NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F035892

Metagenome / Metatranscriptome Family F035892

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F035892
Family Type Metagenome / Metatranscriptome
Number of Sequences 171
Average Sequence Length 46 residues
Representative Sequence LQPLFAAGHADTSSPAFAAAARALGVSTQQLLTALMHAKQSLAQGS
Number of Associated Samples 150
Number of Associated Scaffolds 171

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 90.64 %
% of genes from short scaffolds (< 2000 bps) 81.29 %
Associated GOLD sequencing projects 141
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.058 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(28.070 % of family members)
Environment Ontology (ENVO) Unclassified
(30.409 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(41.520 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 37.84%    β-sheet: 0.00%    Coil/Unstructured: 62.16%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 171 Family Scaffolds
PF00486Trans_reg_C 46.20
PF00072Response_reg 43.27
PF00672HAMP 4.68
PF02518HATPase_c 2.92
PF14226DIOX_N 0.58
PF08281Sigma70_r4_2 0.58
PF00656Peptidase_C14 0.58
PF00512HisKA 0.58

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 171 Family Scaffolds
COG4249Uncharacterized conserved protein, contains caspase domainGeneral function prediction only [R] 0.58


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.64 %
UnclassifiedrootN/A9.36 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2209111022|2221207167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora acidiphila1864Open in IMG/M
3300001593|JGI12635J15846_10252924All Organisms → cellular organisms → Bacteria1129Open in IMG/M
3300001867|JGI12627J18819_10009638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3771Open in IMG/M
3300001867|JGI12627J18819_10362660All Organisms → cellular organisms → Bacteria → Terrabacteria group587Open in IMG/M
3300005176|Ga0066679_10294674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1053Open in IMG/M
3300005330|Ga0070690_100767153All Organisms → cellular organisms → Bacteria → Terrabacteria group746Open in IMG/M
3300005338|Ga0068868_102139349All Organisms → cellular organisms → Bacteria → Terrabacteria group532Open in IMG/M
3300005435|Ga0070714_100413075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1277Open in IMG/M
3300005436|Ga0070713_100181887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1889Open in IMG/M
3300005437|Ga0070710_10176870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1333Open in IMG/M
3300005438|Ga0070701_10340497All Organisms → cellular organisms → Bacteria → Terrabacteria group934Open in IMG/M
3300005441|Ga0070700_101496482All Organisms → cellular organisms → Bacteria → Terrabacteria group574Open in IMG/M
3300005450|Ga0066682_10482626All Organisms → cellular organisms → Bacteria → Terrabacteria group786Open in IMG/M
3300005456|Ga0070678_101273164All Organisms → cellular organisms → Bacteria → Terrabacteria group684Open in IMG/M
3300005467|Ga0070706_100951827All Organisms → cellular organisms → Bacteria → Terrabacteria group792Open in IMG/M
3300005533|Ga0070734_10074140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2020Open in IMG/M
3300005535|Ga0070684_101988612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia549Open in IMG/M
3300005544|Ga0070686_100329142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1141Open in IMG/M
3300005576|Ga0066708_10784467All Organisms → cellular organisms → Bacteria → Terrabacteria group599Open in IMG/M
3300005602|Ga0070762_10814193All Organisms → cellular organisms → Bacteria → Terrabacteria group633Open in IMG/M
3300005615|Ga0070702_101186018All Organisms → cellular organisms → Bacteria → Terrabacteria group614Open in IMG/M
3300005764|Ga0066903_105984854All Organisms → cellular organisms → Bacteria → Terrabacteria group637Open in IMG/M
3300005840|Ga0068870_10175064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1284Open in IMG/M
3300005843|Ga0068860_102365365All Organisms → cellular organisms → Bacteria → Terrabacteria group551Open in IMG/M
3300006028|Ga0070717_11187275All Organisms → cellular organisms → Bacteria → Terrabacteria group694Open in IMG/M
3300006173|Ga0070716_101650844All Organisms → cellular organisms → Bacteria → Terrabacteria group527Open in IMG/M
3300006176|Ga0070765_102058984All Organisms → cellular organisms → Bacteria → Terrabacteria group533Open in IMG/M
3300006237|Ga0097621_100108142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2347Open in IMG/M
