Ga0116219_106569012 | 3300009824 | Peatlands Soil | MAGTTGEIEALSMWAGQGVALAGQSQSAADIVTELTSRL* |
| Ga0126378_119980702 | 3300010361 | Tropical Forest Soil | PGRSPWNWHLSGTTGEIEALSMWAGQSVALARQSQSAAEIVAELTSEL* |
| Ga0126378_127767111 | 3300010361 | Tropical Forest Soil | MTGTTGDIEVLSMWAGQGVTLARQPQPAADIVTELTSRL* |
| Ga0136449_1029623561 | 3300010379 | Peatlands Soil | GTTGDIEALSMWAGQSVALARKPQSAAEIVTELTSRL* |
| Ga0134126_121646461 | 3300010396 | Terrestrial Soil | MTGDIDALSLWAGQSVALARARRPAAEIVADLVSRL* |
| Ga0126344_10162271 | 3300010866 | Boreal Forest Soil | TGDIEALSMWAGQGVALMHQDQSAADIVKELTSRL* |
| Ga0126350_115218612 | 3300010880 | Boreal Forest Soil | MVGTTGEIEALSMWAGQDVALARKSESAADIVAELTSRL* |
| Ga0126350_121863071 | 3300010880 | Boreal Forest Soil | TGDIEALSMWAGQSVALARAPQSAAEIVTELTSRL* |
| Ga0126350_122287681 | 3300010880 | Boreal Forest Soil | TTGEIEALSMWAGQDVALARKSQSAADIVAELTSRL* |
| Ga0138514_1000139433 | 3300011003 | Soil | MVGTIGEIEALSLWAGQSVALAKQSQPAAEIVAELVSRL* |
| Ga0150983_157973562 | 3300011120 | Forest Soil | APPMIGTTGDIEALSMWAGQGVALAKLSQSAADIVSELTSRL* |
| Ga0150984_1035790603 | 3300012469 | Avena Fatua Rhizosphere | MVGTTGEIEALSLWAGQSVALAKQPQPAEEVVAELVSRL* |
| Ga0137407_106715232 | 3300012930 | Vadose Zone Soil | MVGTTGDIEALSMWAGQDVALATKSQSAADIVAELTSHL* |
| Ga0181518_100682021 | 3300014156 | Bog | MVGTTGDIEALSLWAGQSVALAREPQSAAGIVAELVSGLESKSA* |
| Ga0181532_103149032 | 3300014164 | Bog | MVGTTGEIEALSMWAGQSVALAKKSQSAADIVTELTSRL* |
| Ga0181534_105662241 | 3300014168 | Bog | EPAPPMVGTTGDIEALSMWAGQSVALARQPQSAADIVAELVSGL* |
| Ga0181526_100787285 | 3300014200 | Bog | PMVGTTGDIEAISLWAGQSVALARQPQSAADIVAELVSGL* |
| Ga0181537_112385601 | 3300014201 | Bog | MVGTTGEIEALSQWAGQSVALAKQSQPAAEIVAELVSRL* |
| Ga0182000_106679342 | 3300014487 | Soil | MAGTTGDIEALSMWAGQSVALARKPQSAAEIVTELTSHL* |
| Ga0182015_103584601 | 3300014495 | Palsa | TTGDIEALSMWAGQSVALARQPRPAAEIVAELVSRL* |
| Ga0182015_105511722 | 3300014495 | Palsa | AGTTGDIEALSMWAGQSVALARQPQSAAEIVTELTSRL* |
| Ga0182024_121840961 | 3300014501 | Permafrost | TGEIEALSMWAGQSVALARQPQSAAEIVTELTSRL* |
| Ga0182035_121053031 | 3300016341 | Soil | SSALALEGTTGDVGALSMWAGQSVALAKRTQPAADIIAELTT |
| Ga0182034_105906791 | 3300016371 | Soil | MSPIEALSMWAGQGVALARKSQSAADIVTELTSHL |
| Ga0187812_10164342 | 3300017821 | Freshwater Sediment | MAGTTGEIEALSMWAGQGVALAGQSQSAADIVTELCSRL |
| Ga0187820_12779722 | 3300017924 | Freshwater Sediment | APPMVGTTGEIEALSMWAGQGVALARQSQSAADIVTELTSRL |
| Ga0187807_10899371 | 3300017926 | Freshwater Sediment | TGEIEALSMWAGQGIALARKSQSAADIVAELTSRL |
| Ga0187806_10068963 | 3300017928 | Freshwater Sediment | MLGTTGDIEALSMWAGQDIALVRHSQSAAEIVTELIYRL |
