Basic Information | |
---|---|
Family ID | F035892 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 171 |
Average Sequence Length | 46 residues |
Representative Sequence | LQPLFAAGHADTSSPAFAAAARALGVSTQQLLTALMHAKQSLAQGS |
Number of Associated Samples | 150 |
Number of Associated Scaffolds | 171 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 90.64 % |
% of genes from short scaffolds (< 2000 bps) | 81.29 % |
Associated GOLD sequencing projects | 141 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (90.058 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.070 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.409 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.520 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.84% β-sheet: 0.00% Coil/Unstructured: 62.16% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 171 Family Scaffolds |
---|---|---|
PF00486 | Trans_reg_C | 46.20 |
PF00072 | Response_reg | 43.27 |
PF00672 | HAMP | 4.68 |
PF02518 | HATPase_c | 2.92 |
PF14226 | DIOX_N | 0.58 |
PF08281 | Sigma70_r4_2 | 0.58 |
PF00656 | Peptidase_C14 | 0.58 |
PF00512 | HisKA | 0.58 |
COG ID | Name | Functional Category | % Frequency in 171 Family Scaffolds |
---|---|---|---|
COG4249 | Uncharacterized conserved protein, contains caspase domain | General function prediction only [R] | 0.58 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 90.64 % |
Unclassified | root | N/A | 9.36 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2209111022|2221207167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora acidiphila | 1864 | Open in IMG/M |
3300001593|JGI12635J15846_10252924 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
3300001867|JGI12627J18819_10009638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3771 | Open in IMG/M |
3300001867|JGI12627J18819_10362660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 587 | Open in IMG/M |
3300005176|Ga0066679_10294674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1053 | Open in IMG/M |
3300005330|Ga0070690_100767153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 746 | Open in IMG/M |
3300005338|Ga0068868_102139349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 532 | Open in IMG/M |
3300005435|Ga0070714_100413075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1277 | Open in IMG/M |
3300005436|Ga0070713_100181887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1889 | Open in IMG/M |
3300005437|Ga0070710_10176870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1333 | Open in IMG/M |
3300005438|Ga0070701_10340497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 934 | Open in IMG/M |
3300005441|Ga0070700_101496482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 574 | Open in IMG/M |
3300005450|Ga0066682_10482626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 786 | Open in IMG/M |
3300005456|Ga0070678_101273164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 684 | Open in IMG/M |
3300005467|Ga0070706_100951827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 792 | Open in IMG/M |
3300005533|Ga0070734_10074140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2020 | Open in IMG/M |
3300005535|Ga0070684_101988612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 549 | Open in IMG/M |
3300005544|Ga0070686_100329142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1141 | Open in IMG/M |
3300005576|Ga0066708_10784467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 599 | Open in IMG/M |
3300005602|Ga0070762_10814193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 633 | Open in IMG/M |
3300005615|Ga0070702_101186018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 614 | Open in IMG/M |
3300005764|Ga0066903_105984854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 637 | Open in IMG/M |
3300005840|Ga0068870_10175064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1284 | Open in IMG/M |
3300005843|Ga0068860_102365365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 551 | Open in IMG/M |
3300006028|Ga0070717_11187275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 694 | Open in IMG/M |
3300006173|Ga0070716_101650844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 527 | Open in IMG/M |
3300006176|Ga0070765_102058984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 533 | Open in IMG/M |
3300006237|Ga0097621_100108142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2347 | Open in IMG/M |
3300006797|Ga0066659_11055887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 679 | Open in IMG/M |
3300006806|Ga0079220_10666545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 756 | Open in IMG/M |
