| Basic Information | |
|---|---|
| Family ID | F035910 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 171 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MRLDPNTHAYVMATAFLTSICFAIAAMSVIGLAIHLFVPGAS |
| Number of Associated Samples | 147 |
| Number of Associated Scaffolds | 171 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 12.28 % |
| % of genes near scaffold ends (potentially truncated) | 43.27 % |
| % of genes from short scaffolds (< 2000 bps) | 83.63 % |
| Associated GOLD sequencing projects | 141 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.287 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (16.959 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.240 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.538 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 73.81% β-sheet: 0.00% Coil/Unstructured: 26.19% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 171 Family Scaffolds |
|---|---|---|
| PF07883 | Cupin_2 | 18.71 |
| PF01872 | RibD_C | 8.77 |
| PF10944 | DUF2630 | 4.68 |
| PF00210 | Ferritin | 4.09 |
| PF14333 | DUF4389 | 2.92 |
| PF03358 | FMN_red | 2.92 |
| PF01926 | MMR_HSR1 | 1.75 |
| PF08734 | GYD | 1.75 |
| PF13231 | PMT_2 | 1.75 |
| PF04079 | SMC_ScpB | 1.17 |
| PF00950 | ABC-3 | 1.17 |
| PF02518 | HATPase_c | 1.17 |
| PF10058 | zinc_ribbon_10 | 1.17 |
| PF00903 | Glyoxalase | 1.17 |
| PF11832 | DUF3352 | 0.58 |
| PF01210 | NAD_Gly3P_dh_N | 0.58 |
| PF14714 | KH_dom-like | 0.58 |
| PF01386 | Ribosomal_L25p | 0.58 |
| PF01479 | S4 | 0.58 |
| PF01565 | FAD_binding_4 | 0.58 |
| PF02224 | Cytidylate_kin | 0.58 |
| PF02628 | COX15-CtaA | 0.58 |
| PF00486 | Trans_reg_C | 0.58 |
| PF06983 | 3-dmu-9_3-mt | 0.58 |
| PF10417 | 1-cysPrx_C | 0.58 |
| PF10617 | DUF2474 | 0.58 |
| PF00275 | EPSP_synthase | 0.58 |
| PF04993 | TfoX_N | 0.58 |
| PF01794 | Ferric_reduct | 0.58 |
| PF01434 | Peptidase_M41 | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 171 Family Scaffolds |
|---|---|---|---|
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 8.77 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 8.77 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 1.75 |
| COG0609 | ABC-type Fe3+-siderophore transport system, permease component | Inorganic ion transport and metabolism [P] | 1.17 |
| COG1108 | ABC-type Mn2+/Zn2+ transport system, permease component | Inorganic ion transport and metabolism [P] | 1.17 |
| COG1386 | Chromosome segregation and condensation protein ScpB | Transcription [K] | 1.17 |
| COG4606 | ABC-type enterochelin transport system, permease component | Inorganic ion transport and metabolism [P] | 1.17 |
| COG0283 | Cytidylate kinase | Nucleotide transport and metabolism [F] | 0.58 |
| COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 0.58 |
| COG1612 | Heme A synthase | Coenzyme transport and metabolism [H] | 0.58 |
| COG1825 | Ribosomal protein L25 (general stress protein Ctc) | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.58 |
| COG3070 | Transcriptional regulator of competence genes, TfoX/Sxy family | Transcription [K] | 0.58 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.46 % |
| Unclassified | root | N/A | 17.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908016|OU_2_1_1_newblercontig13894 | Not Available | 709 | Open in IMG/M |
| 2124908045|KansclcFeb2_ConsensusfromContig1192042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2766 | Open in IMG/M |
| 2170459017|G14TP7Y01CNJB9 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 769 | Open in IMG/M |
| 2228664021|ICCgaii200_c0891531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
| 2228664022|INPgaii200_c1047635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1344 | Open in IMG/M |
| 3300000550|F24TB_10259821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 959 | Open in IMG/M |
| 3300000953|JGI11615J12901_10020958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 569 | Open in IMG/M |
| 3300000956|JGI10216J12902_100787913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 579 | Open in IMG/M |
| 3300001305|C688J14111_10087508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 946 | Open in IMG/M |
| 3300001431|F14TB_100475649 | Not Available | 826 | Open in IMG/M |
| 3300001686|C688J18823_10435669 | Not Available | 845 | Open in IMG/M |
| 3300002503|C687J35164_10205446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 563 | Open in IMG/M |
| 3300002568|C688J35102_118415918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
| 3300002568|C688J35102_119959533 | Not Available | 827 | Open in IMG/M |
| 3300002911|JGI25390J43892_10003282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3521 | Open in IMG/M |
| 3300003990|Ga0055455_10072574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 979 | Open in IMG/M |
| 3300004156|Ga0062589_101276258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 708 | Open in IMG/M |
| 3300005167|Ga0066672_10446109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 845 | Open in IMG/M |
