NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F035863

Metagenome / Metatranscriptome Family F035863

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F035863
Family Type Metagenome / Metatranscriptome
Number of Sequences 171
Average Sequence Length 38 residues
Representative Sequence PKVGQGRACTMEAKAFSFTHRTKVFADGTVRKNNA
Number of Associated Samples 153
Number of Associated Scaffolds 171

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 16.96 %
% of genes near scaffold ends (potentially truncated) 79.53 %
% of genes from short scaffolds (< 2000 bps) 85.38 %
Associated GOLD sequencing projects 152
AlphaFold2 3D model prediction Yes
3D model pTM-score0.22

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (64.327 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(12.281 % of family members)
Environment Ontology (ENVO) Unclassified
(19.883 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.047 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 15.87%    Coil/Unstructured: 84.13%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.22
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 171 Family Scaffolds
PF00078RVT_1 23.98
PF08388GIIM 18.13
PF02371Transposase_20 2.34
PF08327AHSA1 1.17
PF01548DEDD_Tnp_IS110 0.58
PF12697Abhydrolase_6 0.58
PF13561adh_short_C2 0.58
PF07676PD40 0.58
PF01527HTH_Tnp_1 0.58
PF00797Acetyltransf_2 0.58
PF00872Transposase_mut 0.58
PF13537GATase_7 0.58
PF13358DDE_3 0.58
PF05163DinB 0.58
PF13683rve_3 0.58
PF04237YjbR 0.58

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 171 Family Scaffolds
COG3547TransposaseMobilome: prophages, transposons [X] 2.92
COG2162Arylamine N-acetyltransferaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.58
COG2315Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR familyTranscription [K] 0.58
COG2318Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)Secondary metabolites biosynthesis, transport and catabolism [Q] 0.58
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.58


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms64.33 %
UnclassifiedrootN/A35.67 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573001|GZR05M101A76P4Not Available508Open in IMG/M
2228664021|ICCgaii200_c1004509Not Available1681Open in IMG/M
3300000559|F14TC_101398867All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b529Open in IMG/M
3300001356|JGI12269J14319_10093676All Organisms → cellular organisms → Bacteria1513Open in IMG/M
3300001396|JGI20175J14863_1006864All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus necator1904Open in IMG/M
3300001593|JGI12635J15846_10212548Not Available1270Open in IMG/M
3300001593|JGI12635J15846_10463491Not Available753Open in IMG/M
3300001867|JGI12627J18819_10026379All Organisms → cellular organisms → Bacteria2391Open in IMG/M
3300002245|JGIcombinedJ26739_101259872All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300004080|Ga0062385_10373463All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300004267|Ga0066396_10057788All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium639Open in IMG/M
3300005167|Ga0066672_10044669All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2511Open in IMG/M
3300005174|Ga0066680_10050108Not Available2450Open in IMG/M
3300005177|Ga0066690_10052267All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2496Open in IMG/M
3300005332|Ga0066388_105326195All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300005435|Ga0070714_101416388All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300005437|Ga0070710_10069207Not Available2030Open in IMG/M
3300005445|Ga0070708_100128045All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2348Open in IMG/M
3300005451|Ga0066681_10083176Not Available1808Open in IMG/M
3300005553|Ga0066695_10216519All Organisms → cellular organisms → Bacteria1204Open in IMG/M