| Ga0187806_12320891 | 3300017928 | Freshwater Sediment | TTGDIEALSMWAGQSVALARAPQPAADIVAELTSRL |
| Ga0187814_101012042 | 3300017932 | Freshwater Sediment | MLGTTGDIEALSMWAGQDIALVRHSQSAAEIVTELISRL |
| Ga0187814_101589471 | 3300017932 | Freshwater Sediment | TGEIEALSMWAGQSVALATKAQPAAAIVAELTSRL |
| Ga0187814_102235022 | 3300017932 | Freshwater Sediment | APPMTGTTGDIEALSMWAGQSVALARQPQAAADIVAELTSRL |
| Ga0187854_105033532 | 3300017938 | Peatland | MVGTTGEIEALSMWAGQSVALAKKSQSAADIVTELTSRL |
| Ga0187808_101162151 | 3300017942 | Freshwater Sediment | MAGTTGQIEALSMWAGQSVALARQPQSAADIVTELTSRL |
| Ga0187819_106296521 | 3300017943 | Freshwater Sediment | ELLGVPRTTGEVEALSMWAGQSVALPRRAQPAAEIVSELVSGF |
| Ga0187879_100171722 | 3300017946 | Peatland | MAGTTGDIEALSMWAGQGVALARQPQSAADIVAELTSGL |
| Ga0187879_106228812 | 3300017946 | Peatland | AGTTGDIEALSMWAGQSVALARQPQSAADIVTELTSHL |
| Ga0187847_100644352 | 3300017948 | Peatland | MVGTTGESEALSLWAGQSVALAKRPQPAAEIVAELVSRF |
| Ga0187778_112027231 | 3300017961 | Tropical Peatland | TGDIEALSMWAGQSVALARASQPAADIVAELTSRL |
| Ga0187783_105029911 | 3300017970 | Tropical Peatland | TTGEIEALSMWAGQSVALARQSQSAADIVAELPSRL |
| Ga0187777_106459122 | 3300017974 | Tropical Peatland | GTTGEIEALSMWAGQAVALARKSQSAAEIVAELTSRL |
| Ga0187874_102297822 | 3300018019 | Peatland | VIAHFASGESIVRYEPAPPMAGTTGDIEALSMWARQSAALARQPQSAADIVTELT |
| Ga0187867_100059981 | 3300018033 | Peatland | MIGTTGDIEALSMWAGQDVALARQTQSAADIVAELTSRL |
| Ga0187867_100386043 | 3300018033 | Peatland | MAGTTGDIEALSMWAGQSVALARQPQSAADIVTELTSHL |
| Ga0187863_108804992 | 3300018034 | Peatland | MVGTTGEIEALSMWAGQGVALARESRSAADIVTELTSRL |
| Ga0187875_100780541 | 3300018035 | Peatland | MVGTTGEIEALSMWAGQSVALARRVQPAAEIVTELTSRLGDRLV |
| Ga0187875_104255893 | 3300018035 | Peatland | APMVGTTGDIEALSLWAGQSVALAREPQSAAGIVAELVSGLESKSA |
| Ga0187871_106526221 | 3300018042 | Peatland | TTGQIEALSMWAGQGVALAKERQSAADIVTELTSHL |
| Ga0187766_104743321 | 3300018058 | Tropical Peatland | TTGEIEALSQWAGQSVALAKQSRPAAQIVGELVSRL |
| Ga0187766_106180142 | 3300018058 | Tropical Peatland | MVGTTPEIETLSLWAGQSVALAKRSQPAAEIVAEPVSRL |
| Ga0187784_114593771 | 3300018062 | Tropical Peatland | TGDVEALSLWAGQSVALAKQPQTAAEIVAELVSGL |
| Ga0187784_116746841 | 3300018062 | Tropical Peatland | TGEIEALSMWAGQSVALARQPQSAADIVAELTTRL |
| Ga0187772_103171281 | 3300018085 | Tropical Peatland | GTTGEIEPLSMWAGQGVALARESQSAADIVAELTSRL |
| Ga0182025_11890844 | 3300019786 | Permafrost | MAGTTGEIEALSMWAGQGIALARQPQSAAEIVAELTSHL |
| Ga0193728_11532421 | 3300019890 | Soil | EGDIDAMSLWAGQSVALARAVEPAAAIVAELVSRL |
| Ga0210399_106546122 | 3300020581 | Soil | PMAGTTGDIEALSMWAGQSVALARTPQSAADIVAELTSRL |