3300006797|Ga0066659_11055887All Organisms → cellular organisms → Bacteria → Terrabacteria group679Open in IMG/M
3300006806|Ga0079220_10666545All Organisms → cellular organisms → Bacteria → Terrabacteria group756Open in IMG/M
3300006854|Ga0075425_100398980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1584Open in IMG/M
3300006854|Ga0075425_101090039All Organisms → cellular organisms → Bacteria → Terrabacteria group910Open in IMG/M
3300006854|Ga0075425_102935036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales523Open in IMG/M
3300007076|Ga0075435_100234217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1560Open in IMG/M
3300007982|Ga0102924_1233845All Organisms → cellular organisms → Bacteria → Terrabacteria group770Open in IMG/M
3300009098|Ga0105245_10968016All Organisms → cellular organisms → Bacteria → Terrabacteria group894Open in IMG/M
3300009101|Ga0105247_10326068All Organisms → cellular organisms → Bacteria → Terrabacteria group1073Open in IMG/M
3300010043|Ga0126380_10058181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp.2127Open in IMG/M
3300010325|Ga0134064_10094040All Organisms → cellular organisms → Bacteria → Terrabacteria group979Open in IMG/M
3300010326|Ga0134065_10326794All Organisms → cellular organisms → Bacteria → Terrabacteria group595Open in IMG/M
3300010358|Ga0126370_12478516All Organisms → cellular organisms → Bacteria → Terrabacteria group516Open in IMG/M
3300010360|Ga0126372_11745041All Organisms → cellular organisms → Bacteria → Terrabacteria group665Open in IMG/M
3300010360|Ga0126372_12198704All Organisms → cellular organisms → Bacteria → Terrabacteria group601Open in IMG/M
3300010366|Ga0126379_10345424All Organisms → cellular organisms → Bacteria → Terrabacteria group1516Open in IMG/M
3300010366|Ga0126379_13317813All Organisms → cellular organisms → Bacteria → Terrabacteria group539Open in IMG/M
3300010366|Ga0126379_13883915All Organisms → cellular organisms → Bacteria → Terrabacteria group500Open in IMG/M
3300010371|Ga0134125_10153902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2562Open in IMG/M
3300010396|Ga0134126_10045172All Organisms → cellular organisms → Bacteria5532Open in IMG/M
3300010396|Ga0134126_10960686All Organisms → cellular organisms → Bacteria → Terrabacteria group958Open in IMG/M
3300011270|Ga0137391_10831996All Organisms → cellular organisms → Bacteria → Terrabacteria group759Open in IMG/M
3300012202|Ga0137363_11787822All Organisms → cellular organisms → Bacteria → Terrabacteria group507Open in IMG/M
3300012209|Ga0137379_10626192All Organisms → cellular organisms → Bacteria → Terrabacteria group982Open in IMG/M
3300012209|Ga0137379_10862222All Organisms → cellular organisms → Bacteria → Terrabacteria group810Open in IMG/M
3300012351|Ga0137386_10675583All Organisms → cellular organisms → Bacteria → Terrabacteria group742Open in IMG/M
3300012515|Ga0157338_1053597All Organisms → cellular organisms → Bacteria → Terrabacteria group586Open in IMG/M
3300012924|Ga0137413_11632114All Organisms → cellular organisms → Bacteria → Terrabacteria group528Open in IMG/M
3300012971|Ga0126369_11316339All Organisms → cellular organisms → Bacteria → Terrabacteria group812Open in IMG/M
3300012977|Ga0134087_10782909All Organisms → cellular organisms → Bacteria → Terrabacteria group515Open in IMG/M
3300013105|Ga0157369_11233720All Organisms → cellular organisms → Bacteria → Terrabacteria group763Open in IMG/M
3300013306|Ga0163162_10187086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2198Open in IMG/M
3300013307|Ga0157372_12941468All Organisms → cellular organisms → Bacteria → Terrabacteria group545Open in IMG/M
3300014325|Ga0163163_12769095Not Available547Open in IMG/M
3300015264|Ga0137403_11126877All Organisms → cellular organisms → Bacteria → Terrabacteria group630Open in IMG/M
3300015372|Ga0132256_100303734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1681Open in IMG/M
3300015374|Ga0132255_105783274All Organisms → cellular organisms → Bacteria → Terrabacteria group523Open in IMG/M
3300016371|Ga0182034_11964507All Organisms → cellular organisms → Bacteria → Terrabacteria group517Open in IMG/M
3300016404|Ga0182037_11363623All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum626Open in IMG/M
3300016404|Ga0182037_11726305All Organisms → cellular organisms → Bacteria → Terrabacteria group558Open in IMG/M
3300016422|Ga0182039_11677874All Organisms → cellular organisms → Bacteria → Terrabacteria group581Open in IMG/M
3300017924|Ga0187820_1194171All Organisms → cellular organisms → Bacteria → Terrabacteria group631Open in IMG/M
3300017926|Ga0187807_1222042All Organisms → cellular organisms → Bacteria → Terrabacteria group615Open in IMG/M