3300006854|Ga0075425_100398980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1584 | Open in IMG/M |
3300006854|Ga0075425_101090039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 910 | Open in IMG/M |
3300006854|Ga0075425_102935036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 523 | Open in IMG/M |
3300007076|Ga0075435_100234217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1560 | Open in IMG/M |
3300007982|Ga0102924_1233845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 770 | Open in IMG/M |
3300009098|Ga0105245_10968016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 894 | Open in IMG/M |
3300009101|Ga0105247_10326068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1073 | Open in IMG/M |
3300010043|Ga0126380_10058181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. | 2127 | Open in IMG/M |
3300010325|Ga0134064_10094040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 979 | Open in IMG/M |
3300010326|Ga0134065_10326794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 595 | Open in IMG/M |
3300010358|Ga0126370_12478516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 516 | Open in IMG/M |
3300010360|Ga0126372_11745041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 665 | Open in IMG/M |
3300010360|Ga0126372_12198704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 601 | Open in IMG/M |
3300010366|Ga0126379_10345424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1516 | Open in IMG/M |
3300010366|Ga0126379_13317813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 539 | Open in IMG/M |
3300010366|Ga0126379_13883915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 500 | Open in IMG/M |
3300010371|Ga0134125_10153902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2562 | Open in IMG/M |
3300010396|Ga0134126_10045172 | All Organisms → cellular organisms → Bacteria | 5532 | Open in IMG/M |
3300010396|Ga0134126_10960686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 958 | Open in IMG/M |
3300011270|Ga0137391_10831996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 759 | Open in IMG/M |
3300012202|Ga0137363_11787822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 507 | Open in IMG/M |
3300012209|Ga0137379_10626192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 982 | Open in IMG/M |
3300012209|Ga0137379_10862222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 810 | Open in IMG/M |
3300012351|Ga0137386_10675583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 742 | Open in IMG/M |
3300012515|Ga0157338_1053597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 586 | Open in IMG/M |
3300012924|Ga0137413_11632114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 528 | Open in IMG/M |
3300012971|Ga0126369_11316339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 812 | Open in IMG/M |
3300012977|Ga0134087_10782909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 515 | Open in IMG/M |
3300013105|Ga0157369_11233720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 763 | Open in IMG/M |
3300013306|Ga0163162_10187086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2198 | Open in IMG/M |
3300013307|Ga0157372_12941468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 545 | Open in IMG/M |
3300014325|Ga0163163_12769095 | Not Available | 547 | Open in IMG/M |
3300015264|Ga0137403_11126877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 630 | Open in IMG/M |
3300015372|Ga0132256_100303734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1681 | Open in IMG/M |
3300015374|Ga0132255_105783274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 523 | Open in IMG/M |
3300016371|Ga0182034_11964507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 517 | Open in IMG/M |
3300016404|Ga0182037_11363623 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 626 | Open in IMG/M |
3300016404|Ga0182037_11726305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 558 | Open in IMG/M |
3300016422|Ga0182039_11677874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 581 | Open in IMG/M |
3300017924|Ga0187820_1194171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 631 | Open in IMG/M |
3300017926|Ga0187807_1222042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 615 | Open in IMG/M |
3300017937|Ga0187809_10008566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3518 | Open in IMG/M |
3300020583|Ga0210401_11171875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 627 | Open in IMG/M |
3300021170|Ga0210400_10772579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 788 | Open in IMG/M |
3300021171|Ga0210405_10661789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 809 | Open in IMG/M |