| 3300005171|Ga0066677_10432060 | Not Available | 753 | Open in IMG/M |
| 3300005175|Ga0066673_10003723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5877 | Open in IMG/M |
| 3300005176|Ga0066679_10704465 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300005179|Ga0066684_10790314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
| 3300005181|Ga0066678_10230334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1192 | Open in IMG/M |
| 3300005187|Ga0066675_11085225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 598 | Open in IMG/M |
| 3300005187|Ga0066675_11360576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
| 3300005294|Ga0065705_10427703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 850 | Open in IMG/M |
| 3300005330|Ga0070690_100212293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1352 | Open in IMG/M |
| 3300005338|Ga0068868_100089766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2474 | Open in IMG/M |
| 3300005338|Ga0068868_101353115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 663 | Open in IMG/M |
| 3300005347|Ga0070668_100090421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2412 | Open in IMG/M |
| 3300005356|Ga0070674_101346832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 638 | Open in IMG/M |
| 3300005434|Ga0070709_10533898 | Not Available | 895 | Open in IMG/M |
| 3300005434|Ga0070709_11047546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
| 3300005434|Ga0070709_11152971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
| 3300005435|Ga0070714_102468750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
| 3300005436|Ga0070713_101561116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 641 | Open in IMG/M |
| 3300005440|Ga0070705_100997333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 679 | Open in IMG/M |
| 3300005444|Ga0070694_101527553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 565 | Open in IMG/M |
| 3300005451|Ga0066681_10972025 | Not Available | 507 | Open in IMG/M |
| 3300005454|Ga0066687_10178120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1145 | Open in IMG/M |
| 3300005454|Ga0066687_10462751 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300005467|Ga0070706_100825512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 858 | Open in IMG/M |
| 3300005468|Ga0070707_100117098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. YIM 130001 | 2586 | Open in IMG/M |
| 3300005471|Ga0070698_100697117 | Not Available | 957 | Open in IMG/M |
| 3300005529|Ga0070741_10725764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 874 | Open in IMG/M |
| 3300005536|Ga0070697_101087530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 712 | Open in IMG/M |
| 3300005539|Ga0068853_101240136 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Halobacteriales | 720 | Open in IMG/M |
| 3300005540|Ga0066697_10561031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 639 | Open in IMG/M |
| 3300005559|Ga0066700_10294550 | Not Available | 1142 | Open in IMG/M |
| 3300005560|Ga0066670_10203519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1189 | Open in IMG/M |
| 3300005561|Ga0066699_10357103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1044 | Open in IMG/M |
| 3300005566|Ga0066693_10209009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Trueperales → Trueperaceae → unclassified Trueperaceae → Trueperaceae bacterium | 761 | Open in IMG/M |
| 3300005568|Ga0066703_10461419 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300005574|Ga0066694_10211278 | Not Available | 921 | Open in IMG/M |
| 3300005575|Ga0066702_10436469 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300005615|Ga0070702_101896281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
| 3300006049|Ga0075417_10627706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 548 | Open in IMG/M |
| 3300006173|Ga0070716_100818379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 722 | Open in IMG/M |
| 3300006573|Ga0074055_11786425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 766 | Open in IMG/M |
| 3300006796|Ga0066665_10137305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1842 | Open in IMG/M |
| 3300006800|Ga0066660_11379317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
| 3300006804|Ga0079221_10170390 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300006806|Ga0079220_10019314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2840 | Open in IMG/M |
| 3300006903|Ga0075426_10029740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3913 | Open in IMG/M |
| 3300006954|Ga0079219_10630954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 794 | Open in IMG/M |
| 3300007255|Ga0099791_10238541 | Not Available | 861 | Open in IMG/M |
| 3300009012|Ga0066710_101038621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1266 | Open in IMG/M |
| 3300009012|Ga0066710_103704337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
| 3300009090|Ga0099827_11513701 | Not Available | 584 | Open in IMG/M |