3300017937|Ga0187809_10008566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3518Open in IMG/M
3300020583|Ga0210401_11171875All Organisms → cellular organisms → Bacteria → Terrabacteria group627Open in IMG/M
3300021170|Ga0210400_10772579All Organisms → cellular organisms → Bacteria → Terrabacteria group788Open in IMG/M
3300021171|Ga0210405_10661789All Organisms → cellular organisms → Bacteria → Terrabacteria group809Open in IMG/M
3300021401|Ga0210393_10496993All Organisms → cellular organisms → Bacteria → Terrabacteria group996Open in IMG/M
3300021404|Ga0210389_10821560All Organisms → cellular organisms → Bacteria → Terrabacteria group725Open in IMG/M
3300021474|Ga0210390_10227057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1580Open in IMG/M
3300021475|Ga0210392_11005264All Organisms → cellular organisms → Bacteria → Terrabacteria group624Open in IMG/M
3300021560|Ga0126371_12283227All Organisms → cellular organisms → Bacteria → Terrabacteria group653Open in IMG/M
3300021560|Ga0126371_13316142All Organisms → cellular organisms → Bacteria → Terrabacteria group544Open in IMG/M
3300022527|Ga0242664_1162026All Organisms → cellular organisms → Bacteria → Terrabacteria group500Open in IMG/M
3300024232|Ga0247664_1125600All Organisms → cellular organisms → Bacteria → Terrabacteria group599Open in IMG/M
3300024288|Ga0179589_10613344All Organisms → cellular organisms → Bacteria → Terrabacteria group510Open in IMG/M
3300025321|Ga0207656_10256725All Organisms → cellular organisms → Bacteria → Terrabacteria group857Open in IMG/M
3300025898|Ga0207692_10405267All Organisms → cellular organisms → Bacteria → Terrabacteria group851Open in IMG/M
3300025901|Ga0207688_10051716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2301Open in IMG/M
3300025910|Ga0207684_11320536All Organisms → cellular organisms → Bacteria → Terrabacteria group593Open in IMG/M
3300025926|Ga0207659_11183851All Organisms → cellular organisms → Bacteria → Terrabacteria group657Open in IMG/M
3300025928|Ga0207700_11635695All Organisms → cellular organisms → Bacteria → Terrabacteria group569Open in IMG/M
3300025929|Ga0207664_11685627All Organisms → cellular organisms → Bacteria → Terrabacteria group556Open in IMG/M
3300025986|Ga0207658_10256715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1488Open in IMG/M
3300026023|Ga0207677_10981074All Organisms → cellular organisms → Bacteria → Terrabacteria group765Open in IMG/M
3300026329|Ga0209375_1302701All Organisms → cellular organisms → Bacteria → Terrabacteria group522Open in IMG/M
3300026490|Ga0257153_1016284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1511Open in IMG/M
3300026557|Ga0179587_10372684All Organisms → cellular organisms → Bacteria → Terrabacteria group928Open in IMG/M
3300027725|Ga0209178_1098049All Organisms → cellular organisms → Bacteria → Terrabacteria group977Open in IMG/M
3300027874|Ga0209465_10069131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1710Open in IMG/M
3300027895|Ga0209624_10807525All Organisms → cellular organisms → Bacteria → Terrabacteria group616Open in IMG/M
3300028784|Ga0307282_10052326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1826Open in IMG/M
3300028811|Ga0307292_10233181All Organisms → cellular organisms → Bacteria → Terrabacteria group762Open in IMG/M
3300028824|Ga0307310_10354715All Organisms → cellular organisms → Bacteria → Terrabacteria group721Open in IMG/M
3300031226|Ga0307497_10512117All Organisms → cellular organisms → Bacteria → Terrabacteria group594Open in IMG/M
3300031469|Ga0170819_13583838All Organisms → cellular organisms → Bacteria → Terrabacteria group503Open in IMG/M
3300031543|Ga0318516_10006449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5420Open in IMG/M
3300031564|Ga0318573_10122587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1348Open in IMG/M
3300031572|Ga0318515_10592770All Organisms → cellular organisms → Bacteria → Terrabacteria group589Open in IMG/M
3300031679|Ga0318561_10500372All Organisms → cellular organisms → Bacteria → Terrabacteria group669Open in IMG/M
3300031680|Ga0318574_10615832All Organisms → cellular organisms → Bacteria → Terrabacteria group636Open in IMG/M
3300031681|Ga0318572_10004199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae6241Open in IMG/M
3300031682|Ga0318560_10101671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1487Open in IMG/M
3300031713|Ga0318496_10065324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1909Open in IMG/M
3300031744|Ga0306918_10662042All Organisms → cellular organisms → Bacteria → Terrabacteria group817Open in IMG/M