3300021401|Ga0210393_10496993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 996 | Open in IMG/M |
3300021404|Ga0210389_10821560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 725 | Open in IMG/M |
3300021474|Ga0210390_10227057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1580 | Open in IMG/M |
3300021475|Ga0210392_11005264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 624 | Open in IMG/M |
3300021560|Ga0126371_12283227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 653 | Open in IMG/M |
3300021560|Ga0126371_13316142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 544 | Open in IMG/M |
3300022527|Ga0242664_1162026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 500 | Open in IMG/M |
3300024232|Ga0247664_1125600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 599 | Open in IMG/M |
3300024288|Ga0179589_10613344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 510 | Open in IMG/M |
3300025321|Ga0207656_10256725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 857 | Open in IMG/M |
3300025898|Ga0207692_10405267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 851 | Open in IMG/M |
3300025901|Ga0207688_10051716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2301 | Open in IMG/M |
3300025910|Ga0207684_11320536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 593 | Open in IMG/M |
3300025926|Ga0207659_11183851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 657 | Open in IMG/M |
3300025928|Ga0207700_11635695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 569 | Open in IMG/M |
3300025929|Ga0207664_11685627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 556 | Open in IMG/M |
3300025986|Ga0207658_10256715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1488 | Open in IMG/M |
3300026023|Ga0207677_10981074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 765 | Open in IMG/M |
3300026329|Ga0209375_1302701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 522 | Open in IMG/M |
3300026490|Ga0257153_1016284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1511 | Open in IMG/M |
3300026557|Ga0179587_10372684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 928 | Open in IMG/M |
3300027725|Ga0209178_1098049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 977 | Open in IMG/M |
3300027874|Ga0209465_10069131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1710 | Open in IMG/M |
3300027895|Ga0209624_10807525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 616 | Open in IMG/M |
3300028784|Ga0307282_10052326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1826 | Open in IMG/M |
3300028811|Ga0307292_10233181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 762 | Open in IMG/M |
3300028824|Ga0307310_10354715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 721 | Open in IMG/M |
3300031226|Ga0307497_10512117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 594 | Open in IMG/M |
3300031469|Ga0170819_13583838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 503 | Open in IMG/M |
3300031543|Ga0318516_10006449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5420 | Open in IMG/M |
3300031564|Ga0318573_10122587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1348 | Open in IMG/M |
3300031572|Ga0318515_10592770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 589 | Open in IMG/M |
3300031679|Ga0318561_10500372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 669 | Open in IMG/M |
3300031680|Ga0318574_10615832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 636 | Open in IMG/M |
3300031681|Ga0318572_10004199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 6241 | Open in IMG/M |
3300031682|Ga0318560_10101671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1487 | Open in IMG/M |
3300031713|Ga0318496_10065324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1909 | Open in IMG/M |
3300031744|Ga0306918_10662042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 817 | Open in IMG/M |
3300031744|Ga0306918_10861655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 706 | Open in IMG/M |
3300031744|Ga0306918_11115285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 611 | Open in IMG/M |
3300031747|Ga0318502_10346572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 878 | Open in IMG/M |
3300031748|Ga0318492_10015533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3210 | Open in IMG/M |
3300031751|Ga0318494_10133282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1391 | Open in IMG/M |
3300031764|Ga0318535_10088210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1347 | Open in IMG/M |
3300031768|Ga0318509_10269160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 952 | Open in IMG/M |