| 3300009092|Ga0105250_10239222 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria | 774 | Open in IMG/M |
| 3300009098|Ga0105245_11737350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 676 | Open in IMG/M |
| 3300009147|Ga0114129_11802408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 744 | Open in IMG/M |
| 3300009553|Ga0105249_12273131 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300010045|Ga0126311_11279510 | Not Available | 609 | Open in IMG/M |
| 3300010303|Ga0134082_10321263 | Not Available | 651 | Open in IMG/M |
| 3300010323|Ga0134086_10398318 | Not Available | 553 | Open in IMG/M |
| 3300010337|Ga0134062_10111016 | Not Available | 1186 | Open in IMG/M |
| 3300010364|Ga0134066_10391586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
| 3300010371|Ga0134125_10530145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1303 | Open in IMG/M |
| 3300012198|Ga0137364_10253295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1301 | Open in IMG/M |
| 3300012198|Ga0137364_10559933 | Not Available | 861 | Open in IMG/M |
| 3300012198|Ga0137364_10678144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 777 | Open in IMG/M |
| 3300012198|Ga0137364_10818577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 704 | Open in IMG/M |
| 3300012198|Ga0137364_11092329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 600 | Open in IMG/M |
| 3300012201|Ga0137365_10002497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 14591 | Open in IMG/M |
| 3300012205|Ga0137362_11761558 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300012206|Ga0137380_11326771 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300012208|Ga0137376_10772979 | Not Available | 827 | Open in IMG/M |
| 3300012208|Ga0137376_11076018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 688 | Open in IMG/M |
| 3300012210|Ga0137378_10038052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4295 | Open in IMG/M |
| 3300012212|Ga0150985_110080609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus → unclassified Microcoleus → Microcoleus sp. SIO2G3 | 1008 | Open in IMG/M |
| 3300012285|Ga0137370_10480399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 759 | Open in IMG/M |
| 3300012350|Ga0137372_10051391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3639 | Open in IMG/M |
| 3300012354|Ga0137366_10153971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1729 | Open in IMG/M |
| 3300012356|Ga0137371_10063869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2851 | Open in IMG/M |
| 3300012469|Ga0150984_105840075 | Not Available | 513 | Open in IMG/M |
| 3300012911|Ga0157301_10070464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 957 | Open in IMG/M |
| 3300012955|Ga0164298_10218243 | Not Available | 1128 | Open in IMG/M |
| 3300012989|Ga0164305_10408960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1041 | Open in IMG/M |
| 3300012989|Ga0164305_11039163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 699 | Open in IMG/M |
| 3300013306|Ga0163162_12986914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
| 3300014166|Ga0134079_10098312 | Not Available | 1113 | Open in IMG/M |
| 3300014326|Ga0157380_12776104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 556 | Open in IMG/M |
| 3300014488|Ga0182001_10072425 | Not Available | 995 | Open in IMG/M |
| 3300015077|Ga0173483_10288578 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300015357|Ga0134072_10263044 | Not Available | 627 | Open in IMG/M |
| 3300017792|Ga0163161_10745896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 819 | Open in IMG/M |
| 3300017939|Ga0187775_10001331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5875 | Open in IMG/M |
| 3300017944|Ga0187786_10562798 | Not Available | 529 | Open in IMG/M |
| 3300017965|Ga0190266_10007504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2609 | Open in IMG/M |
| 3300018027|Ga0184605_10004401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4990 | Open in IMG/M |
| 3300018027|Ga0184605_10362355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 654 | Open in IMG/M |
| 3300018028|Ga0184608_10008389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3447 | Open in IMG/M |
| 3300018028|Ga0184608_10331811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 668 | Open in IMG/M |
| 3300018061|Ga0184619_10021685 | All Organisms → cellular organisms → Bacteria | 2643 | Open in IMG/M |
| 3300018061|Ga0184619_10139529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1103 | Open in IMG/M |
| 3300018089|Ga0187774_10564568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 730 | Open in IMG/M |
| 3300018431|Ga0066655_10224867 | Not Available | 1179 | Open in IMG/M |
| 3300018431|Ga0066655_10815906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 635 | Open in IMG/M |
| 3300018433|Ga0066667_10000804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11124 | Open in IMG/M |
| 3300018465|Ga0190269_10291026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 946 | Open in IMG/M |