3300031744|Ga0306918_10861655All Organisms → cellular organisms → Bacteria → Terrabacteria group706Open in IMG/M
3300031744|Ga0306918_11115285All Organisms → cellular organisms → Bacteria → Terrabacteria group611Open in IMG/M
3300031747|Ga0318502_10346572All Organisms → cellular organisms → Bacteria → Terrabacteria group878Open in IMG/M
3300031748|Ga0318492_10015533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3210Open in IMG/M
3300031751|Ga0318494_10133282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1391Open in IMG/M
3300031764|Ga0318535_10088210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1347Open in IMG/M
3300031768|Ga0318509_10269160All Organisms → cellular organisms → Bacteria → Terrabacteria group952Open in IMG/M
3300031777|Ga0318543_10171826All Organisms → cellular organisms → Bacteria → Terrabacteria group957Open in IMG/M
3300031779|Ga0318566_10050481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1975Open in IMG/M
3300031781|Ga0318547_10100164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1653Open in IMG/M
3300031792|Ga0318529_10563143All Organisms → cellular organisms → Bacteria → Terrabacteria group529Open in IMG/M
3300031798|Ga0318523_10277387All Organisms → cellular organisms → Bacteria → Terrabacteria group837Open in IMG/M
3300031799|Ga0318565_10279910All Organisms → cellular organisms → Bacteria → Terrabacteria group811Open in IMG/M
3300031805|Ga0318497_10518897All Organisms → cellular organisms → Bacteria → Terrabacteria group668Open in IMG/M
3300031821|Ga0318567_10064768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1919Open in IMG/M
3300031821|Ga0318567_10111690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1487Open in IMG/M
3300031845|Ga0318511_10500635All Organisms → cellular organisms → Bacteria → Terrabacteria group562Open in IMG/M
3300031859|Ga0318527_10508507All Organisms → cellular organisms → Bacteria → Terrabacteria group514Open in IMG/M
3300031860|Ga0318495_10009545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3970Open in IMG/M
3300031890|Ga0306925_10186206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2237Open in IMG/M
3300031910|Ga0306923_10098072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3305Open in IMG/M
3300031910|Ga0306923_12390883All Organisms → cellular organisms → Bacteria → Terrabacteria group524Open in IMG/M
3300031912|Ga0306921_10039558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5316Open in IMG/M
3300031941|Ga0310912_10973931All Organisms → cellular organisms → Bacteria → Terrabacteria group651Open in IMG/M
3300031945|Ga0310913_10208895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1365Open in IMG/M
3300031946|Ga0310910_10210282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1511Open in IMG/M
3300031954|Ga0306926_11422991All Organisms → cellular organisms → Bacteria → Terrabacteria group803Open in IMG/M
3300031981|Ga0318531_10455409All Organisms → cellular organisms → Bacteria → Terrabacteria group579Open in IMG/M
3300032001|Ga0306922_11707109All Organisms → cellular organisms → Bacteria → Terrabacteria group623Open in IMG/M
3300032009|Ga0318563_10410938All Organisms → cellular organisms → Bacteria → Terrabacteria group732Open in IMG/M
3300032010|Ga0318569_10243480All Organisms → cellular organisms → Bacteria → Terrabacteria group835Open in IMG/M
3300032035|Ga0310911_10378135All Organisms → cellular organisms → Bacteria → Terrabacteria group819Open in IMG/M
3300032041|Ga0318549_10398363All Organisms → cellular organisms → Bacteria → Terrabacteria group620Open in IMG/M
3300032076|Ga0306924_10023246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6618Open in IMG/M
3300032076|Ga0306924_10957125All Organisms → cellular organisms → Bacteria → Terrabacteria group943Open in IMG/M
3300032091|Ga0318577_10249722All Organisms → cellular organisms → Bacteria → Terrabacteria group849Open in IMG/M
3300032174|Ga0307470_11913256All Organisms → cellular organisms → Bacteria → Terrabacteria group505Open in IMG/M
3300032205|Ga0307472_102622427All Organisms → cellular organisms → Bacteria → Terrabacteria group514Open in IMG/M
3300032261|Ga0306920_102551510All Organisms → cellular organisms → Bacteria → Terrabacteria group702Open in IMG/M
3300032261|Ga0306920_102715313All Organisms → cellular organisms → Bacteria → Terrabacteria group676Open in IMG/M
3300032828|Ga0335080_11953867All Organisms → cellular organisms → Bacteria → Terrabacteria group569Open in IMG/M
3300032898|Ga0335072_11314304All Organisms → cellular organisms → Bacteria → Terrabacteria group632Open in IMG/M