3300031777|Ga0318543_10171826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 957 | Open in IMG/M |
3300031779|Ga0318566_10050481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1975 | Open in IMG/M |
3300031781|Ga0318547_10100164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1653 | Open in IMG/M |
3300031792|Ga0318529_10563143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 529 | Open in IMG/M |
3300031798|Ga0318523_10277387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 837 | Open in IMG/M |
3300031799|Ga0318565_10279910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 811 | Open in IMG/M |
3300031805|Ga0318497_10518897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 668 | Open in IMG/M |
3300031821|Ga0318567_10064768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1919 | Open in IMG/M |
3300031821|Ga0318567_10111690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1487 | Open in IMG/M |
3300031845|Ga0318511_10500635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 562 | Open in IMG/M |
3300031859|Ga0318527_10508507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 514 | Open in IMG/M |
3300031860|Ga0318495_10009545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3970 | Open in IMG/M |
3300031890|Ga0306925_10186206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2237 | Open in IMG/M |
3300031910|Ga0306923_10098072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3305 | Open in IMG/M |
3300031910|Ga0306923_12390883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 524 | Open in IMG/M |
3300031912|Ga0306921_10039558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5316 | Open in IMG/M |
3300031941|Ga0310912_10973931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 651 | Open in IMG/M |
3300031945|Ga0310913_10208895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1365 | Open in IMG/M |
3300031946|Ga0310910_10210282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1511 | Open in IMG/M |
3300031954|Ga0306926_11422991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 803 | Open in IMG/M |
3300031981|Ga0318531_10455409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 579 | Open in IMG/M |
3300032001|Ga0306922_11707109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 623 | Open in IMG/M |
3300032009|Ga0318563_10410938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 732 | Open in IMG/M |
3300032010|Ga0318569_10243480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 835 | Open in IMG/M |
3300032035|Ga0310911_10378135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 819 | Open in IMG/M |
3300032041|Ga0318549_10398363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 620 | Open in IMG/M |
3300032076|Ga0306924_10023246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6618 | Open in IMG/M |
3300032076|Ga0306924_10957125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 943 | Open in IMG/M |
3300032091|Ga0318577_10249722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 849 | Open in IMG/M |
3300032174|Ga0307470_11913256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 505 | Open in IMG/M |
3300032205|Ga0307472_102622427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 514 | Open in IMG/M |
3300032261|Ga0306920_102551510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 702 | Open in IMG/M |
3300032261|Ga0306920_102715313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 676 | Open in IMG/M |
3300032828|Ga0335080_11953867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 569 | Open in IMG/M |
3300032898|Ga0335072_11314304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 632 | Open in IMG/M |
3300033004|Ga0335084_11940532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 574 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.07% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.53% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.19% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.02% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.26% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.51% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.34% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.34% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.92% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.92% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.75% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.75% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.75% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.17% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.17% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.17% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