| Ga0210400_103458271 | 3300021170 | Soil | MVGTTGEIEALSLWAGQSVALARQSQPAAAIVAELVSCF |
| Ga0210388_112871522 | 3300021181 | Soil | TGDIEALSMWAGQSVALARQPQPAADIVAELTSRL |
| Ga0210393_107536652 | 3300021401 | Soil | EATSMWAGQSVALARKSQPAAEIVAELTSALSAARR |
| Ga0210397_100041901 | 3300021403 | Soil | LFPAPPMVGTTGEIEALSLWAGQSVALANRRQPAAAIVAELVSRL |
| Ga0210389_114865741 | 3300021404 | Soil | TGEIEALSQWAGQSVALAKQPQPAAEIISELVSHL |
| Ga0210390_107435612 | 3300021474 | Soil | DEPAPPMVGTTGDIEALSMWAGQSVALARQPQSAAEIVAELCSRL |
| Ga0210398_112164332 | 3300021477 | Soil | PMAGTTGDIEALSMWTGQGVALARQPQSAADIVKELTSRL |
| Ga0224565_10476891 | 3300024176 | Plant Litter | PMVGTTGNIEALSMWAGQGVALTRESQSTADIVAELTSRL |
| Ga0224572_11080521 | 3300024225 | Rhizosphere | PPMVGTTGNIEALSMWAGQGVALTRESQSTADIVAELTSRL |
| Ga0228598_10454463 | 3300024227 | Rhizosphere | GTTGEIEALSMWAGQGVALARQPQSAAEIVTELTSRL |
| Ga0207652_116235141 | 3300025921 | Corn Rhizosphere | MVGATSEIEALLMWAGQGVALARQSQSAAEIVAELC |
| Ga0207678_115750071 | 3300026067 | Corn Rhizosphere | LPLEGTTGDIGALSLWAGQSVALAKSRRPAAEIVSELVSRLD |
| Ga0209839_100259581 | 3300026294 | Soil | MAGTTGEIEALSMWAGQGVALARQPQSAADIVTELTSHL |
| Ga0208237_10231821 | 3300027080 | Forest Soil | MAGTTGDIEALSMWAGQSVALARQTQSAAEIVTELTSRLTGS |
| Ga0209732_10902271 | 3300027117 | Forest Soil | PAPPMTGTTGEIEALSMWAGQGVALARATQSAADIVTELTSRL |
| Ga0209327_10746652 | 3300027307 | Forest Soil | TTGEIEALSMWAGQSVALARQPQSAADIVTELTSRL |
| Ga0208199_10559091 | 3300027497 | Peatlands Soil | PAAPMVGTTGDIEAISLWAGQSVALARQPQPAAAIVAELVSRL |
| Ga0208042_11350341 | 3300027568 | Peatlands Soil | YEPAPPMTGTTGQIEALSMWAGQSVALARRPQSAADIVTELTSRL |
| Ga0209420_10832382 | 3300027648 | Forest Soil | EPAPPMAGTTGDIEALSMWAGQSVALATQPQSAADIVAELTSRL |
| Ga0209112_100526962 | 3300027817 | Forest Soil | PAPPMAGTTGDIEALSMWAGQSVALARQPQSAADIVAELTSRL |
| Ga0209274_103273172 | 3300027853 | Soil | EIEALSMWAGQGVALARQSQSAAEIVTELTSRLTGS |
| Ga0209579_100681621 | 3300027869 | Surface Soil | MTGTTGDIEALSMWAGQSVALARAPQPAADIVAELTSRL |
| Ga0209169_100804141 | 3300027879 | Soil | MAGTTGDIEALSMWAGQGVALARQPQSAADIVKELTSRL |
| Ga0209624_103255183 | 3300027895 | Forest Soil | TGDIEALSMWAGQGVALTRESQSTADIVAELTSRL |
| Ga0209624_110030701 | 3300027895 | Forest Soil | PGAPMVGTTGDIEALSLWAGQSVALAKQTQTSAEIVAELVSGL |
| Ga0209067_109382702 | 3300027898 | Watersheds | MVGTTGEIEALSMWAGQSVALARQPQSAADIVTELTSRL |
| Ga0209006_105039323 | 3300027908 | Forest Soil | LGTTGDIEALSLWAGQSVGLARQTQPVSEIVAELVSGL |
| Ga0307316_103128421 | 3300028755 | Soil | PAPPMAGTTGDIEALSMWAGQSVALARQPQSAADIVSELTSRL |
| Ga0302232_101686152 | 3300028789 | Palsa | TTGDIEALSMWAGQSVALARQTQSAADIVAELTSRL |
| Ga0302226_104235381 | 3300028801 | Palsa | AGTTGSIEALSMWAGQSVALATQPQSAADIVAELTSRL |