3300033004|Ga0335084_11940532All Organisms → cellular organisms → Bacteria → Terrabacteria group574Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil28.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.53%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.19%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.02%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.26%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.51%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.92%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.92%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.75%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.75%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.75%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.17%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.17%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.17%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.17%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.17%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.17%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.17%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.17%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.58%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.58%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.58%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.58%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.58%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.58%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.58%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.58%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.58%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.58%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.58%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.58%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.58%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.58%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2209111022Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichmentEnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007982Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012515Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610Host-AssociatedOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022527Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024232Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300024310Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026490Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-AEnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027684Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
22220413522209111022Grass SoilHADTSSPAFAAAARALGVSTQQLSAALAHGKQSLAGGN
JGI12635J15846_1025292413300001593Forest SoilAGHADTSSPAFAAAARALGVSTGQLDAALMHAKQSLAQGS*
JGI12627J18819_1000963853300001867Forest SoilLQPLFAAGHADTSSPAFAAAARSLGVSTQQLSTALVHAKQSLAQGG*
JGI12627J18819_1036266013300001867Forest SoilHADTSSPSFAAAARALGVSTNQLDTALMHAKQSLAQSS*
Ga0066679_1029467413300005176SoilTARVSAALQPLFAAGHADPSSPAFAAAARSLGVSSQQLSTALMHAKQSLAQGS*
Ga0070690_10076715323300005330Switchgrass RhizosphereHVSTARVSAALQPLFAAGHADTSSPSFAAAARALGVSTNQLDTALMHAKQSLAQSS*
Ga0068868_10213934913300005338Miscanthus RhizosphereVGAALQPLFAAGHADTSSPAFAAAARALGVSTNQLDTALMHAKQSLAQSS*
Ga0070714_10041307513300005435Agricultural SoilRVNAALRPLFAAGGADTSSPVFAAAARSLGVSVQQLSAALMHGKESLAGGT*
Ga0070713_10018188713300005436Corn, Switchgrass And Miscanthus RhizospherePLFAAGHADTSSPAFAAAARALGVSAEQLNTALMHAKQSLAQGS*
Ga0070710_1017687033300005437Corn, Switchgrass And Miscanthus RhizosphereVARELHVSTARVSAALQPLFAAGHADPSSPAFAAAARSLGVSTQQLSTALMHAKQSLAQGS*
Ga0070701_1034049723300005438Corn, Switchgrass And Miscanthus RhizosphereAALQPLFAAGHADTSSPSFAAAARALGVSTSQLDTALMHAKQSLAQSS*
Ga0070700_10149648223300005441Corn, Switchgrass And Miscanthus RhizosphereVSTARVSAALQPLFAAGHADTSSPSFAAAARALGVSTNQLDTALMHAKQSLAQSS*
Ga0066682_1048262623300005450SoilSTARVSAALQPLFAAGHADPSSPAFAAAARSLGVSSQQLSTALMHAKQSLAQGS*
Ga0070678_10127316413300005456Miscanthus RhizosphereAGHADTSSPAFAAAARALGVSTNQLDTALMHAKQSLAQSS*
Ga0070706_10095182713300005467Corn, Switchgrass And Miscanthus RhizosphereHVSTARVSAALQPLFAAGHADTSSPAFAAAARALGVSTNQLDTALMHAKQSLAQSS*
Ga0070734_1007414013300005533Surface SoilAGAALRPLFAAGRADTSSPMFAAAARSLGVSAQQLNTALMHAKQSLAAGQ*
Ga0070684_10198861213300005535Corn RhizosphereLFAAGGAEPDSPLLQAAARDLGVSAQQLNTALVHAKQSLASASQP*
Ga0070686_10032914233300005544Switchgrass RhizosphereGHADTSSPSFAAAARALGVSTSQLDTALMHAKQSLAQSS*