.17% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.17% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.17% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.17% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.17% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.58% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.58% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.58% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.58% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.58% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.58% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.58% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.58% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.58% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.58% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.58% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.58% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.58% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.58% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.58% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.58% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.58% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.58% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2209111022 | Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichment | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
2222041352 | 2209111022 | Grass Soil | HADTSSPAFAAAARALGVSTQQLSAALAHGKQSLAGGN |
JGI12635J15846_102529241 | 3300001593 | Forest Soil | AGHADTSSPAFAAAARALGVSTGQLDAALMHAKQSLAQGS* |
JGI12627J18819_100096385 | 3300001867 | Forest Soil | LQPLFAAGHADTSSPAFAAAARSLGVSTQQLSTALVHAKQSLAQGG* |
JGI12627J18819_103626601 | 3300001867 | Forest Soil | HADTSSPSFAAAARALGVSTNQLDTALMHAKQSLAQSS* |
Ga0066679_102946741 | 3300005176 | Soil | TARVSAALQPLFAAGHADPSSPAFAAAARSLGVSSQQLSTALMHAKQSLAQGS* |
Ga0070690_1007671532 | 3300005330 | Switchgrass Rhizosphere | HVSTARVSAALQPLFAAGHADTSSPSFAAAARALGVSTNQLDTALMHAKQSLAQSS* |
Ga0068868_1021393491 | 3300005338 | Miscanthus Rhizosphere | VGAALQPLFAAGHADTSSPAFAAAARALGVSTNQLDTALMHAKQSLAQSS* |
Ga0070714_1004130751 | 3300005435 | Agricultural Soil | RVNAALRPLFAAGGADTSSPVFAAAARSLGVSVQQLSAALMHGKESLAGGT* |
Ga0070713_1001818871 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | PLFAAGHADTSSPAFAAAARALGVSAEQLNTALMHAKQSLAQGS* |
Ga0070710_101768703 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VARELHVSTARVSAALQPLFAAGHADPSSPAFAAAARSLGVSTQQLSTALMHAKQSLAQGS* |
Ga0070701_103404972 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | AALQPLFAAGHADTSSPSFAAAARALGVSTSQLDTALMHAKQSLAQSS* |
Ga0070700_1014964822 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VSTARVSAALQPLFAAGHADTSSPSFAAAARALGVSTNQLDTALMHAKQSLAQSS* |
Ga0066682_104826262 | 3300005450 | Soil | STARVSAALQPLFAAGHADPSSPAFAAAARSLGVSSQQLSTALMHAKQSLAQGS* |
Ga0070678_1012731641 | 3300005456 | Miscanthus Rhizosphere | AGHADTSSPAFAAAARALGVSTNQLDTALMHAKQSLAQSS* |
Ga0070706_1009518271 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | HVSTARVSAALQPLFAAGHADTSSPAFAAAARALGVSTNQLDTALMHAKQSLAQSS* |
Ga0070734_100741401 | 3300005533 | Surface Soil | AGAALRPLFAAGRADTSSPMFAAAARSLGVSAQQLNTALMHAKQSLAAGQ* |
Ga0070684_1019886121 | 3300005535 | Corn Rhizosphere | LFAAGGAEPDSPLLQAAARDLGVSAQQLNTALVHAKQSLASASQP* |
Ga0070686_1003291423 | 3300005544 | Switchgrass Rhizosphere | GHADTSSPSFAAAARALGVSTSQLDTALMHAKQSLAQSS* |
Ga0066708_107844672 | 3300005576 | Soil | RVSAALQPLFAAGRADTPALAAAARALGVSTGQLDTALMHAKQSLAQSS* |
Ga0070762_108141932 | 3300005602 | Soil | FAAGGAGTSSPAFSAAARSLGVSTQQLSAALAHGKQSLAGGN* |
Ga0070702_1011860182 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | LQPLFAAGHADTSSPSFAAAARALGVSTSQLDTALMHAKQSLAQSS* |
Ga0066903_1059848541 | 3300005764 | Tropical Forest Soil | QPLFAAGRADSSSPVVAAAARSLGVSTHQLYAALGHAKQSLAPGS* |
Ga0068870_101750643 | 3300005840 | Miscanthus Rhizosphere | TSSPAFAAAARALGVSTNQLDTALMHAKQSLAQSS* |
Ga0068860_1023653652 | 3300005843 | Switchgrass Rhizosphere | LHVSTARVSAALQPLFAAGHADTSSPAFAAAARALGVSTNQLDTALMHAKQSLAQSS* |
Ga0070717_111872751 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | SSPAFAAAARSLGVSTQQLSTALMHAKQSLAQGS* |
Ga0070716_1016508441 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | STARVSAALQPLFAAGHADTSSPAFAAAARALGVSTNQLDTALMHAKQSLAQSS* |
Ga0070712_1000282555 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | AEPDSPLLTAAARDLGVSAQQLNTALVHAKQSLASTS* |
Ga0070765_1020589842 | 3300006176 | Soil | ALQPLFAAGHADTSSPAFAATARALGVSANQLDTALMHAKERLAQSS* |
Ga0097621_1001081421 | 3300006237 | Miscanthus Rhizosphere | LHVSTARVSAALQPLFAAGHADTSSPSFAAAARALGVSTNQLDTALMHAKQSLAQSS* |