3300005554|Ga0066661_10669809All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300005561|Ga0066699_10762875All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium684Open in IMG/M
3300005576|Ga0066708_10339892All Organisms → cellular organisms → Bacteria963Open in IMG/M
3300005614|Ga0068856_101623514All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300005764|Ga0066903_100433393All Organisms → cellular organisms → Bacteria2185Open in IMG/M
3300006034|Ga0066656_10085680All Organisms → cellular organisms → Bacteria1889Open in IMG/M
3300006052|Ga0075029_100509177All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → Thiocapsa marina → Thiocapsa marina 5811795Open in IMG/M
3300006162|Ga0075030_101401861All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300006175|Ga0070712_101747389All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300006176|Ga0070765_101158166Not Available730Open in IMG/M
3300006224|Ga0079037_102560574All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300006852|Ga0075433_10835519Not Available804Open in IMG/M
3300006854|Ga0075425_100107146All Organisms → cellular organisms → Bacteria3183Open in IMG/M
3300007770|Ga0105015_1055529Not Available1701Open in IMG/M
3300009038|Ga0099829_11565648All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b544Open in IMG/M
3300009078|Ga0105106_10128674Not Available1863Open in IMG/M
3300009078|Ga0105106_11102109All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300009089|Ga0099828_11441399All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300009143|Ga0099792_10894178All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b587Open in IMG/M
3300009176|Ga0105242_13138765All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300009518|Ga0116128_1010515All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales3324Open in IMG/M
3300009519|Ga0116108_1021721All Organisms → cellular organisms → Bacteria2193Open in IMG/M
3300009548|Ga0116107_1014064All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales3321Open in IMG/M
3300009792|Ga0126374_10066789All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia sordidicola1905Open in IMG/M
3300009839|Ga0116223_10109226Not Available1743Open in IMG/M
3300009839|Ga0116223_10228463Not Available1129Open in IMG/M
3300010047|Ga0126382_10295273Not Available1214Open in IMG/M
3300010048|Ga0126373_10023885All Organisms → cellular organisms → Bacteria5206Open in IMG/M
3300010048|Ga0126373_11810958All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300010048|Ga0126373_12264357All Organisms → cellular organisms → Bacteria → Proteobacteria604Open in IMG/M
3300010146|Ga0126320_1092786Not Available1107Open in IMG/M
3300010304|Ga0134088_10702765All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300010341|Ga0074045_10014981All Organisms → cellular organisms → Bacteria6264Open in IMG/M
3300010358|Ga0126370_11425632All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium655Open in IMG/M
3300010360|Ga0126372_11046409Not Available831Open in IMG/M
3300010361|Ga0126378_12239523All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium624Open in IMG/M
3300010361|Ga0126378_12701963All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300010362|Ga0126377_11391331Not Available774Open in IMG/M
3300010366|Ga0126379_13761189All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300010376|Ga0126381_100450722Not Available1804Open in IMG/M
3300010379|Ga0136449_101392583All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b1084Open in IMG/M
3300010379|Ga0136449_101426931All Organisms → cellular organisms → Bacteria → Acidobacteria1066Open in IMG/M
3300010392|Ga0118731_103750769All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300011072|Ga0138563_1077421All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300011081|Ga0138575_1031497Not Available626Open in IMG/M