Ga0066708_1078446723300005576SoilRVSAALQPLFAAGRADTPALAAAARALGVSTGQLDTALMHAKQSLAQSS*
Ga0070762_1081419323300005602SoilFAAGGAGTSSPAFSAAARSLGVSTQQLSAALAHGKQSLAGGN*
Ga0070702_10118601823300005615Corn, Switchgrass And Miscanthus RhizosphereLQPLFAAGHADTSSPSFAAAARALGVSTSQLDTALMHAKQSLAQSS*
Ga0066903_10598485413300005764Tropical Forest SoilQPLFAAGRADSSSPVVAAAARSLGVSTHQLYAALGHAKQSLAPGS*
Ga0068870_1017506433300005840Miscanthus RhizosphereTSSPAFAAAARALGVSTNQLDTALMHAKQSLAQSS*
Ga0068860_10236536523300005843Switchgrass RhizosphereLHVSTARVSAALQPLFAAGHADTSSPAFAAAARALGVSTNQLDTALMHAKQSLAQSS*
Ga0070717_1118727513300006028Corn, Switchgrass And Miscanthus RhizosphereSSPAFAAAARSLGVSTQQLSTALMHAKQSLAQGS*
Ga0070716_10165084413300006173Corn, Switchgrass And Miscanthus RhizosphereSTARVSAALQPLFAAGHADTSSPAFAAAARALGVSTNQLDTALMHAKQSLAQSS*
Ga0070712_10002825553300006175Corn, Switchgrass And Miscanthus RhizosphereAEPDSPLLTAAARDLGVSAQQLNTALVHAKQSLASTS*
Ga0070765_10205898423300006176SoilALQPLFAAGHADTSSPAFAATARALGVSANQLDTALMHAKERLAQSS*
Ga0097621_10010814213300006237Miscanthus RhizosphereLHVSTARVSAALQPLFAAGHADTSSPSFAAAARALGVSTNQLDTALMHAKQSLAQSS*
Ga0066659_1105588713300006797SoilTTRVSAALRPLFAAGRADTSSPVLSAAARSLGVSIQQLFAALAHAKQSLAGGN*
Ga0079220_1066654523300006806Agricultural SoilRVAAALQPLFAAGHADTSSPAFAAAARALGVSTDQLNAALMHAKQTLGQGS*
Ga0075425_10039898013300006854Populus RhizosphereVAQALHVSTARVEAALQPLFAAGRADSSSPLVAAAARSLDVSTPQLFAALRHAKVSLAPGS*
Ga0075425_10109003913300006854Populus RhizosphereALAPLFAAGRVEPDSPLMRAAARDLGVSAQQLNTALVHAKQSLASAGQP*
Ga0075425_10293503613300006854Populus RhizosphereARVSAALQPLFAAGHADTSSPAFAAAARALGVSTGQLDTALMHAKQSLAQGS*
Ga0075426_1035765533300006903Populus RhizosphereSSPLVAAAARSLDVSTPQLFAALRHAKVSLAPGS*
Ga0075436_10030496833300006914Populus RhizosphereFAAGRADSSSPLVAAAARSLDVSTPQLFAALRHAKVSLAPGS*
Ga0075435_10023421733300007076Populus RhizosphereLHVSTARVEAALQPLFAAGRADSSSPLVAAAARSLDVSTPQLFAALRHAKVSLAPGS*
Ga0102924_123384523300007982Iron-Sulfur Acid SpringSMARVSAALRPLFAAGRADPSSPIVSAAARSLGVSIQQLSAALAHAKQSLAGGN*
Ga0105245_1096801613300009098Miscanthus RhizosphereSAALEPLFAAGHADTSSPAFAAAARALGVGAEQLNTALMHAKQSLAQGS*
Ga0105247_1032606813300009101Switchgrass RhizosphereAVAAELHVSTARVSAALQPLFATGHADTSSPSFAAAARALGVSTNQLDTALMHAKQSLAQSS*
Ga0126380_1005818133300010043Tropical Forest SoilAALQPLFAAGRADTSSPVIAAAARSLGVSTQQLFAALRHAKQSLAAGS*
Ga0126373_1296259013300010048Tropical Forest SoilASSPVLATAAHSLGVSTQQLFAALRHAKQSLAPGS*
Ga0134064_1009404033300010325Grasslands SoilAELHVSTARVSAALQPLFAAGHADPSSPAFAAAARSLGVSSQQLSTALMHAKQSLAQGS*
Ga0134065_1032679423300010326Grasslands SoilADTSSPAFAAAARSLGVSTQQLSAALGDAKQSLAAAN*
Ga0126370_1247851623300010358Tropical Forest SoilADTSSTAFAAAARSLGVSTQQLNTALRHAKQSLAPGN*
Ga0126372_1021088533300010360Tropical Forest SoilSSPAFATAARSLGISAQQLSAALMHAKQSMSGGH*
Ga0126372_1174504123300010360Tropical Forest SoilLAPLFAAGHADMSSIAAAARALGVSAQQLNTALVHAKQSLASTSQP*
Ga0126372_1219870423300010360Tropical Forest SoilRPLFAAGHADTSSPVFAAAARSLGVGTQQLSAALVHAKLSLAPGS*
Ga0126379_1034542433300010366Tropical Forest SoilALQPLFAAGQADASSPVLATAAHSLGVSTQQLFAALRHAKQSLAPGS*
Ga0126379_1331781313300010366Tropical Forest SoilSTPAFAAAARSLGVSVHQLSAALVHAKESLAAGQ*
Ga0126379_1388391523300010366Tropical Forest SoilALRPLFAAGRADSSSPVVAAAARSLGVSTDQLLAALRHAKQSLAPGS*
Ga0134125_1015390213300010371Terrestrial SoilGRGDTSSPVFSAAARSLGVSTQQLSAALAHAKQSLAGGN*
Ga0134126_1004517273300010396Terrestrial SoilRPLFAAGRGDTSSPVFSAAARSLGVSTQQLSAALAHAKQSLAGGN*
Ga0134126_1096068633300010396Terrestrial SoilAALEPLFAAGHADTSSPAFAAAARALGVSAEQLNTALVHAKQSLAQGS*
Ga0137391_1083199623300011270Vadose Zone SoilAGELHVSTARVSAALQPLFAAGYADPSSPAFAAIARSLGVSTQQLSAALIHAKQSLAQGS
Ga0137363_1178782223300012202Vadose Zone SoilVSAALQPLFAAGHADTSSPAFAAAARSLGVSTQQLDTALMHAKQSLAQGS*
Ga0137379_1062619213300012209Vadose Zone SoilQPLFAAGRADTSSPAFAAAARSLGVSTQQLSTALMHAKQSLGGGK*
Ga0137379_1086222223300012209Vadose Zone SoilSAALQPLFAAGHADTSSPAFAAAARALGVSTQQLLTALMHAKQSLAQGS*
Ga0137386_1067558323300012351Vadose Zone SoilLQPLFAAGHADTSSPAFAAAARALGVSTQQLLTALMHAKQSLAQGS*
Ga0157338_105359713300012515Arabidopsis RhizosphereARVSAALQPLFAAGHADTSSPAFVAAARALGVSTGQLDTALAHAKQSLAQGS*
Ga0137413_1163211423300012924Vadose Zone SoilADTSSPAFAAAARSLGVSTQQLDTALMHAKQSLAQGS*
Ga0126369_1131633923300012971Tropical Forest SoilGAALRPLFAAGRADSSSPIVAAAAHSLGVSTHQLLAALRHAKQSLAGGS*
Ga0134087_1078290923300012977Grasslands SoilGHADTASPTFAAAARALGVSAVQLSAALMHAKQSLAQGS*
Ga0157369_1123372023300013105Corn RhizosphereFAAGHADTSSPAFAAAARALGVSTNQLDTALMHAKQSLAQSS*
Ga0163162_1018708613300013306Switchgrass RhizosphereHLGVARVSAALAPLFAAGGAEPDSPLLQAAARDLGVSAQQLNTALVHAKQSLASASQP*