Ga0066659_110558871 | 3300006797 | Soil | TTRVSAALRPLFAAGRADTSSPVLSAAARSLGVSIQQLFAALAHAKQSLAGGN* |
Ga0079220_106665452 | 3300006806 | Agricultural Soil | RVAAALQPLFAAGHADTSSPAFAAAARALGVSTDQLNAALMHAKQTLGQGS* |
Ga0075425_1003989801 | 3300006854 | Populus Rhizosphere | VAQALHVSTARVEAALQPLFAAGRADSSSPLVAAAARSLDVSTPQLFAALRHAKVSLAPGS* |
Ga0075425_1010900391 | 3300006854 | Populus Rhizosphere | ALAPLFAAGRVEPDSPLMRAAARDLGVSAQQLNTALVHAKQSLASAGQP* |
Ga0075425_1029350361 | 3300006854 | Populus Rhizosphere | ARVSAALQPLFAAGHADTSSPAFAAAARALGVSTGQLDTALMHAKQSLAQGS* |
Ga0075426_103576553 | 3300006903 | Populus Rhizosphere | SSPLVAAAARSLDVSTPQLFAALRHAKVSLAPGS* |
Ga0075436_1003049683 | 3300006914 | Populus Rhizosphere | FAAGRADSSSPLVAAAARSLDVSTPQLFAALRHAKVSLAPGS* |
Ga0075435_1002342173 | 3300007076 | Populus Rhizosphere | LHVSTARVEAALQPLFAAGRADSSSPLVAAAARSLDVSTPQLFAALRHAKVSLAPGS* |
Ga0102924_12338452 | 3300007982 | Iron-Sulfur Acid Spring | SMARVSAALRPLFAAGRADPSSPIVSAAARSLGVSIQQLSAALAHAKQSLAGGN* |
Ga0105245_109680161 | 3300009098 | Miscanthus Rhizosphere | SAALEPLFAAGHADTSSPAFAAAARALGVGAEQLNTALMHAKQSLAQGS* |
Ga0105247_103260681 | 3300009101 | Switchgrass Rhizosphere | AVAAELHVSTARVSAALQPLFATGHADTSSPSFAAAARALGVSTNQLDTALMHAKQSLAQSS* |
Ga0126380_100581813 | 3300010043 | Tropical Forest Soil | AALQPLFAAGRADTSSPVIAAAARSLGVSTQQLFAALRHAKQSLAAGS* |
Ga0126373_129625901 | 3300010048 | Tropical Forest Soil | ASSPVLATAAHSLGVSTQQLFAALRHAKQSLAPGS* |
Ga0134064_100940403 | 3300010325 | Grasslands Soil | AELHVSTARVSAALQPLFAAGHADPSSPAFAAAARSLGVSSQQLSTALMHAKQSLAQGS* |
Ga0134065_103267942 | 3300010326 | Grasslands Soil | ADTSSPAFAAAARSLGVSTQQLSAALGDAKQSLAAAN* |
Ga0126370_124785162 | 3300010358 | Tropical Forest Soil | ADTSSTAFAAAARSLGVSTQQLNTALRHAKQSLAPGN* |
Ga0126372_102108853 | 3300010360 | Tropical Forest Soil | SSPAFATAARSLGISAQQLSAALMHAKQSMSGGH* |
Ga0126372_117450412 | 3300010360 | Tropical Forest Soil | LAPLFAAGHADMSSIAAAARALGVSAQQLNTALVHAKQSLASTSQP* |
Ga0126372_121987042 | 3300010360 | Tropical Forest Soil | RPLFAAGHADTSSPVFAAAARSLGVGTQQLSAALVHAKLSLAPGS* |
Ga0126379_103454243 | 3300010366 | Tropical Forest Soil | ALQPLFAAGQADASSPVLATAAHSLGVSTQQLFAALRHAKQSLAPGS* |
Ga0126379_133178131 | 3300010366 | Tropical Forest Soil | STPAFAAAARSLGVSVHQLSAALVHAKESLAAGQ* |
Ga0126379_138839152 | 3300010366 | Tropical Forest Soil | ALRPLFAAGRADSSSPVVAAAARSLGVSTDQLLAALRHAKQSLAPGS* |
Ga0134125_101539021 | 3300010371 | Terrestrial Soil | GRGDTSSPVFSAAARSLGVSTQQLSAALAHAKQSLAGGN* |
Ga0134126_100451727 | 3300010396 | Terrestrial Soil | RPLFAAGRGDTSSPVFSAAARSLGVSTQQLSAALAHAKQSLAGGN* |
Ga0134126_109606863 | 3300010396 | Terrestrial Soil | AALEPLFAAGHADTSSPAFAAAARALGVSAEQLNTALVHAKQSLAQGS* |
Ga0137391_108319962 | 3300011270 | Vadose Zone Soil | AGELHVSTARVSAALQPLFAAGYADPSSPAFAAIARSLGVSTQQLSAALIHAKQSLAQGS |
Ga0137363_117878222 | 3300012202 | Vadose Zone Soil | VSAALQPLFAAGHADTSSPAFAAAARSLGVSTQQLDTALMHAKQSLAQGS* |
Ga0137379_106261921 | 3300012209 | Vadose Zone Soil | QPLFAAGRADTSSPAFAAAARSLGVSTQQLSTALMHAKQSLGGGK* |
Ga0137379_108622222 | 3300012209 | Vadose Zone Soil | SAALQPLFAAGHADTSSPAFAAAARALGVSTQQLLTALMHAKQSLAQGS* |
Ga0137386_106755832 | 3300012351 | Vadose Zone Soil | LQPLFAAGHADTSSPAFAAAARALGVSTQQLLTALMHAKQSLAQGS* |
Ga0157338_10535971 | 3300012515 | Arabidopsis Rhizosphere | ARVSAALQPLFAAGHADTSSPAFVAAARALGVSTGQLDTALAHAKQSLAQGS* |
Ga0137413_116321142 | 3300012924 | Vadose Zone Soil | ADTSSPAFAAAARSLGVSTQQLDTALMHAKQSLAQGS* |
Ga0126369_113163392 | 3300012971 | Tropical Forest Soil | GAALRPLFAAGRADSSSPIVAAAAHSLGVSTHQLLAALRHAKQSLAGGS* |
Ga0134087_107829092 | 3300012977 | Grasslands Soil | GHADTASPTFAAAARALGVSAVQLSAALMHAKQSLAQGS* |
Ga0157369_112337202 | 3300013105 | Corn Rhizosphere | FAAGHADTSSPAFAAAARALGVSTNQLDTALMHAKQSLAQSS* |
Ga0163162_101870861 | 3300013306 | Switchgrass Rhizosphere | HLGVARVSAALAPLFAAGGAEPDSPLLQAAARDLGVSAQQLNTALVHAKQSLASASQP* |
Ga0157372_129414682 | 3300013307 | Corn Rhizosphere | PLFAAGHADTSSPAFAAAARALGVSTGQLNAALVHAKQSLAHSS* |
Ga0163163_127690952 | 3300014325 | Switchgrass Rhizosphere | VAQELHVSTARVSAALRPLFAAGRGDTSSPVFSAAARSLGVSTQQLSAALAHAKQSLAGGN* |
Ga0137403_111268772 | 3300015264 | Vadose Zone Soil | APLFAAGRAAPDSALLTAAAHQLGVSTQQLNTALVHAKQSLAGS* |
Ga0132256_1003037341 | 3300015372 | Arabidopsis Rhizosphere | SAALQPLFAAGHADTSSPAFAAAARALGVSTQQLDTALMHAKQSLAQSS* |
Ga0132255_1042562212 | 3300015374 | Arabidopsis Rhizosphere | RAETGSPQFRAAARALGVSAQQLNTALVRAKQSLASAR* |
Ga0132255_1057832741 | 3300015374 | Arabidopsis Rhizosphere | AELHLSTARVSAALQPLFAAGHADTSSPAFAAAARALGVSTGQLDTALMHAKQSLAQGS* |
Ga0182034_119645072 | 3300016371 | Soil | PLFAAGHADPSSPAFAAAARALGVSTQQLSTALMHAKQSLAQGS |
Ga0182037_113636231 | 3300016404 | Soil | RVSAALRPLFAAGRADTSSPILAAAARSLGVSAQQLNTALVHAKQSLAAGT |