3300011271|Ga0137393_10598822All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300011271|Ga0137393_11272997All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b623Open in IMG/M
3300011271|Ga0137393_11543094All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium554Open in IMG/M
3300011411|Ga0153933_1080687All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium meliloti → Sinorhizobium meliloti 1021690Open in IMG/M
3300012096|Ga0137389_10041725All Organisms → cellular organisms → Bacteria → Proteobacteria3412Open in IMG/M
3300012189|Ga0137388_10754919All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300012207|Ga0137381_11194710All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300012211|Ga0137377_10318807Not Available1490Open in IMG/M
3300012212|Ga0150985_106383000All Organisms → cellular organisms → Bacteria → Proteobacteria650Open in IMG/M
3300012212|Ga0150985_116436759All Organisms → cellular organisms → Bacteria → Proteobacteria647Open in IMG/M
3300012349|Ga0137387_10147440Not Available1673Open in IMG/M
3300012351|Ga0137386_11296555All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300012903|Ga0157289_10041509Not Available1128Open in IMG/M
3300012910|Ga0157308_10365574All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300012948|Ga0126375_10499234Not Available907Open in IMG/M
3300012971|Ga0126369_13470528All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300012988|Ga0164306_10477209Not Available954Open in IMG/M
3300014166|Ga0134079_10623429All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300014199|Ga0181535_10281778All Organisms → cellular organisms → Bacteria996Open in IMG/M
3300014489|Ga0182018_10346139All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium801Open in IMG/M
3300014491|Ga0182014_10443062Not Available642Open in IMG/M
3300014638|Ga0181536_10088319Not Available1807Open in IMG/M
3300014745|Ga0157377_10199194Not Available1270Open in IMG/M
3300014838|Ga0182030_10614782Not Available1044Open in IMG/M
3300016270|Ga0182036_11786478All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300016341|Ga0182035_10089359All Organisms → cellular organisms → Bacteria2225Open in IMG/M
3300016387|Ga0182040_10116938Not Available1842Open in IMG/M
3300017929|Ga0187849_1023999All Organisms → cellular organisms → Bacteria3324Open in IMG/M
3300017934|Ga0187803_10480957All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300017940|Ga0187853_10056073Not Available2008Open in IMG/M
3300017941|Ga0187850_10193985All Organisms → cellular organisms → Bacteria933Open in IMG/M
3300017996|Ga0187891_1149177All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300018007|Ga0187805_10025721All Organisms → cellular organisms → Bacteria2594Open in IMG/M
3300018008|Ga0187888_1142007Not Available988Open in IMG/M
3300018013|Ga0187873_1203801All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300018024|Ga0187881_10423614All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300018026|Ga0187857_10525857Not Available529Open in IMG/M
3300018026|Ga0187857_10527007All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b529Open in IMG/M
3300018429|Ga0190272_11356028Not Available712Open in IMG/M
3300019082|Ga0187852_1201438Not Available821Open in IMG/M
3300020034|Ga0193753_10219900Not Available860Open in IMG/M
3300020583|Ga0210401_10038993All Organisms → cellular organisms → Bacteria → Proteobacteria4510Open in IMG/M
3300021171|Ga0210405_11414443All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b506Open in IMG/M
3300021178|Ga0210408_10583477Not Available886Open in IMG/M
3300021344|Ga0193719_10018174All Organisms → cellular organisms → Bacteria2985Open in IMG/M
3300021403|Ga0210397_10525696Not Available898Open in IMG/M
3300021404|Ga0210389_11325344All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300021477|Ga0210398_10276477Not Available1369Open in IMG/M