Ga0157372_1294146823300013307Corn RhizospherePLFAAGHADTSSPAFAAAARALGVSTGQLNAALVHAKQSLAHSS*
Ga0163163_1276909523300014325Switchgrass RhizosphereVAQELHVSTARVSAALRPLFAAGRGDTSSPVFSAAARSLGVSTQQLSAALAHAKQSLAGGN*
Ga0137403_1112687723300015264Vadose Zone SoilAPLFAAGRAAPDSALLTAAAHQLGVSTQQLNTALVHAKQSLAGS*
Ga0132256_10030373413300015372Arabidopsis RhizosphereSAALQPLFAAGHADTSSPAFAAAARALGVSTQQLDTALMHAKQSLAQSS*
Ga0132255_10425622123300015374Arabidopsis RhizosphereRAETGSPQFRAAARALGVSAQQLNTALVRAKQSLASAR*
Ga0132255_10578327413300015374Arabidopsis RhizosphereAELHLSTARVSAALQPLFAAGHADTSSPAFAAAARALGVSTGQLDTALMHAKQSLAQGS*
Ga0182034_1196450723300016371SoilPLFAAGHADPSSPAFAAAARALGVSTQQLSTALMHAKQSLAQGS
Ga0182037_1136362313300016404SoilRVSAALRPLFAAGRADTSSPILAAAARSLGVSAQQLNTALVHAKQSLAAGT
Ga0182037_1172630523300016404SoilLHVSTARVDAALQPLFAAGRAYPSSPVVAAAARSLGVSTHQLLAALMHAKQSLAPGS
Ga0182039_1167787413300016422SoilRVSAALQPLFAAGHADPSSPAFAAAARALGVSTQQLSTALMHAKQSLAQGS
Ga0187820_119417113300017924Freshwater SedimentAAGQADPSSPVFAAAARSLGVSTQQLSAALANAKQSLAPGN
Ga0187807_122204223300017926Freshwater SedimentPLFTAADPADTSSLIGAAAQSLGVSTQQLAAALAQAKQSLRPAS
Ga0187809_1000856613300017937Freshwater SedimentALQPLFAAGQADPSSPVFAAAARSLGVSTQQLSAALVNAKQSLAPGN
Ga0187809_1016415623300017937Freshwater SedimentAAGRADPSSPAFATAAISLGVSTQQLTAALVEAKQSLAGGS
Ga0210401_1117187513300020583SoilALQPLFAAGSADPSSPAFATAASSLGVSTQQLTAALTEAKQSLASGS
Ga0210400_1077257913300021170SoilLFAAGHADTSSPAFAAAARALGVSTGQLNAALMHAKQSLAQSS
Ga0210405_1066178923300021171SoilAAGHADPSSPAFAAAARSLGVSTQQLSTALMHAKQSLAQGS
Ga0210396_1041727513300021180SoilAGSADPSSPAFATAASSLGVSTQQLTAALTEAKQSLASGS
Ga0210393_1049699313300021401SoilFAAGQADTSSPVFAAAARSLGVSIQQLSTALAHAKQSLAGGN
Ga0210389_1082156013300021404SoilHADTSSPAFAAAARALGVSTGQLNAALMHAKQSLAQGS
Ga0210389_1146126023300021404SoilEGMIDSSSREFAAAAGSLSVTPQQLFAALAQAKQSLSGGK
Ga0210387_1109459713300021405SoilIDSSSREFAAAAGSLSVTPQQLFAALAQAKQSLSGGK
Ga0210390_1022705713300021474SoilARVSAALQPLFAAGQADTSSPVFAAAARSLGVSIQQLSTALAHAKQSLAGGN
Ga0210392_1100526423300021475SoilELHVSTARVSAALQPLFAAGHADTSSPAFAAAARALGVSTNQLDTALMHAKQSLAQSS
Ga0126371_1228322713300021560Tropical Forest SoilARVNAALQPLFAAGQADASSPVLATAAHSLGVSTQQLFAALRHAKQSLAPGS
Ga0126371_1331614213300021560Tropical Forest SoilDTSSPAFAAAARSLGVSTQQLFTALAHAKQSLAQGG
Ga0242664_116202623300022527SoilALQPLFAAGHGDTSSPAFAAAARSLGVSTQQLLIALMHAKQSLAQGS
Ga0247664_112560013300024232SoilLHVSTARVSAALQPLFAAGHADTSSPSFAAAARALGVSTNQLNTALMHAKQSLAQSS
Ga0179589_1061334413300024288Vadose Zone SoilAGHAETSSPACAAAARALGVSAEQLNTALVHAKQSLAQGS
Ga0247681_104861713300024310SoilAEPDSPLLQAAARDLGVSAQQLNTALVHAKQSLASASQP
Ga0207656_1025672523300025321Corn RhizosphereGHADTSSPAFAAAARALGVSTNQLDTALMHAKQSLAQSS
Ga0207692_1040526723300025898Corn, Switchgrass And Miscanthus RhizosphereLEPLFAAGHADTSSPAFAAAARALGVSAEQLNTALMHAKQSLAQGS
Ga0207692_1100847513300025898Corn, Switchgrass And Miscanthus RhizosphereTDSPQFSAAARALGVSTQQLNTALAHAKQSLASAR
Ga0207688_1005171643300025901Corn, Switchgrass And Miscanthus RhizosphereAVAAELHVSTARVSAALQPLFATGHADTSSPSFAAAARALGVSTNQLDTALMHAKQSLAQSS
Ga0207699_1127592913300025906Corn, Switchgrass And Miscanthus RhizosphereHAETSSPAFAAAARALGVSAEQLNTALVHAKQSLAQGS
Ga0207684_1132053623300025910Corn, Switchgrass And Miscanthus RhizosphereNAAVRPLFAEGTADSSSPVFAAAARSLGVSTQQLSAALAHAKQSLAGGK
Ga0207659_1118385113300025926Miscanthus RhizosphereLHVSTARVSAALQPLFATGHADTSSPSFAAAARALGVSTNQLDTALMHAKQSLAQSS
Ga0207700_1163569523300025928Corn, Switchgrass And Miscanthus RhizospherePLFAAGHADTSSPAFAAAARALGVSAEQLNTALMHAKQSLAQGS
Ga0207664_1168562723300025929Agricultural SoilPLFAAGHAETSSPAFAAAARALGVSAEQLNTALVHAKQSLAQGS
Ga0207658_1025671533300025986Switchgrass RhizosphereAGHADTSSPAFAAAARALGVSTNQLDTALMHAKQSLAQSS
Ga0207677_1098107413300026023Miscanthus RhizosphereAALQPLFAAGHADTSSPSFAAAARALGVSTSQLDTALMHAKQSLAQSS
Ga0209375_130270123300026329SoilLQPLFAAGHADPSSPAFAAAARSLGVSSQQLSTALMHAKQSLAQGS
Ga0257153_101628413300026490SoilGHADTSSPAFAAAARSLGVSTQQLDTALMHAKQSLAQGS
Ga0179587_1037268413300026557Vadose Zone SoilSAALQPLFAAGHADTSSPAFAAAARSLGVSTQQLDTALMHAKQSLAQGS
Ga0209626_102488023300027684Forest SoilMVDPSSREFAAAARSLGVSPQQLSAALAQAKQSLATGK
Ga0209178_109804933300027725Agricultural SoilAALQPLFAAGHADTSSPAFAAAARALGVSTDQLNAALMHAKQTLAQGS
Ga0209465_1006913113300027874Tropical Forest SoilRALHVSTARVSAALRPLFAAGHADTSSPVFAAAARSLGVGTQQLSAALVHAKLSLAPGS
Ga0209624_1080752513300027895Forest SoilGRADSSSPTFAAAARSLGVSPQQLSAALGAAKQSLAGGS
Ga0307282_1005232633300028784SoilGHADTSSPAFAAAARALGVSTGQLDTALAHAKQSLAQSS
Ga0307292_1023318113300028811SoilHADTSSPAFAAAARALGVSTGQLDTALAHAKQSLAQSS