| Ga0302235_100101906 | 3300028877 | Palsa | MAGTTGDIEALSMWAGQSVAVARKPQSAADIVTELTSRL |
| Ga0311368_102094251 | 3300029882 | Palsa | TTGDIEALSMWAGQGVALARQPQSAADIVTELTSRL |
| Ga0311328_102566411 | 3300029939 | Bog | PMVGTTGEIEALSMWAGQGVALARQSQSAADIVTELTSHL |
| Ga0311352_106860662 | 3300029944 | Palsa | TGDIEALSQWAGQSVALAKQTQSAAEIVAELVSGL |
| Ga0311352_113756702 | 3300029944 | Palsa | TTGDIEALSMWAGQGVALARQPQSAADIVKELTSRL |
| Ga0311371_111981072 | 3300029951 | Palsa | TGEIEALSMWAGQSVALARQPQSAADIVAELTSRL |
| Ga0311371_119430222 | 3300029951 | Palsa | PMEGTTGAIEALSLWAGQSVALVKERQPVAEIVAELVSGL |
| Ga0311339_114177131 | 3300029999 | Palsa | PMVGTTGEIEALSHWAGQSVALAKQTQSAAEIVAELVSGL |
| Ga0311338_101139494 | 3300030007 | Palsa | AGTTGEIEALSMWAGQGVALARQSQSAADIVKELTSRL |
| Ga0302178_103959831 | 3300030013 | Palsa | TGEIEALSMWAGQSVALARQPQSAADIVTELTSRL |
| Ga0302306_102676892 | 3300030043 | Palsa | MVGTTGEIEALSLWAGQSVALIRETKSCADIVAELVSAL |
| Ga0302177_104074741 | 3300030053 | Palsa | TGEIEALSMWAGQSVALAREPQSAADIVTELTSHL |
| Ga0311370_124518162 | 3300030503 | Palsa | TGDIEALSMWAGQDVALARKSQSAADIVAELTSRL |
| Ga0311372_103875813 | 3300030520 | Palsa | TGEIEPLSLWAGQSVALAKQQQPAAEIVAELVARL |
| Ga0311356_105428783 | 3300030617 | Palsa | GAPMVGTTGDIEALSLWAGQSVALARQPQSAADIVAELVSGL |
| Ga0311345_107554742 | 3300030688 | Bog | GAPMVGTTGDIEGLSLWAGQSVALVSHPQPAADIVTELVSCL |
| Ga0302311_108752901 | 3300030739 | Palsa | VRYEPAPPMVGTTGDIEALSQWAGQSVALATQPQSAAEIVAELTSRL |
| Ga0265461_123888921 | 3300030743 | Soil | GTTGDIEALSMWAGQGVALARQSQSAADIVAELTSRL |
| Ga0302325_100841441 | 3300031234 | Palsa | APPMAGTTGEIEALSMWAGQGVALARQSQSAADIVKELTSRL |
| Ga0302325_107523651 | 3300031234 | Palsa | PAPPMAGTTGDIEALSMWAGQSVALARQPQSAADIVKELTSRL |
| Ga0302325_124766382 | 3300031234 | Palsa | PMVGTTGDIEAISLWAGQSVALTRQPQTAAEIVAELVSGL |
| Ga0302326_115060753 | 3300031525 | Palsa | TGDIEALSMWAGQSVALARAPQPAADIVAELTSRL |
| Ga0310915_106563822 | 3300031573 | Soil | GALSLWAGQGVALANRTQPAADIIAELTSQPQARP |
| Ga0310686_1031091652 | 3300031708 | Soil | TGDIEALSMWAGQSVALARQSQPAADIVAELTSRL |
| Ga0310686_1049393351 | 3300031708 | Soil | MTGTTGEIEALSMWAGQSVALARKSQSAADIVAELTSRL |
| Ga0310686_1064177582 | 3300031708 | Soil | VGTTGDIEALSMWAGQSVALARKPQSAAEIVTELTSRL |
| Ga0310686_1130822203 | 3300031708 | Soil | GTTGDIEALSMWAGQSVALATQPQPAADIVAELTSRL |
| Ga0310686_1191051801 | 3300031708 | Soil | GTTGDIEALSMWAGQSVALARKSQSAADIVKELTSHL |
| Ga0265342_102366441 | 3300031712 | Rhizosphere | GAPMAGTTGDIEGLSLWAGQSVALARQPQSAAEIVAELVSRL |
| Ga0307474_100285072 | 3300031718 | Hardwood Forest Soil | MTGTTGDIEALSMWAGQSVALARQPQSAADIVAELTSRL |