3300021560|Ga0126371_10588800All Organisms → cellular organisms → Bacteria1261Open in IMG/M
3300021560|Ga0126371_12016815All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → Thiocapsa marina → Thiocapsa marina 5811694Open in IMG/M
3300022507|Ga0222729_1072700Not Available510Open in IMG/M
3300022720|Ga0242672_1070924All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b630Open in IMG/M
3300023259|Ga0224551_1007984All Organisms → cellular organisms → Bacteria1763Open in IMG/M
3300025453|Ga0208455_1032802Not Available1179Open in IMG/M
3300025500|Ga0208686_1053944All Organisms → cellular organisms → Bacteria931Open in IMG/M
3300025916|Ga0207663_10003949All Organisms → cellular organisms → Bacteria7336Open in IMG/M
3300026215|Ga0209849_1007996Not Available1710Open in IMG/M
3300026313|Ga0209761_1140282All Organisms → cellular organisms → Bacteria → Acidobacteria1152Open in IMG/M
3300026315|Ga0209686_1011510All Organisms → cellular organisms → Bacteria → Acidobacteria3672Open in IMG/M
3300026318|Ga0209471_1336305All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b500Open in IMG/M
3300026469|Ga0257169_1090425All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b504Open in IMG/M
3300027050|Ga0209325_1001988All Organisms → cellular organisms → Bacteria1868Open in IMG/M
3300027109|Ga0208603_1004225All Organisms → cellular organisms → Bacteria2392Open in IMG/M
3300027502|Ga0209622_1009711Not Available1603Open in IMG/M
3300027721|Ga0209492_1051857Not Available1447Open in IMG/M
3300027738|Ga0208989_10162411Not Available748Open in IMG/M
3300027825|Ga0209039_10057937Not Available1743Open in IMG/M
3300027825|Ga0209039_10110930Not Available1168Open in IMG/M
3300027825|Ga0209039_10133674All Organisms → cellular organisms → Bacteria1042Open in IMG/M
3300027882|Ga0209590_10331551Not Available979Open in IMG/M
3300028867|Ga0302146_10421094All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium509Open in IMG/M
3300029944|Ga0311352_10489764All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b995Open in IMG/M
3300029952|Ga0311346_10726288Not Available855Open in IMG/M
3300030014|Ga0302175_10031018All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1133Open in IMG/M
3300030019|Ga0311348_10554899Not Available857Open in IMG/M
3300030862|Ga0265753_1116907All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b556Open in IMG/M
3300031421|Ga0308194_10115436Not Available791Open in IMG/M
3300031469|Ga0170819_17705430All Organisms → cellular organisms → Bacteria → Proteobacteria1317Open in IMG/M
3300031474|Ga0170818_103849491Not Available739Open in IMG/M
3300031543|Ga0318516_10423535All Organisms → cellular organisms → Bacteria → Proteobacteria766Open in IMG/M
3300031561|Ga0318528_10733466All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300031564|Ga0318573_10041719Not Available2202Open in IMG/M
3300031573|Ga0310915_10113974Not Available1840Open in IMG/M
3300031681|Ga0318572_10148639Not Available1352Open in IMG/M
3300031736|Ga0318501_10090726Not Available1510Open in IMG/M
3300031744|Ga0306918_10643694All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300031744|Ga0306918_10839442All Organisms → cellular organisms → Bacteria → Acidobacteria717Open in IMG/M
3300031754|Ga0307475_11494965All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300031796|Ga0318576_10150283Not Available1085Open in IMG/M
3300031820|Ga0307473_10111080All Organisms → cellular organisms → Bacteria1483Open in IMG/M
3300031820|Ga0307473_10460611All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300031832|Ga0318499_10096981Not Available1138Open in IMG/M
3300031846|Ga0318512_10596879All Organisms → cellular organisms → Bacteria → Proteobacteria563Open in IMG/M
3300031954|Ga0306926_12624259All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → Thiocapsa marina → Thiocapsa marina 5811549Open in IMG/M