Ga0307310_1035471513300028824SoilLFAAGHADTSSPAFAAAARALGVSTQQLDTALAHAKQSLAQSS
Ga0307497_1051211713300031226SoilAALQSLFAAGHADTSSPAFAAAARALGVSTGQLQTSLAHAKQSLAQGS
Ga0170819_1358383823300031469Forest SoilVAAVAGELHVSTTRVSAALEPLFAAGHADTSSPAFAAAARSLGVSTQQLFTALMHAKQSLAQGS
Ga0318516_1000644963300031543SoilAVARELHVSTARVNAALRPLFAAGRADTSSPVFAAAAHSLGVRTQQLLAALVHAKQSLAPGS
Ga0318573_1012258713300031564SoilVSAALRPLFAAGHADTSSPVFAAAARSLGVGSQQLSAALMHAKLSLAPGS
Ga0318515_1059277013300031572SoilAGHADTSSPAFAAVARSLGVSTQQLSTALMHAKQSLAQGS
Ga0318561_1050037213300031679SoilGHADPSSPAFAAAARSLGLSSQQLSSALVGAKQALAAGSS
Ga0318574_1061583213300031680SoilRELHVSTARVNAALRPLFAAGRADTSSPVFAAAAHSLGVRTQQLLAALVHAKQSLAPGS
Ga0318572_1000419983300031681SoilVSAALQPLFAAGHADPSSPAFAAAARALGVSTQQLSTALMHAKQSLAQGS
Ga0318560_1010167133300031682SoilDTSSAVFAAAARSLGVSTEQLSAALAHAKQSLAPGG
Ga0318496_1006532413300031713SoilPLFAAGRAGSSSPVVAAAARSLGVSTHQLLAALRHAKQSLAPGS
Ga0306918_1066204213300031744SoilALPLLFAAGRADTSSPVFAAAAHSLGVRTQQLLAALVHAKQSLAPGS
Ga0306918_1086165523300031744SoilALGPLFAAGHADTSSPAFAAAARSLGVSTQQLSASLMHAKMSLAPGS
Ga0306918_1111528513300031744SoilQADSSSPVIAAAARSLGVSTHQLNAALVHAKLSLAPGS
Ga0318502_1034657213300031747SoilVGAALQPLFAAGHADTSSPAFAAVARSLGVSTQQLSTALMHAKQSLAQGS
Ga0318492_1001553343300031748SoilAGRADSSSPAFAAAARSLGVSVQQLSVALEHAKQSLAGGT
Ga0318494_1013328233300031751SoilGRANTSSPILAAAARSLGVSAQQLNTALVHAKLSLAAGT
Ga0318535_1008821013300031764SoilADSSSPAFAAAARSLGVSVQQLSVALEHAKQSLAGGT
Ga0318509_1026916013300031768SoilAVARELHVSTARVNAALRPLFAAGRADTSSPVFAAAAHSLGVSTHQLYAALVHAKQSLAPGS
Ga0318543_1017182613300031777SoilAGRADTSSPAFAAAARSLGVSTQQLSAALAHAKQSLAPGS
Ga0318566_1005048133300031779SoilDPSSPAFAAAARALGVSTQQLSTALMHAKQSLAQGS
Ga0318547_1010016433300031781SoilGHADTSSAVFAAAARSLGVSTEQLSAALAHAKQSLAPGG
Ga0318529_1056314323300031792SoilSTARVDAALRPLFAAGRADSSSPVVAAAARSLGVSTQQLIAALGHAKQSLAPGS
Ga0318523_1027738713300031798SoilLHVSAARVGAALQPLFAAGHADTSSPAFAAVARSLGVSTQQLSTALMHAKQSLAQGS
Ga0318565_1027991023300031799SoilGHADTSSAAFAAAARSLSVSTHQLNAALIHAKESLAAGA
Ga0318497_1051889713300031805SoilPLFAAGRADTSSPVFAAAAHSLGVRTQQLLAALVHAKQSLAPGS
Ga0318567_1006476833300031821SoilADTSSAVFAAAARSLGVSTEQLSAALAHAKQSLAPGG
Ga0318567_1011169033300031821SoilHVSTARVDAALRPLFAAGRADSSSPVVAAAARSLGVSTQQLIAALGHAKQSLAPGS
Ga0318511_1050063523300031845SoilLFAAGHADPSSPAFAAAARALGVSTQQLSTALMHAKQSLAQGS
Ga0318527_1050850723300031859SoilHVSTARVNAALRPLFAAGRADTSSPVFAAAAHSLGVSTHQLNAALVHAKLSLAPGS
Ga0318495_1000954553300031860SoilARVSAALQPLFAAGHADPSSPAFAAAARALGVSTQQLSTALMHAKQSLAQGS
Ga0306919_1083590723300031879SoilGQADTSSPAFAAAARSLGVSTQQLSTALAQAKQSLAQGS
Ga0306925_1018620633300031890SoilRELHVSTARVNAALRPLFAAGRADTSSPVFAAAAHSLGVSTQQLLAALVHAKQSLAPGS
Ga0306923_1009807213300031910SoilTARVSAALRPLFAAGHADTSSPVFAAAARSLGVGSQQLSAALMHAKLSLAPGS
Ga0306923_1239088313300031910SoilFAAGQADASSPVFVAAARSLGLSTQQLSAALAHGKQSLAPGS
Ga0306921_1003955813300031912SoilTARVSAALRPLFAAGRADSSSPAFAAAARSLGVSVQQLSVALEHAKQSLAGGT
Ga0310912_1097393113300031941SoilADPSSPAFAAAARSLGLSSQQLSSALVGAKQALAAGSS
Ga0310913_1020889513300031945SoilLHVSTARVDAALRPLFAAGRADSSSPVVAAAARSLGVSTQQLIAALGHAKQSLAPGS
Ga0310910_1021028233300031946SoilQPLFAAGRADSSSPVVAAAARSLGVSTHQLLAALRHAKQSLAPGS
Ga0306926_1142299113300031954SoilGELHVSAARVGAALQPLFAAGHADTSSPAFAAVARSLGVSTQQLSTALMHAKQSLAQGS
Ga0318531_1045540923300031981SoilPLFAAGRAYPSSPVVAAAARSLGVSTHQLLAALMHAKQSLAPGS
Ga0306922_1170710913300032001SoilDSSSPAFAAAARSLGVSVQQLSVALAHAKQSLAGGA
Ga0318563_1041093813300032009SoilADSSSPAFAAAARSLGVSVQQLSVALAHAKQSLAGGA
Ga0318569_1024348023300032010SoilDSSSPVVAAAARSLGVSTQQLIAALGHAKQSLAPGS
Ga0310911_1037813523300032035SoilAALRPLFAAGRADTSSPVFAAAAHSLGVSTQQLLAALVHAKQSLAPGS
Ga0318549_1039836313300032041SoilTTAVARELHVTTAQASAALRPLFAAGHADPSSPALVAAARSLGVSTHQLNTALMHAKQSLAPGS
Ga0306924_10023246103300032076SoilRVGAALQPLFAAGHADTSSPAFAAVARSLGVSTQQLSTALMHAKQSLAQGS
Ga0306924_1095712533300032076SoilPSSPAFAAAARSLGLSSQQLSSALVGAKQALAAGSS
Ga0318577_1024972213300032091SoilARREQRPGRADTSSPVFAAAAHSLGVSTQQLLAALVHAKQSLAPGS
Ga0307470_1191325613300032174Hardwood Forest SoilVASELHLGVARVSAALAPLFAAGGAEPDSPLLQAAARDLGVSAQQLNTALVHAKQSLASASQP
Ga0307472_10262242713300032205Hardwood Forest SoilLFAAGRADSSSPVVAAAARSLGVSTQQLNAALVHAKLSLAPGS
Ga0306920_10255151013300032261SoilTARVSAALRPLFAAGQADTSSPVFAAAARSLGVSTQQLSAALMHAKLSLAPGS
Ga0306920_10271531313300032261SoilAALRPLFAAGRADTSSPILAAAARSLGVSAQQLNTALVHAKLSLAAGT
Ga0335080_1195386723300032828SoilLFAAGHAEVPSPAFAAAARSLGVSTQQLNTALAHAKQSLAQAADTSGECR
Ga0335072_1131430423300032898SoilAGQADTSSPVFASAAQSLGVSTQQLSAALAQGKQSVAGGN
Ga0335084_1194053223300033004SoilTSSPAFAAAARALGVSTGQLQTALAHAKQSLAQSS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.