| 3300018482|Ga0066669_10868379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 805 | Open in IMG/M |
| 3300019362|Ga0173479_10824825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
| 3300019877|Ga0193722_1110789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 646 | Open in IMG/M |
| 3300019885|Ga0193747_1012758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2040 | Open in IMG/M |
| 3300019887|Ga0193729_1029203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2338 | Open in IMG/M |
| 3300019888|Ga0193751_1064391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1521 | Open in IMG/M |
| 3300019888|Ga0193751_1145130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 857 | Open in IMG/M |
| 3300020140|Ga0179590_1188958 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300020170|Ga0179594_10157292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 842 | Open in IMG/M |
| 3300022756|Ga0222622_10272777 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300025159|Ga0209619_10144507 | Not Available | 1379 | Open in IMG/M |
| 3300025552|Ga0210142_1014341 | Not Available | 1458 | Open in IMG/M |
| 3300025898|Ga0207692_10062358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1935 | Open in IMG/M |
| 3300025901|Ga0207688_11035537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 518 | Open in IMG/M |
| 3300025930|Ga0207701_10843087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 770 | Open in IMG/M |
| 3300025934|Ga0207686_10058661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2428 | Open in IMG/M |
| 3300025939|Ga0207665_10036915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3251 | Open in IMG/M |
| 3300025939|Ga0207665_10813867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 738 | Open in IMG/M |
| 3300026306|Ga0209468_1140116 | Not Available | 660 | Open in IMG/M |
| 3300026310|Ga0209239_1075629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1463 | Open in IMG/M |
| 3300026312|Ga0209153_1085241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1169 | Open in IMG/M |
| 3300026542|Ga0209805_1030912 | All Organisms → cellular organisms → Bacteria | 2745 | Open in IMG/M |
| 3300026542|Ga0209805_1191633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 891 | Open in IMG/M |
| 3300026547|Ga0209156_10379219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 598 | Open in IMG/M |
| 3300026973|Ga0207479_101889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 709 | Open in IMG/M |
| 3300028707|Ga0307291_1032383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1226 | Open in IMG/M |
| 3300028710|Ga0307322_10125954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 671 | Open in IMG/M |
| 3300028718|Ga0307307_10022854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1739 | Open in IMG/M |
| 3300028718|Ga0307307_10054182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1179 | Open in IMG/M |
| 3300028720|Ga0307317_10081385 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300028755|Ga0307316_10280946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 607 | Open in IMG/M |
| 3300028782|Ga0307306_10148305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 651 | Open in IMG/M |
| 3300028799|Ga0307284_10008716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2960 | Open in IMG/M |
| 3300028799|Ga0307284_10133562 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300028824|Ga0307310_10691251 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300028875|Ga0307289_10019032 | All Organisms → cellular organisms → Bacteria | 2646 | Open in IMG/M |
| 3300028881|Ga0307277_10002584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6993 | Open in IMG/M |
| 3300028884|Ga0307308_10055149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1872 | Open in IMG/M |
| 3300030511|Ga0268241_10001241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4507 | Open in IMG/M |
| 3300031716|Ga0310813_10067943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2682 | Open in IMG/M |
| 3300031716|Ga0310813_12370793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 503 | Open in IMG/M |
| 3300031820|Ga0307473_10668844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 725 | Open in IMG/M |
| 3300031938|Ga0308175_101441714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 769 | Open in IMG/M |
| 3300031996|Ga0308176_12625565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 536 | Open in IMG/M |
| 3300032179|Ga0310889_10652178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 546 | Open in IMG/M |
| 3300032205|Ga0307472_100705941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 908 | Open in IMG/M |
| 3300032770|Ga0335085_10439718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1503 | Open in IMG/M |
| 3300032770|Ga0335085_10655535 | Not Available | 1173 | Open in IMG/M |
| 3300032828|Ga0335080_10696279 | Not Available | 1059 | Open in IMG/M |