3300031959|Ga0318530_10161135All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium914Open in IMG/M
3300032060|Ga0318505_10028323All Organisms → cellular organisms → Bacteria2261Open in IMG/M
3300032076|Ga0306924_12278270All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300032076|Ga0306924_12523024All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300032090|Ga0318518_10290762All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium839Open in IMG/M
3300032261|Ga0306920_100690976Not Available1504Open in IMG/M
3300032756|Ga0315742_13261948All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b524Open in IMG/M
3300033433|Ga0326726_10518592Not Available1141Open in IMG/M
3300033433|Ga0326726_11678867Not Available619Open in IMG/M
3300033887|Ga0334790_238387All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300034090|Ga0326723_0580268All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b518Open in IMG/M
3300034817|Ga0373948_0092428Not Available703Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.28%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.36%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.26%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland5.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.68%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.68%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.09%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.34%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.34%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.75%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.75%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.75%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.75%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.75%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.17%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.17%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.17%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.17%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.17%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.17%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.17%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.17%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.17%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.17%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.17%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.58%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.58%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.58%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.58%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.58%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.58%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.58%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.58%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.58%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.58%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.58%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.58%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.58%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.58%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.58%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.58%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.58%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.58%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573001Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300001396Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004267Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBioEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007770Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 250-2.7um, replicate aEnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010146Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300011072Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 48 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011081Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 60 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300011411Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaGHost-AssociatedOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300020034Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022507Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022720Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023259Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24EnvironmentalOpen in IMG/M
3300025453Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025500Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026215Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes)EnvironmentalOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026469Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-BEnvironmentalOpen in IMG/M
3300027050Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027109Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes)EnvironmentalOpen in IMG/M
3300027502Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027721Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028867Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_3EnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029952II_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300030014Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_3EnvironmentalOpen in IMG/M
3300030019II_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030862Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033887Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1EnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M
3300034817Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FD2_063490502189573001Grass SoilAMNRSAKGGLGRACTMGAKAYSFTHRNKVIADGTERKSNA
ICCgaii200_100450922228664021SoilSAKGGQGRARTMGAKAFSYTHRTKVFADGTVRKIRA
F14TC_10139886713300000559SoilPKVGQGRVCTSETKAFSFTHRTKVFADGTVQKNNA*
JGI12269J14319_1009367623300001356Peatlands SoilMGAAPKMNRSAKGGQGRACTMEAKAFSFTHRTKVFADGTVRKNNV*
JGI20175J14863_100686413300001396Arctic Peat SoilPKVGQGRACTMKAKAFSFTHRTKVFADGTVRKSDA*
JGI12635J15846_1021254823300001593Forest SoilPKVGQGRACCMKAKAFSFTHRTKVFADGTVRKSDA*
JGI12635J15846_1046349113300001593Forest SoilPKVGQGRACTMEAKAFSFTHRTKVFADGTVRKNNA*
JGI12627J18819_1002637923300001867Forest SoilMGAAPKMNRSAKGGQGRACTMEAKAFSFTHRTKVFADGTVRKNNA*
JGIcombinedJ26739_10125987213300002245Forest SoilKPEMNRSAKGGQGRVCVSETKAFSFTHRTKVIADGTVRKNSA*
Ga0062385_1037346323300004080Bog Forest SoilMNRSAKGGFGRARTMRAKAFSFTHRTKVIADGTERKNSA*
Ga0066396_1005778813300004267Tropical Forest SoilMGKPETNRSAEGGQGRARHMGAKAFSFTIRNKVIADGTVRKNNA*
Ga0066672_1004466933300005167SoilMGKPKMNRSAKGGQARVCTSETKAFSFTHRTKVFADATVRKNSA*
Ga0066680_1005010823300005174SoilMGKPKMNRSAKGGQGRVCALKTKAFSFTHRTKVIADGTVRKDNA*
Ga0066690_1005226733300005177SoilMGKPKMNRSAKGGQARVCTSETKAFSFTHRTKVFADGTVRKNSA*
Ga0066388_10532619513300005332Tropical Forest SoilMGKLKMNRSAKGGQGRVCTSKTKAFSFTHRTKVIADGTVRKNSA*
Ga0070714_10141638813300005435Agricultural SoilMGKPEMNRSAKGGQGRVCVSETKAFSFTHRTKVIADGTVRKNSA*
Ga0070710_1006920713300005437Corn, Switchgrass And Miscanthus RhizosphereMNRSAKGGFGRARTIRAKAFSFTHRTKVIADGTERKNSA*
Ga0070708_10012804533300005445Corn, Switchgrass And Miscanthus RhizosphereMGAAPKMNRSAKGGQGRACTMEAKAFSFTHRTKVFADGTVRKN
Ga0066681_1008317613300005451SoilMNRSAKGGFGRARTMRAKAFSFTHRTKVIAGGTERKNSA*
Ga0066695_1021651933300005553SoilPTMNRSAKGGTGRACSMKTKAFSFTRRTKVFADGTVRKNDA*
Ga0066661_1066980923300005554SoilMGAAPKMNRSAKGGQGRACTMEAKAFSFTHRTKVFADGTVRKNNT*
Ga0066699_1076287513300005561SoilVGQGRACYSGAKAFSFTHPLTKVIAGGTVRKNSA*
Ga0066708_1033989223300005576SoilMGKPKMNQSAKGGQARVCTSETKAFSFTHRTKVFADGTVRKNSA*