Ga0182037_117263052 | 3300016404 | Soil | LHVSTARVDAALQPLFAAGRAYPSSPVVAAAARSLGVSTHQLLAALMHAKQSLAPGS |
Ga0182039_116778741 | 3300016422 | Soil | RVSAALQPLFAAGHADPSSPAFAAAARALGVSTQQLSTALMHAKQSLAQGS |
Ga0187820_11941711 | 3300017924 | Freshwater Sediment | AAGQADPSSPVFAAAARSLGVSTQQLSAALANAKQSLAPGN |
Ga0187807_12220422 | 3300017926 | Freshwater Sediment | PLFTAADPADTSSLIGAAAQSLGVSTQQLAAALAQAKQSLRPAS |
Ga0187809_100085661 | 3300017937 | Freshwater Sediment | ALQPLFAAGQADPSSPVFAAAARSLGVSTQQLSAALVNAKQSLAPGN |
Ga0187809_101641562 | 3300017937 | Freshwater Sediment | AAGRADPSSPAFATAAISLGVSTQQLTAALVEAKQSLAGGS |
Ga0210401_111718751 | 3300020583 | Soil | ALQPLFAAGSADPSSPAFATAASSLGVSTQQLTAALTEAKQSLASGS |
Ga0210400_107725791 | 3300021170 | Soil | LFAAGHADTSSPAFAAAARALGVSTGQLNAALMHAKQSLAQSS |
Ga0210405_106617892 | 3300021171 | Soil | AAGHADPSSPAFAAAARSLGVSTQQLSTALMHAKQSLAQGS |
Ga0210396_104172751 | 3300021180 | Soil | AGSADPSSPAFATAASSLGVSTQQLTAALTEAKQSLASGS |
Ga0210393_104969931 | 3300021401 | Soil | FAAGQADTSSPVFAAAARSLGVSIQQLSTALAHAKQSLAGGN |
Ga0210389_108215601 | 3300021404 | Soil | HADTSSPAFAAAARALGVSTGQLNAALMHAKQSLAQGS |
Ga0210389_114612602 | 3300021404 | Soil | EGMIDSSSREFAAAAGSLSVTPQQLFAALAQAKQSLSGGK |
Ga0210387_110945971 | 3300021405 | Soil | IDSSSREFAAAAGSLSVTPQQLFAALAQAKQSLSGGK |
Ga0210390_102270571 | 3300021474 | Soil | ARVSAALQPLFAAGQADTSSPVFAAAARSLGVSIQQLSTALAHAKQSLAGGN |
Ga0210392_110052642 | 3300021475 | Soil | ELHVSTARVSAALQPLFAAGHADTSSPAFAAAARALGVSTNQLDTALMHAKQSLAQSS |
Ga0126371_122832271 | 3300021560 | Tropical Forest Soil | ARVNAALQPLFAAGQADASSPVLATAAHSLGVSTQQLFAALRHAKQSLAPGS |
Ga0126371_133161421 | 3300021560 | Tropical Forest Soil | DTSSPAFAAAARSLGVSTQQLFTALAHAKQSLAQGG |
Ga0242664_11620262 | 3300022527 | Soil | ALQPLFAAGHGDTSSPAFAAAARSLGVSTQQLLIALMHAKQSLAQGS |
Ga0247664_11256001 | 3300024232 | Soil | LHVSTARVSAALQPLFAAGHADTSSPSFAAAARALGVSTNQLNTALMHAKQSLAQSS |
Ga0179589_106133441 | 3300024288 | Vadose Zone Soil | AGHAETSSPACAAAARALGVSAEQLNTALVHAKQSLAQGS |
Ga0247681_10486171 | 3300024310 | Soil | AEPDSPLLQAAARDLGVSAQQLNTALVHAKQSLASASQP |
Ga0207656_102567252 | 3300025321 | Corn Rhizosphere | GHADTSSPAFAAAARALGVSTNQLDTALMHAKQSLAQSS |
Ga0207692_104052672 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LEPLFAAGHADTSSPAFAAAARALGVSAEQLNTALMHAKQSLAQGS |
Ga0207692_110084751 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | TDSPQFSAAARALGVSTQQLNTALAHAKQSLASAR |
Ga0207688_100517164 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | AVAAELHVSTARVSAALQPLFATGHADTSSPSFAAAARALGVSTNQLDTALMHAKQSLAQSS |
Ga0207699_112759291 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | HAETSSPAFAAAARALGVSAEQLNTALVHAKQSLAQGS |
Ga0207684_113205362 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | NAAVRPLFAEGTADSSSPVFAAAARSLGVSTQQLSAALAHAKQSLAGGK |
Ga0207659_111838511 | 3300025926 | Miscanthus Rhizosphere | LHVSTARVSAALQPLFATGHADTSSPSFAAAARALGVSTNQLDTALMHAKQSLAQSS |
Ga0207700_116356952 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | PLFAAGHADTSSPAFAAAARALGVSAEQLNTALMHAKQSLAQGS |
Ga0207664_116856272 | 3300025929 | Agricultural Soil | PLFAAGHAETSSPAFAAAARALGVSAEQLNTALVHAKQSLAQGS |
Ga0207658_102567153 | 3300025986 | Switchgrass Rhizosphere | AGHADTSSPAFAAAARALGVSTNQLDTALMHAKQSLAQSS |
Ga0207677_109810741 | 3300026023 | Miscanthus Rhizosphere | AALQPLFAAGHADTSSPSFAAAARALGVSTSQLDTALMHAKQSLAQSS |
Ga0209375_13027012 | 3300026329 | Soil | LQPLFAAGHADPSSPAFAAAARSLGVSSQQLSTALMHAKQSLAQGS |
Ga0257153_10162841 | 3300026490 | Soil | GHADTSSPAFAAAARSLGVSTQQLDTALMHAKQSLAQGS |
Ga0179587_103726841 | 3300026557 | Vadose Zone Soil | SAALQPLFAAGHADTSSPAFAAAARSLGVSTQQLDTALMHAKQSLAQGS |
Ga0209626_10248802 | 3300027684 | Forest Soil | MVDPSSREFAAAARSLGVSPQQLSAALAQAKQSLATGK |
Ga0209178_10980493 | 3300027725 | Agricultural Soil | AALQPLFAAGHADTSSPAFAAAARALGVSTDQLNAALMHAKQTLAQGS |
Ga0209465_100691311 | 3300027874 | Tropical Forest Soil | RALHVSTARVSAALRPLFAAGHADTSSPVFAAAARSLGVGTQQLSAALVHAKLSLAPGS |
Ga0209624_108075251 | 3300027895 | Forest Soil | GRADSSSPTFAAAARSLGVSPQQLSAALGAAKQSLAGGS |
Ga0307282_100523263 | 3300028784 | Soil | GHADTSSPAFAAAARALGVSTGQLDTALAHAKQSLAQSS |
Ga0307292_102331811 | 3300028811 | Soil | HADTSSPAFAAAARALGVSTGQLDTALAHAKQSLAQSS |
Ga0307310_103547151 | 3300028824 | Soil | LFAAGHADTSSPAFAAAARALGVSTQQLDTALAHAKQSLAQSS |
Ga0307497_105121171 | 3300031226 | Soil | AALQSLFAAGHADTSSPAFAAAARALGVSTGQLQTSLAHAKQSLAQGS |
Ga0170819_135838382 | 3300031469 | Forest Soil | VAAVAGELHVSTTRVSAALEPLFAAGHADTSSPAFAAAARSLGVSTQQLFTALMHAKQSLAQGS |
Ga0318516_100064496 | 3300031543 | Soil | AVARELHVSTARVNAALRPLFAAGRADTSSPVFAAAAHSLGVRTQQLLAALVHAKQSLAPGS |
Ga0318573_101225871 | 3300031564 | Soil | VSAALRPLFAAGHADTSSPVFAAAARSLGVGSQQLSAALMHAKLSLAPGS |