| 3300033550|Ga0247829_10326534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1250 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 16.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 16.37% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.11% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 4.68% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.51% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.34% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.75% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.75% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.17% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.17% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.17% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.17% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.17% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.17% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.58% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.58% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.58% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.58% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.58% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.58% |
| Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 0.58% | |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.58% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.58% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.58% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908016 | Sample 642 | Environmental | Open in IMG/M |
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002503 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
| 3300025552 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026973 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK01-C (SPAdes) | Environmental | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| OU_01956220 | 2124908016 | MRLDPNTHAFVMATAFLTSIFFAVAAMQVIALAIHLFVPGAG | |
| KansclcFeb2_01733330 | 2124908045 | Soil | MRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPG |
| 4ZMR_01099650 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | MRLDPNTHAFVMATAFLTSICFAIAATSVMGLAIHLFVPGAG |
| ICCgaii200_08915312 | 2228664021 | Soil | MRLDPNTHAYVMATAXFTSICFAIAAMSVIGLAIHXFAPGAS |
| INPgaii200_10476353 | 2228664022 | Soil | MRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLLVPGAS |
| F24TB_102598213 | 3300000550 | Soil | MDHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPG* |
| JGI11615J12901_100209581 | 3300000953 | Soil | MDHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIH |
| JGI10216J12902_1007879132 | 3300000956 | Soil | MQLDPNTHAFVMATAFLTSICFSVAAMSVIALAIHLFVPGAG* |
| C688J14111_100875082 | 3300001305 | Soil | VHARRGHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAG* |
| F14TB_1004756493 | 3300001431 | Soil | MRLDPNTHALVMATAFMTSICFAVAAMGVIGLTIHLFVPGAG* |
| C688J18823_104356691 | 3300001686 | Soil | CRHSESSISAAMRLDPNTHAYVMATAFLTSICFAIAAMSVIGLAIHLLVPGAG* |
| C687J35164_102054462 | 3300002503 | Soil | VSLDPNTHAFVLATAFFTSIMFAIAALLPVGLALHFLFFGS* |
| C688J35102_1184159181 | 3300002568 | Soil | MRLDPNTQAFVMATAFLTSICFAIAAMSVIALAIHVFVPGAS* |
| C688J35102_1199595331 | 3300002568 | Soil | MRLDPNTHAYVMATAFLTSICFAIAAMSVIALAIHLFVPGAS* |
| JGI25390J43892_100032823 | 3300002911 | Grasslands Soil | MRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS* |
| Ga0055455_100725742 | 3300003990 | Natural And Restored Wetlands | LSDRARRLDPRLAVKLDPNTYWFVAATAFLTSICFAIAVMALLKVAIHLFVPGAA* |
| Ga0062589_1012762581 | 3300004156 | Soil | MSLDPNTHAYVMATAFLTSIFFAIAAMSVLGLAVHLLVPGAS* |
| Ga0066672_104461091 | 3300005167 | Soil | MRLDPNTHAFVLATAFFTSITFAIAAMSVIALVLHLTLPG* |
| Ga0066677_104320601 | 3300005171 | Soil | DHSESSISAAMRLDPNTHAYVMATAFLTSICFAIAAMSVVGLAIHLFVPGAG* |
| Ga0066673_100037239 | 3300005175 | Soil | MRLDPNTHAYVMATAFLTSICFAIAAMSVVGLAIHLFVPGAG* |
| Ga0066679_107044652 | 3300005176 | Soil | MRLDPNTHAYVMATAFLTSICFAIAAMSVIGLAIHLFVPGAS* |
| Ga0066684_107903142 | 3300005179 | Soil | MRLDPNTHAFVMATAFLTSLCFAIAAMQVIALAIHLFVPGAG* |
| Ga0066678_102303342 | 3300005181 | Soil | MRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAG* |
| Ga0066675_110852252 | 3300005187 | Soil | MRLDPNTHAFVMATAFLTSICFALAAMQVIALAIHLFVPGAG* |
| Ga0066675_113605761 | 3300005187 | Soil | HSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS* |
| Ga0065705_104277033 | 3300005294 | Switchgrass Rhizosphere | MRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHVFAPGAS* |
| Ga0070690_1002122933 | 3300005330 | Switchgrass Rhizosphere | LPSLDHSESSISAAMRLDPNTHAFVMATAFLTSICFAIAATSVIGLAIHLFVPGAS* |
| Ga0068868_1000897664 | 3300005338 | Miscanthus Rhizosphere | MRLDPNTHAYVMATAFFTSLCFAIAAMSVIGLAIHLFVPGAS* |
| Ga0068868_1013531152 | 3300005338 | Miscanthus Rhizosphere | MRLDPNTHAFVMATAFLTSICFAIAATSVIGLAIHLFVPGAS* |
| Ga0070668_1000904213 | 3300005347 | Switchgrass Rhizosphere | MSLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS* |
| Ga0070674_1013468322 | 3300005356 | Miscanthus Rhizosphere | ISAAMRLDPNTHAYVMATAFFTSLCFAIAAMSVIGLAIHLFVPGAS* |