Ga0068856_10162351423300005614Corn RhizosphereGRPKVGQGRARTMGAKAFSYTHRTKVFADGTVRKIRA*
Ga0066903_10043339323300005764Tropical Forest SoilMGATSKMNRSAKGGQGRACTMEAKAFSFTHRTKVFADGTVRKNSA*
Ga0066656_1008568043300006034SoilKVGQGRVCTSKTKAFSFTHRTKVFAGGTVRKNNA*
Ga0075029_10050917723300006052WatershedsMNRSAKGGFGRARTMRAKAFSFTHRTKVIADGTEQKNSA*
Ga0075030_10140186113300006162WatershedsPKMNRSAKGGQGRACTMEAKAFSFTHRTKVFADGTVRKNNV*
Ga0070712_10174738913300006175Corn, Switchgrass And Miscanthus RhizosphereTGRPKVGQGRARTMGAKAFSFTHRIKVFADGTVGKIKT*
Ga0070765_10115816613300006176SoilRPKVGQGRACTMEAKAFSFTHRTKVFADGTVRKNNA*
Ga0079037_10256057433300006224Freshwater WetlandsRTGRPKVGPGRARTMGAKAFSFTHRTKVFADGTVRKTNA*
Ga0075433_1083551913300006852Populus RhizosphereRPKAGQGRACIMEAKAFSFTRRTKVFADGTVRKNST*
Ga0075425_10010714643300006854Populus RhizosphereMNRSAKGGQGRVCGLKTKAFSFTHRTKVIADGTVRKDNA*
Ga0105015_105552923300007770MarineRTGRPKVGQGRACTMEAKAFSFTHHTKVFADGTVRKTSV*
Ga0099829_1156564813300009038Vadose Zone SoilRPKVGQGRVCTSETKAFSFTHRTKVIADGTVQKNNA*
Ga0105106_1012867413300009078Freshwater SedimentKVGQGRACTMEAKAFSFTHRTKVFAGGMVRKNSA*
Ga0105106_1110210913300009078Freshwater SedimentKVGQGRACTMEAKAFSFTHRTKVFAGGTVRKNSA*
Ga0099828_1144139913300009089Vadose Zone SoilMNWSAKGGQGRACTMEAKAFSFTHRTKVFADGTVRKN
Ga0099792_1089417813300009143Vadose Zone SoilMNRSAKGGIGRACTMEAKAFSFTHRTKVFADGTVRKNDA*
Ga0105242_1313876513300009176Miscanthus RhizospherePKVGQGRACRMKAKAFSFTHRTKVFADGTVRKNDA*
Ga0116128_101051513300009518PeatlandPKVGQGRACTMEAKAFSFTHRTKVFADGTVGKNSA*
Ga0116108_102172113300009519PeatlandRSAKGGQGRACTMEAKAFSFTHRTKVFADGTVRKNNT*
Ga0116107_101406413300009548PeatlandKVGQGRACTMEAKAFSFTHRTKVFADGTVGKNSA*
Ga0126374_1006678933300009792Tropical Forest SoilRPKVGQGRVCTSETKAFSFTQRTKVFADGTVQKNNA*
Ga0116223_1010922613300009839Peatlands SoilKGGFGRARTMRAKAFSFTHRTKVIADGTERKNSA*
Ga0116223_1022846313300009839Peatlands SoilKVGQGRVCTSETKAFSFTHRTKVFAGGTVRKNNA*
Ga0126382_1029527313300010047Tropical Forest SoilRPKAGQGRACTMEAKAFSFTRRTKVFADGTVRKNST*
Ga0126373_1002388563300010048Tropical Forest SoilPKVGFGRARTIGAKAFSFTHRTKVIADGTERKNSA*
Ga0126373_1181095813300010048Tropical Forest SoilKVGQGRARTMGAKAFSFTHRTKVFADGTVRKNSA*
Ga0126373_1226435713300010048Tropical Forest SoilMGATPKMNWSAKGGVGRACTMKAKAFSFTRRTKVFADGTVRKNSA*
Ga0126320_109278613300010146SoilKVGKGRACTMKAKAFSFAHRTKVFADGTARKNNA*
Ga0134088_1070276513300010304Grasslands SoilSAKGGQARVCTSETKAFSFTHRTKVFADGTVRKNSA*
Ga0074045_1001498123300010341Bog Forest SoilMNRSANGGQGRVCIAKTKALSFTHHTKVVADGTVRKNNA*
Ga0126370_1142563213300010358Tropical Forest SoilETNRSARGGGGRACTMEAKAFSFTRRTKVFADGTVWKSSA*
Ga0126372_1104640913300010360Tropical Forest SoilTGRPKVGQGRACTMEAKAFSFTHRTKVFADGTVRKNKA*
Ga0126378_1223952323300010361Tropical Forest SoilPKVGQGRACTMEAKAFSFTHRTKVFADDTVGKNKA*
Ga0126378_1270196313300010361Tropical Forest SoilTGRPKVGQGRACTMEAKAFSFTHRTKVFADGTVRKNNA*
Ga0126377_1139133113300010362Tropical Forest SoilPKAGQGRACTMEAKAFSFTRRTKVFADGTVRKNNA*
Ga0126379_1376118913300010366Tropical Forest SoilKVGQGRACIMEAKAFSFTHRTKVFADGTVRKSDA*
Ga0126381_10045072213300010376Tropical Forest SoilKVGQGRACTMEAKAFSFTHRTKVFADGTVRKNSV*
Ga0136449_10139258313300010379Peatlands SoilGRPKVGQGRARTMGAKAFSFTHRIKVFADGTVGKIKT*
Ga0136449_10142693123300010379Peatlands SoilMNRSAKGGLGRARTMRAKAFSFTHRTKVIADGTERKNS
Ga0118731_10375076913300010392MarineKVGQGRACTMEAKAHSSTHRTKVFADGTVWKIHA*
Ga0138563_107742113300011072Peatlands SoilKGHPAMNRSAKGGLGRARTMRAKAFSFTHRTKVIADGTERKNSA*
Ga0138575_103149713300011081Peatlands SoilKVGQGRACIMEAKAFSFTHRTKVFAGGTVRKSSA*
Ga0137393_1059882233300011271Vadose Zone SoilRPQVGLGRAYTVKAKAFSFTHGTKVFADGTVRKNSA*
Ga0137393_1127299713300011271Vadose Zone SoilMNRSAKGGIGRACTMEAKAFSFTHRTKVIADGTGRKNN
Ga0137393_1154309423300011271Vadose Zone SoilKVGQGRVCTSETKAFSFTHRTKVIAGGTVQKNSA*
Ga0153933_108068723300011411Attine Ant Fungus GardensMMNRSAKGGARSSPHYGAKAFSFTHRTKVFADGTVRKNSA*