Ga0318515_105927701 | 3300031572 | Soil | AGHADTSSPAFAAVARSLGVSTQQLSTALMHAKQSLAQGS |
Ga0318561_105003721 | 3300031679 | Soil | GHADPSSPAFAAAARSLGLSSQQLSSALVGAKQALAAGSS |
Ga0318574_106158321 | 3300031680 | Soil | RELHVSTARVNAALRPLFAAGRADTSSPVFAAAAHSLGVRTQQLLAALVHAKQSLAPGS |
Ga0318572_100041998 | 3300031681 | Soil | VSAALQPLFAAGHADPSSPAFAAAARALGVSTQQLSTALMHAKQSLAQGS |
Ga0318560_101016713 | 3300031682 | Soil | DTSSAVFAAAARSLGVSTEQLSAALAHAKQSLAPGG |
Ga0318496_100653241 | 3300031713 | Soil | PLFAAGRAGSSSPVVAAAARSLGVSTHQLLAALRHAKQSLAPGS |
Ga0306918_106620421 | 3300031744 | Soil | ALPLLFAAGRADTSSPVFAAAAHSLGVRTQQLLAALVHAKQSLAPGS |
Ga0306918_108616552 | 3300031744 | Soil | ALGPLFAAGHADTSSPAFAAAARSLGVSTQQLSASLMHAKMSLAPGS |
Ga0306918_111152851 | 3300031744 | Soil | QADSSSPVIAAAARSLGVSTHQLNAALVHAKLSLAPGS |
Ga0318502_103465721 | 3300031747 | Soil | VGAALQPLFAAGHADTSSPAFAAVARSLGVSTQQLSTALMHAKQSLAQGS |
Ga0318492_100155334 | 3300031748 | Soil | AGRADSSSPAFAAAARSLGVSVQQLSVALEHAKQSLAGGT |
Ga0318494_101332823 | 3300031751 | Soil | GRANTSSPILAAAARSLGVSAQQLNTALVHAKLSLAAGT |
Ga0318535_100882101 | 3300031764 | Soil | ADSSSPAFAAAARSLGVSVQQLSVALEHAKQSLAGGT |
Ga0318509_102691601 | 3300031768 | Soil | AVARELHVSTARVNAALRPLFAAGRADTSSPVFAAAAHSLGVSTHQLYAALVHAKQSLAPGS |
Ga0318543_101718261 | 3300031777 | Soil | AGRADTSSPAFAAAARSLGVSTQQLSAALAHAKQSLAPGS |
Ga0318566_100504813 | 3300031779 | Soil | DPSSPAFAAAARALGVSTQQLSTALMHAKQSLAQGS |
Ga0318547_101001643 | 3300031781 | Soil | GHADTSSAVFAAAARSLGVSTEQLSAALAHAKQSLAPGG |
Ga0318529_105631432 | 3300031792 | Soil | STARVDAALRPLFAAGRADSSSPVVAAAARSLGVSTQQLIAALGHAKQSLAPGS |
Ga0318523_102773871 | 3300031798 | Soil | LHVSAARVGAALQPLFAAGHADTSSPAFAAVARSLGVSTQQLSTALMHAKQSLAQGS |
Ga0318565_102799102 | 3300031799 | Soil | GHADTSSAAFAAAARSLSVSTHQLNAALIHAKESLAAGA |
Ga0318497_105188971 | 3300031805 | Soil | PLFAAGRADTSSPVFAAAAHSLGVRTQQLLAALVHAKQSLAPGS |
Ga0318567_100647683 | 3300031821 | Soil | ADTSSAVFAAAARSLGVSTEQLSAALAHAKQSLAPGG |
Ga0318567_101116903 | 3300031821 | Soil | HVSTARVDAALRPLFAAGRADSSSPVVAAAARSLGVSTQQLIAALGHAKQSLAPGS |
Ga0318511_105006352 | 3300031845 | Soil | LFAAGHADPSSPAFAAAARALGVSTQQLSTALMHAKQSLAQGS |
Ga0318527_105085072 | 3300031859 | Soil | HVSTARVNAALRPLFAAGRADTSSPVFAAAAHSLGVSTHQLNAALVHAKLSLAPGS |
Ga0318495_100095455 | 3300031860 | Soil | ARVSAALQPLFAAGHADPSSPAFAAAARALGVSTQQLSTALMHAKQSLAQGS |
Ga0306919_108359072 | 3300031879 | Soil | GQADTSSPAFAAAARSLGVSTQQLSTALAQAKQSLAQGS |
Ga0306925_101862063 | 3300031890 | Soil | RELHVSTARVNAALRPLFAAGRADTSSPVFAAAAHSLGVSTQQLLAALVHAKQSLAPGS |
Ga0306923_100980721 | 3300031910 | Soil | TARVSAALRPLFAAGHADTSSPVFAAAARSLGVGSQQLSAALMHAKLSLAPGS |
Ga0306923_123908831 | 3300031910 | Soil | FAAGQADASSPVFVAAARSLGLSTQQLSAALAHGKQSLAPGS |
Ga0306921_100395581 | 3300031912 | Soil | TARVSAALRPLFAAGRADSSSPAFAAAARSLGVSVQQLSVALEHAKQSLAGGT |
Ga0310912_109739311 | 3300031941 | Soil | ADPSSPAFAAAARSLGLSSQQLSSALVGAKQALAAGSS |
Ga0310913_102088951 | 3300031945 | Soil | LHVSTARVDAALRPLFAAGRADSSSPVVAAAARSLGVSTQQLIAALGHAKQSLAPGS |
Ga0310910_102102823 | 3300031946 | Soil | QPLFAAGRADSSSPVVAAAARSLGVSTHQLLAALRHAKQSLAPGS |
Ga0306926_114229911 | 3300031954 | Soil | GELHVSAARVGAALQPLFAAGHADTSSPAFAAVARSLGVSTQQLSTALMHAKQSLAQGS |
Ga0318531_104554092 | 3300031981 | Soil | PLFAAGRAYPSSPVVAAAARSLGVSTHQLLAALMHAKQSLAPGS |
Ga0306922_117071091 | 3300032001 | Soil | DSSSPAFAAAARSLGVSVQQLSVALAHAKQSLAGGA |
Ga0318563_104109381 | 3300032009 | Soil | ADSSSPAFAAAARSLGVSVQQLSVALAHAKQSLAGGA |
Ga0318569_102434802 | 3300032010 | Soil | DSSSPVVAAAARSLGVSTQQLIAALGHAKQSLAPGS |
Ga0310911_103781352 | 3300032035 | Soil | AALRPLFAAGRADTSSPVFAAAAHSLGVSTQQLLAALVHAKQSLAPGS |
Ga0318549_103983631 | 3300032041 | Soil | TTAVARELHVTTAQASAALRPLFAAGHADPSSPALVAAARSLGVSTHQLNTALMHAKQSLAPGS |
Ga0306924_1002324610 | 3300032076 | Soil | RVGAALQPLFAAGHADTSSPAFAAVARSLGVSTQQLSTALMHAKQSLAQGS |
Ga0306924_109571253 | 3300032076 | Soil | PSSPAFAAAARSLGLSSQQLSSALVGAKQALAAGSS |
Ga0318577_102497221 | 3300032091 | Soil | ARREQRPGRADTSSPVFAAAAHSLGVSTQQLLAALVHAKQSLAPGS |
Ga0307470_119132561 | 3300032174 | Hardwood Forest Soil | VASELHLGVARVSAALAPLFAAGGAEPDSPLLQAAARDLGVSAQQLNTALVHAKQSLASASQP |
Ga0307472_1026224271 | 3300032205 | Hardwood Forest Soil | LFAAGRADSSSPVVAAAARSLGVSTQQLNAALVHAKLSLAPGS |
Ga0306920_1025515101 | 3300032261 | Soil | TARVSAALRPLFAAGQADTSSPVFAAAARSLGVSTQQLSAALMHAKLSLAPGS |
Ga0306920_1027153131 | 3300032261 | Soil | AALRPLFAAGRADTSSPILAAAARSLGVSAQQLNTALVHAKLSLAAGT |
Ga0335080_119538672 | 3300032828 | Soil | LFAAGHAEVPSPAFAAAARSLGVSTQQLNTALAHAKQSLAQAADTSGECR |
Ga0335072_113143042 | 3300032898 | Soil | AGQADTSSPVFASAAQSLGVSTQQLSAALAQGKQSVAGGN |
Ga0335084_119405322 | 3300033004 | Soil | TSSPAFAAAARALGVSTGQLQTALAHAKQSLAQSS |
⦗Top⦘ |