| Ga0070709_105338981 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | SLDPNTHAYVMATAFLTSIFFAIAAMSVLGLAVHLLVPGAS* |
| Ga0070709_110475462 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLDPNTHAYVMATAFLTSIFFAIAAMSVLGLAVHLLVPGAG* |
| Ga0070709_111529711 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LDHSESSISAAMRLDPNTHAFVMATAFLTSICFAIAATSVIGLAIHLFVPGAS* |
| Ga0070714_1024687502 | 3300005435 | Agricultural Soil | HSESSISAAMSLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS* |
| Ga0070713_1015611161 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | SESSISAAMRLDPNTHAFVMATAFLTSICFAIAATSVIGLAIHLFVPGAS* |
| Ga0070705_1009973332 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLDPNTHAYVMATAFLTSIFFAIAAMSVLGLAVHLFVPGAS* |
| Ga0070694_1015275531 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | SESSISAAMRLDPNTHAYVMATAFFTSLCFAIAAMSVIGLAIHLFVPGAS* |
| Ga0066681_109720252 | 3300005451 | Soil | VAFLDHSESSISAAMRLDPNTHALVMATAFMTSICFAVAAMSVIGLTIHLFVPGAG* |
| Ga0066687_101781203 | 3300005454 | Soil | MRLDPNTRAFVMATAFLTSLCFAIAAMQVIALAIHLFVPGAG* |
| Ga0066687_104627513 | 3300005454 | Soil | FLDHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAG* |
| Ga0070706_1008255121 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | SAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS* |
| Ga0070707_1001170983 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LDPNTHAYVMATAFLTSIFFAIAAMSVLGLAVHLLVPGAS* |
| Ga0070698_1006971172 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | GFLDHSESSISAAMSLDPNTHAYVMATAFLTSIFFAIAAMSVLGLAVHLFVPGAS* |
| Ga0070741_107257642 | 3300005529 | Surface Soil | MRLDPNTHAFVMATAFLTSICFSIAAMSVIALAIHLFVPGAG* |
| Ga0070697_1010875301 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MQLEGSRKRFAVLRQGIDRPRFLDHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS* |
| Ga0068853_1012401361 | 3300005539 | Corn Rhizosphere | ESSISAAMRLDPNTHAYVMATAFFTSLCFAIAAMSVIGLAIHLFVPGAS* |
| Ga0066697_105610311 | 3300005540 | Soil | LAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS* |
| Ga0066700_102945503 | 3300005559 | Soil | DHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLLAPGAS* |
| Ga0066670_102035192 | 3300005560 | Soil | MRLDPNTHAYVLATAFFTSITFAIAGMAVIALVLHLTLPS* |
| Ga0066699_103571033 | 3300005561 | Soil | RSPAAMRLDPNTHAYVMATAFLTSICFAIAAMSVIGLAIHLFVPGAS* |
| Ga0066693_102090092 | 3300005566 | Soil | MRLDPNTHAYVMATALLTSICFAIAAMSVIALAIHLFVPGAG* |
| Ga0066703_104614192 | 3300005568 | Soil | MRLDPNTHAYVMATAFLTSICFAIAAMSVIGLAIHLFVPGAG* |
| Ga0066694_102112781 | 3300005574 | Soil | MRLDPNTHALVMATAFMTSICFAVAAMSVIGLTIHLFVPGAG* |
| Ga0066702_104364693 | 3300005575 | Soil | AAMRLDPNTHAYVMATAFLTSICFAIAAMSVIGLAIHLFVPGAS* |
| Ga0070702_1018962811 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLDPNTHAYVMATAFFTSLCFAIAAMSVIGLAIHLFVPGAS* |
| Ga0075417_106277062 | 3300006049 | Populus Rhizosphere | MRLDPNTHAFVMATAFLTSICFAIAATSVIGLAIHLFVPCAS* |
| Ga0070716_1008183793 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GIDRSPFLDHSESSISAAMRLDPNTHAFVMATAFLTSICFAIAATSVIGLAIHLFVPGAS |
| Ga0074055_117864251 | 3300006573 | Soil | MRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLLAPGAS* |
| Ga0066665_101373052 | 3300006796 | Soil | VDHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAG* |
| Ga0066660_113793171 | 3300006800 | Soil | VTHTESRPTAALRLMRLDPNTHAYVMATAFFTSITFAIAAMSVIALVLHLTLPS* |
| Ga0079221_101703902 | 3300006804 | Agricultural Soil | MRLDPNTHAFVMATAFLTSICFAIAAMSVIALAIHVFIPGAG* |
| Ga0079220_100193147 | 3300006806 | Agricultural Soil | AFVMATAFLTSICFAIAAMSVIALAIHVFIPGAG* |
| Ga0075426_100297401 | 3300006903 | Populus Rhizosphere | LDHSESSISAAMRLDPNTHAFVMATAFLTSICFAIAAMSVIALAIHVFIPGAG* |
| Ga0079219_106309541 | 3300006954 | Agricultural Soil | MRLDLNTHAFVMATAFLTWICFAIAAISVIALAIH |
| Ga0099791_102385411 | 3300007255 | Vadose Zone Soil | VAGHSRPTLSPGVDRSDFLDHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLLAPGAS* |
| Ga0066710_1010386214 | 3300009012 | Grasslands Soil | PSVDHSESSISAAMRLDPNTHAYVMATAFLTSICFAIAAMSVIGLAIHLFVPGAS |
| Ga0066710_1037043373 | 3300009012 | Grasslands Soil | MRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGA |
| Ga0099827_115137011 | 3300009090 | Vadose Zone Soil | MRLDPNTHAYVMATAFFTSICFATAAMSVIGLAIHLFVPGAG* |
| Ga0105250_102392223 | 3300009092 | Switchgrass Rhizosphere | AAGIDRLPFLVHSESSISAAMRLDPNTHAYVMATAFFTSLCFAIAAMSVIGLAIHLFVPGAS* |
| Ga0105245_117373501 | 3300009098 | Miscanthus Rhizosphere | MRLDPNTHAFVMATAFLTSICFAIAATSVIGLAIHL |
| Ga0114129_118024081 | 3300009147 | Populus Rhizosphere | DHSESSISAAMRLDPNTHAFVMATAFLTSICFAIAATSVIGLAIHLFVPGAS* |
| Ga0105249_122731311 | 3300009553 | Switchgrass Rhizosphere | THAYVMATAFLTSIFFAIAAMSVLGLAVHLLVPGAS* |
| Ga0126311_112795101 | 3300010045 | Serpentine Soil | MRLDPNTHAYVMATAFLTSICFAIAAMQVIALAIHLFVPGAG* |
| Ga0134082_103212631 | 3300010303 | Grasslands Soil | MRLDPNTHAFLMATALLTSITFVIAAMAVLGLAIHLFVPGAA* |
| Ga0134086_103983181 | 3300010323 | Grasslands Soil | MRLDPNTHAYVMATAFLTSICFAIAAMSVIALAIHLLVPGAG* |