| Ga0318500_103899921 | 3300031724 | Soil | GTTGDVGALSLWAGQGVALANRTQPAADIIAELTSQPPARP |
| Ga0318494_101587482 | 3300031751 | Soil | DNPDAIMSPIEALSMWAGQGVALARKSQSAADIVTELISLL |
| Ga0307477_105833721 | 3300031753 | Hardwood Forest Soil | MSGTTGDIEALSMWAGQSVALARQPQSAADIVAELTSRL |
| Ga0318509_102004162 | 3300031768 | Soil | GDTGDIGALSLWAGQSVALAQRIQPAADIIAELASCLPGQP |
| Ga0318546_108323682 | 3300031771 | Soil | TTDDIEALSMWAGQGVALAKKSQPAADIVTELTSHL |
| Ga0318566_104490722 | 3300031779 | Soil | MSPIEALSMWAGQGVALARKSQSAADIVTELISLL |
| Ga0318529_100386852 | 3300031792 | Soil | MVGTTGEIEALSMWAGQSVALARKSQSAADIVAELTSRL |
| Ga0318564_101678922 | 3300031831 | Soil | AIMSPIEALSMWAGQGVALARKSQSAADIVTELISLL |
| Ga0318522_100237791 | 3300031894 | Soil | GDIGALSLWAGQSVALAQRIQPAADIIAELASCLPGQP |
| Ga0306921_101076044 | 3300031912 | Soil | GALSLWAGQSVALAQRIQPAADIIAELASCLPGQP |
| Ga0315278_107833191 | 3300031997 | Sediment | LEGTTGDIDALSLWAGQSVALATNTQAAADIVAELVSII |
| Ga0318514_106250092 | 3300032066 | Soil | LALEGTTGDVGALSLWAGQGVALANRTQPAADIIAELTSQPPARP |
| Ga0306924_123120872 | 3300032076 | Soil | DVGALSLWAGQGVALANRTQPAADIIAELTSQPPARP |
| Ga0311301_107739292 | 3300032160 | Peatlands Soil | APLMVGTTGEIEALSMWAGQSVALARQPQSAADIVTELTSRL |
| Ga0311301_107834461 | 3300032160 | Peatlands Soil | PAPPMGGTTGEIEALSMWAGQSVALARESQSAADIVTELTSRL |
| Ga0315283_106135353 | 3300032164 | Sediment | TTGDIGALSLWAGQSVALATRTQAAADIVAELVSRI |
| Ga0315270_107221041 | 3300032275 | Sediment | STMPLEGTTGDIGALSLWAGQSVALATNTQAAADIVAELVSII |
| Ga0335080_116716761 | 3300032828 | Soil | AGTTGEIEALSMWAGQGVALAKRSLSAADIVSELTSRL |
| Ga0335081_125516081 | 3300032892 | Soil | MAGTIGEIEALSIWAGPGIALARQPQSAADIVTELTSNL |
| Ga0335075_103851951 | 3300032896 | Soil | MAGTTGDIEALSMWAGQSVALARQPQPAADIVAELTSRL |
| Ga0335072_109011731 | 3300032898 | Soil | APPMVGTTGDIEALSMWAGQSVALASKSQSAADIVTELTSRL |
| Ga0335076_101507181 | 3300032955 | Soil | MVGTTGEIEALSMWAGQSVALARRTQPAAAIVAELVSRL |
| Ga0335076_109350922 | 3300032955 | Soil | TGTTGEIEALSMWAGQSVALARQPQPAADIVAELTSRL |
| Ga0335073_100029171 | 3300033134 | Soil | GTTGEIEPLSLWAGQSVALAKRSQSAAEIVAELVSQL |
| Ga0318519_110591132 | 3300033290 | Soil | GALSLWAGQSVALAKRTQPAADIIAELTSQLQARR |
| Ga0310811_111184201 | 3300033475 | Soil | TTGDIEALSMWAGQDVALARQVQPAADIVAELTSRL |
| Ga0334840_129992_514_633 | 3300033824 | Soil | MVGTTGEIEALSMWAGQGVALARQSQSAADIVTELTSHL |
| Ga0334827_214032_1_120 | 3300034065 | Soil | MVGTTGEIEALSMWAGQGVALAKESQSAADIVKELTSRL |
| Ga0370515_0270671_468_587 | 3300034163 | Untreated Peat Soil | MVGTTGEIEALSLWAGQSVALAKHSQPAAEIVAELVSRL |
| Ga0370515_0336288_40_159 | 3300034163 | Untreated Peat Soil | MAGTTGEIEALSMWAGQDVALARKSQSAADIVTELTSRL |
| ⦗Top⦘ |