| Ga0134062_101110162 | 3300010337 | Grasslands Soil | MRLDPNTHAYVMATALLTSICFAIAAMSVVGLAIHLFVPGAG* |
| Ga0134066_103915861 | 3300010364 | Grasslands Soil | MRLDPNTHALVMATAFMTSICFAVAAMSVIGLTIHLFVPGAGFLYI |
| Ga0134125_105301453 | 3300010371 | Terrestrial Soil | MSLDPNTHAYVMATAFLTSICFAIAAMSVIALAIHLFVPGAG* |
| Ga0137364_102532951 | 3300012198 | Vadose Zone Soil | AKTDSRELRQGIDRQCFLDHSESSISAAMRLDPNTHAYVMATAFLTSICFAIAAMSVIGLAIHLFVPGAS* |
| Ga0137364_105599331 | 3300012198 | Vadose Zone Soil | LPFVDHSESSISAAMRLDPNTHAYVMATAFLTSICFAIAAMSVVGLAIHLFVPGAG* |
| Ga0137364_106781443 | 3300012198 | Vadose Zone Soil | MRLDPNTHAYVMATAFLTSICFAIAAMSVLGLAIHLFVPGAS* |
| Ga0137364_108185771 | 3300012198 | Vadose Zone Soil | QGIDRLPFLVHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS* |
| Ga0137364_110923292 | 3300012198 | Vadose Zone Soil | LVHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS* |
| Ga0137365_1000249714 | 3300012201 | Vadose Zone Soil | MSLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLLAPGAS* |
| Ga0137362_117615581 | 3300012205 | Vadose Zone Soil | AMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLLAPGAS* |
| Ga0137380_113267711 | 3300012206 | Vadose Zone Soil | AGGSRPRLSPGVDRSGFLDHSESSISAAMSLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLLAPGAS* |
| Ga0137376_107729791 | 3300012208 | Vadose Zone Soil | LDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLLAPGAS* |
| Ga0137376_110760181 | 3300012208 | Vadose Zone Soil | MRLDPNTHAYVLATAFLTSICFAIAAMGVIALAIHLFVPGAS* |
| Ga0137378_100380525 | 3300012210 | Vadose Zone Soil | MRLDPNTHAYVMATAFFTSICFAIAAMSMIGLAIHLFVPGAS* |
| Ga0150985_1100806093 | 3300012212 | Avena Fatua Rhizosphere | RLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAG* |
| Ga0137370_104803991 | 3300012285 | Vadose Zone Soil | MRLDPNTHAYVMATAFLTSIGFTIAAMSVVGLAIHLFVPGAG* |
| Ga0137372_100513911 | 3300012350 | Vadose Zone Soil | DPALAVRLDPNTYAFVAATAFLTSIAFAVAVMGLIAIAIHLFVPGAG* |
| Ga0137366_101539714 | 3300012354 | Vadose Zone Soil | MSLDPNTHAYVMATAFFTSICFAISAMSVIGLAIHLLAPGAS* |
| Ga0137371_100638695 | 3300012356 | Vadose Zone Soil | MRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAT* |
| Ga0150984_1058400752 | 3300012469 | Avena Fatua Rhizosphere | RLDPNTHAYVMATAFLTSICFAIAAMSVIALAIHLFVPGAS* |
| Ga0157301_100704641 | 3300012911 | Soil | MRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHVFVPGAS* |
| Ga0164298_102182433 | 3300012955 | Soil | LDPNTHAYVMATAFLTSIFFAIAAMSVLGLAVHLFVPGAG* |
| Ga0164305_104089603 | 3300012989 | Soil | MSLDPNTHAYVMATAFLTSIFFAIAAMSVLGLAVHL |
| Ga0164305_110391632 | 3300012989 | Soil | MRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIRLLAPGGS* |
| Ga0163162_129869141 | 3300013306 | Switchgrass Rhizosphere | AAMRLDPNTHAYVMATAFFTSLCFAIAAMSVIGLAIHLFVPGAS* |
| Ga0134079_100983121 | 3300014166 | Grasslands Soil | MRLDPNTHALVMATAFMTFICFAVAAMSVIGLTIHLFVPGAG* |
| Ga0157380_127761041 | 3300014326 | Switchgrass Rhizosphere | PNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS* |
| Ga0182001_100724252 | 3300014488 | Soil | MKLDPNTHAYVLATAFMTSIAFAIAAMQVIALLIHLFVPGAA* |
| Ga0173483_102885782 | 3300015077 | Soil | MRLDPNTHAYVMATAFLTSIFFAIAAMSVLGLAVHLLVPGAS* |
| Ga0134072_102630442 | 3300015357 | Grasslands Soil | MRLDPNTRAFVMATAFLTSICFAIAAMSVIALAIHLFVPGAG* |
| Ga0163161_107458962 | 3300017792 | Switchgrass Rhizosphere | AAGIDRLPFLVHSESSISAAMRLDPNTHAYVMATAFFTSLCFAIAAMSVIGLAIHLFVPGAS |
| Ga0187775_100013315 | 3300017939 | Tropical Peatland | MKLDPNTHVFIAATAFLTSVAFAVAIMALIRVAIHLLVPGAG |
| Ga0187786_105627982 | 3300017944 | Tropical Peatland | MKLDPNTHVFVAATAFLTSVAFAVAVMALIRVAIHLLVPGAG |
| Ga0190266_100075043 | 3300017965 | Soil | MRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS |
| Ga0184605_100044014 | 3300018027 | Groundwater Sediment | MRLDPNTHAYVMATAFLTSICFAIAAMSVIALAIHLFVPGAS |
| Ga0184605_103623552 | 3300018027 | Groundwater Sediment | MRLDPNTHAYVLATAFFTSITFAIAGMAVIALVLHLTLPS |
| Ga0184608_100083893 | 3300018028 | Groundwater Sediment | MRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAG |
| Ga0184608_103318111 | 3300018028 | Groundwater Sediment | MRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHRFVPGAS |
| Ga0184619_100216851 | 3300018061 | Groundwater Sediment | MRLDPNTHAYVMATAFFTSITFAIAAMSVIALVLHLTLPS |
| Ga0184619_101395293 | 3300018061 | Groundwater Sediment | MRLDPNTHAYVMATAFMTSVCFAIAAMSVIGLAIHLFVPGAG |
| Ga0187774_105645681 | 3300018089 | Tropical Peatland | MKLDPNTHVFIAATAFLTSIAFAVAIMALIRLAVHLL |
| Ga0066655_102248672 | 3300018431 | Grasslands Soil | MRLDPNTHAYVMATAFLTSICFAIAAMSVVGLAIHLFVPGAG |
| Ga0066655_108159062 | 3300018431 | Grasslands Soil | MRLDPSTRAFVMATAFLTSLCFAIAAMQVIALAIHLFVPGAG |
| Ga0066667_1000080416 | 3300018433 | Grasslands Soil | LAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS |
| Ga0190269_102910261 | 3300018465 | Soil | MRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVP |
| Ga0066669_108683792 | 3300018482 | Grasslands Soil | VAFLDHSESSISAAMRLDPNTHALVMATAFMTSICFAVAAMSVIGLTIHLFVPGAG |
| Ga0173479_108248252 | 3300019362 | Soil | MRLDPNTHAFVMATAFLTSICFAIAATSVVGLAIHLFVPGAS |
| Ga0193722_11107891 | 3300019877 | Soil | FLVHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS |
| Ga0193747_10127583 | 3300019885 | Soil | VRLDPSTYWFVAATAFLTSIAFAVAVMGLIQIAIHLFVPGAG |
| Ga0193729_10292032 | 3300019887 | Soil | MRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHFLASGAS |
| Ga0193751_10643913 | 3300019888 | Soil | ISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLLAPGAS |
| Ga0193751_11451301 | 3300019888 | Soil | MRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLLASGAS |
| Ga0179590_11889582 | 3300020140 | Vadose Zone Soil | AVPTFAPGVDRSDFLDHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLLAPGAS |
| Ga0179594_101572922 | 3300020170 | Vadose Zone Soil | MRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLLAPGAS |
| Ga0222622_102727771 | 3300022756 | Groundwater Sediment | HSESSISAAMRLDPNTHAYVMATAFLTSICFAIAAMSVIGLAIHLFVPGAG |
| Ga0209619_101445073 | 3300025159 | Soil | VSLDPNTHAFVLATAFFTSIMFAIAALLPVGLALHFLFFGS |
| Ga0210142_10143411 | 3300025552 | Natural And Restored Wetlands | VKLDPNTYWFVAATAFLTSICFAIACMALLKVAIHLFVPGAA |
| Ga0207692_100623583 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLDPNTHAYVMATAFLTSIFFAIAAMSVLGLAVHLLVPGAG |
| Ga0207688_110355372 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLDPNTHAYVMATAFFTSLCFAIAAMSVIGLAIHLFVPGAS |
| Ga0207701_108430871 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | AGIDRLSFLVHSESSISAAMRLDPNTHAYVMATAFFTSLCFAIAAMSVIGLAIHLFVPGA |
| Ga0207686_100586614 | 3300025934 | Miscanthus Rhizosphere | SESSISAAMRLDPNTHAYVMATAFFTSLCFAIAAMSVIGLAIHLFVPGAS |
| Ga0207665_100369155 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | AARIDRLSFLVHSASSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS |
| Ga0207665_108138671 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | IDRLPSLDHSESSISAAMRLDPNTHAFVMATAFLTSICFAIAATSVIGLAIHLFVPGAS |
| Ga0209468_11401161 | 3300026306 | Soil | MRLDPNTHALVMATAFMTSICFAVAAMSVIGLTIHLFVPGAG |
| Ga0209239_10756294 | 3300026310 | Grasslands Soil | AFLVHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIALAIHLFVPGAS |
| Ga0209153_10852411 | 3300026312 | Soil | MRLDPNTHAYVMATAFLTSICFAIAAMSVIGLAIHLFVPGAS |
| Ga0209805_10309124 | 3300026542 | Soil | VRLDPSTYAFVAATAFLTSIAFAVAVMGLIQIAIHLFVPGAA |
| Ga0209805_11916333 | 3300026542 | Soil | MRLDPNTHAFVLATAFFTSITFAIAAMSVIALVLHLTLPS |
| Ga0209156_103792192 | 3300026547 | Soil | MRLDPNTHAFVMATAFLTSICFALAAMQVIALAIHLFVPGAG |
| Ga0207479_1018892 | 3300026973 | Soil | MRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHVFVPGAS |
| Ga0307291_10323832 | 3300028707 | Soil | MRLDPNTHAYVMATAFLTSICFAIAAMSVIGLAIHLFVPGAG |
| Ga0307322_101259541 | 3300028710 | Soil | MRLDPNTHAYVMATAFLTSICFAIAAMSVIGLAIHLF |
| Ga0307307_100228543 | 3300028718 | Soil | MRLDPNTHAYVLATAFLTSICFAIAAMSVIALAIHLFVPGAS |
| Ga0307307_100541823 | 3300028718 | Soil | DPNTHAYVMATAFFTSICFAIAGMSVIGLAIHLFVPGAS |
| Ga0307317_100813853 | 3300028720 | Soil | PGPLHSESSISAAMRLDPNTHAYVMATAFLTSICFAIAAMSVIGLAIHLFVPGAG |
| Ga0307316_102809461 | 3300028755 | Soil | RKKRFAAGIDRLSFLVHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS |
| Ga0307306_101483052 | 3300028782 | Soil | SISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS |
| Ga0307284_100087164 | 3300028799 | Soil | MRLDPNTHAYVMATAFFTSICFAIAGMSVIGLAIHLFVPGAS |
| Ga0307284_101335621 | 3300028799 | Soil | HAYVLATAFLTSICFAIAAMSVIALAIHLFVPGAS |
| Ga0307310_106912511 | 3300028824 | Soil | AAMRLDPNTHAYVMATAFLTSICFAIAAMSVIGLAIHLFVPGAG |
| Ga0307289_100190321 | 3300028875 | Soil | NTHAYVMATAFLTSICFAIAAMSVIGLAIHLFVPGAG |
| Ga0307277_100025847 | 3300028881 | Soil | MRLDPNTQAFVMATAFLTSICFAIAAMSVIALGIYLFVPGAS |
| Ga0307308_100551493 | 3300028884 | Soil | MARRPFSAHAVYRASAALRLMRLDPNTHAYVLATAFFTSITFAIAGMAVIALVLHLTLPS |
| Ga0268241_100012412 | 3300030511 | Soil | MGEDSHTLRVHSEYSISAAMRLDPNTHALVMATAFVTSICFAVAAMSVIGLTIHLFVPGA |
| Ga0310813_100679437 | 3300031716 | Soil | FLVHSQSSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHVFVPGAS |
| Ga0310813_123707931 | 3300031716 | Soil | MDHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGL |
| Ga0307473_106688443 | 3300031820 | Hardwood Forest Soil | RLPSLDHSESSISAAMRLDPNTHAFVMATAFLTSICFAIAATSVIGLAIHLFVPGAS |
| Ga0308175_1014417143 | 3300031938 | Soil | MRLDPNTHAYVMATALLTSICFAIAAMSVIALAIH |
| Ga0308176_126255652 | 3300031996 | Soil | MRLDPNTHAYVMATAFLTSICFAIAAMSVIALAIHLFVPGAG |
| Ga0310889_106521781 | 3300032179 | Soil | LPSLDHSESSISAAMRLDPNTHAFVMATAFLTSICFAIAATSVIGLAIHLFVPGAS |
| Ga0307472_1007059412 | 3300032205 | Hardwood Forest Soil | MSLDPNTHAYVMATAFLTSIFFAIAAMSVLGLAVHLFVPGAS |
| Ga0335085_104397182 | 3300032770 | Soil | MKLDPNTHVFIAATAFLTSIAFAVAIMALIRLAVHLLVPGAG |
| Ga0335085_106555353 | 3300032770 | Soil | MKLDPNTHVFIAATAFLTSIAFAVAIMALIRVAVHLLVPGAG |
| Ga0335080_106962793 | 3300032828 | Soil | MKLDPNTHAFIAATAFLTSIAFAVAVMALIRMAIHLLVPGAG |
| Ga0247829_103265343 | 3300033550 | Soil | RLDPNTHAYVMATAFFTSLCFAIAAMSVIGLAIHLFVPGAS |
| ⦗Top⦘ |