Ga0137389_1004172543300012096Vadose Zone SoilMTNRSAKGGQGRARTMGAKAFSSTHRTKVCADGTVRKTST*
Ga0137388_1075491913300012189Vadose Zone SoilPQVGLGRAYTVKAKAFSFTHGTKVFADGTVRKNSA*
Ga0137381_1119471013300012207Vadose Zone SoilMNRSAKGGQGRVCALKTKAFSFTHRTKVIADGTVRKDNA*
Ga0137377_1031880723300012211Vadose Zone SoilMNRSAKGGIGRACTMEAKAFSFTHRTKVIADGTGRKNNA*
Ga0150985_10638300023300012212Avena Fatua RhizosphereRPKVGQGRARTMGAKAFSFTHRIKVFAGGTVRKIET*
Ga0150985_11643675913300012212Avena Fatua RhizosphereKVGQGRARTMGAKAFSSTHRIKVFADGTVRKIET*
Ga0137387_1014744013300012349Vadose Zone SoilKVGQGRVCTSETKAFSFTHRTKVFAGGTVRKNSA*
Ga0137386_1129655513300012351Vadose Zone SoilMNRSAKGGIGRACTMRAKAYSSTHRTKVIADGTERKNSA*
Ga0157289_1004150913300012903SoilRPKVGQGRACTTKAKAFSFTHRTKVFADGTVWKNSA*
Ga0157308_1036557413300012910SoilKVGQGRARTMGAKAFSFTHRIKVFAGGTVRKIKT*
Ga0126375_1049923423300012948Tropical Forest SoilGRPKVGQGRACTMEAKAFSSTHRNKVCAVGTVRKI*
Ga0126369_1347052813300012971Tropical Forest SoilGRPKAGQGRACTMEAKAFSFTRRTKVFADGTVRKSDA*
Ga0164306_1047720913300012988SoilPKVGQGRVCEMKTKAFSFTHRTKVIAGGTVRKNST*
Ga0134079_1062342913300014166Grasslands SoilPKVGQGRACTMEAKAYSFTHRTKVFADGTVGKNKA*
Ga0181535_1028177813300014199BogPKVGQGRACTMEAKAFSFTHRTKVFADGTVWKNSA*
Ga0182018_1034613913300014489PalsaKVGQGRVCTSLTKAFSFTHRTKVIAGGTVRKDNV*
Ga0182014_1044306213300014491BogKVGQGRACTMEAKAFSFTHRTKVFADGTVQKNSA*
Ga0181536_1008831913300014638BogMNRSAKGGIGRACTMRAKAFSSTHRTKVIAGGTERKNSA*
Ga0157377_1019919413300014745Miscanthus RhizosphereGRPKVGQGRACRMKAKAFSFTHRTKVFADGTVRKNIA*
Ga0182030_1061478233300014838BogMNRSAKGGITMEAKAFSFTHRTKVIADGTGLKNNA*
Ga0182036_1178647813300016270SoilEPVSPLVGQGRACYSGAKAFSFTHPLTKVIAGGTVRKNSA
Ga0182035_1008935933300016341SoilAKGGVGRACTMKAKAFSFTRRTKVFADSTVRKNSA
Ga0182040_1011693813300016387SoilPKVGQGRVCTMVTKAFSFTHRTKVFAGGTVWKNNA
Ga0187849_102399913300017929PeatlandPKVGQGRACTMEAKAFSFTHRTKVFADGTVGKNSA
Ga0187803_1048095713300017934Freshwater SedimentPAMNRSAQGGSGRACTMEAKALSSTHRTKVIAGGTERKNGV
Ga0187853_1005607343300017940PeatlandMNRSAKGGIGRACTMRAKAFSSTHRTKVIAGGTERKNSA
Ga0187850_1019398523300017941PeatlandRPKVGQGRACNMEAKAFSFTHRTKVFADGTVQKNSA
Ga0187891_114917723300017996PeatlandMMNRSAKGGISRACTMEAKAFSFTHRTKVFADGTVGKN
Ga0187805_1002572133300018007Freshwater SedimentMGAAPKMNRSAKGGQGRACTMEAKAFSFTHRTKVFADGTVRKNNV
Ga0187888_114200713300018008PeatlandRPKVGQGRACTMEAKAFSFTHRTKVFADGTVGKNSA
Ga0187873_120380113300018013PeatlandAPKMNRSAKGGQGRACTMEAKAFSFTHRTKVFADGTVRKNNV
Ga0187881_1042361413300018024PeatlandMGATPMMNRSAKGGIGRACTMEAKAFSFTHRTKVFADGTVQKNSA
Ga0187857_1052585723300018026PeatlandPAMNRSAKGGIGRACTMEAKAFSFTHRTKVIAGGTGWKNNA
Ga0187857_1052700713300018026PeatlandRPKVGQGRACNMEAKAFSFTHRTKVFADGTVRKNSA
Ga0190272_1135602813300018429SoilTGRPKVGQGRARTMGAKAFSYTHRTKVFADGTVRKIRA
Ga0187852_120143823300019082PeatlandPKVGQGRACTMEAKAFSFTHRTKVFADGTVRKSDA
Ga0193753_1021990013300020034SoilGRPKVGQGRACSMEAKAFSFTHRTKVFADGTVGKNKA
Ga0210401_1003899313300020583SoilPKVGQGRVCEMKTKAFSFTHRTKVIAGGTVQKNST
Ga0210405_1141444313300021171SoilMNRSAKGGIGRACTMEAKAFSFTHRTKVIADGTGWKNNA
Ga0210408_1058347713300021178SoilRPKVGQGRVCTSETKAFSFTHRTKVFADGTVQKNNA
Ga0193719_1001817423300021344SoilMNRSAKGGFGRARTMRAKAFSFTHRTKVIADGTERKNSA
Ga0210397_1052569623300021403SoilPKAGQGRACTMEAKALSFTRRTKVFADGTVRKNSA
Ga0210389_1132534423300021404SoilGRPKVGKVRARTMGAKAFSFTHRAKVFADGTIRKNNA
Ga0210398_1027647723300021477SoilTDRPKVGQGRACTIKVKAFSFTHRTKVFADGTVRKNNA
Ga0126371_1058880013300021560Tropical Forest SoilMNWSAKGGVGRACSMKAKAFSFTRRTKVFADGTVRK
Ga0126371_1201681513300021560Tropical Forest SoilMMNRSANGGKGRACVYMAKALSFAHHTKVVADGTVRKNNV
Ga0222729_107270013300022507SoilPKVGQGRVCTSKTKAFSFTPHTKVIADGTVQKNSA
Ga0242672_107092413300022720SoilMNRSAKGGLGRACTMGAKAYSFTHRTKVIADGTERKSNA
Ga0224551_100798433300023259SoilRPKVGQGRARTMGAKAFSFTHRTKVYADGTVRKNKA
Ga0208455_103280223300025453PeatlandAMNRSAKGGFGRARTMRAKAFSFTHRTKVIADGTERKNSA
Ga0208686_105394423300025500PeatlandMGAAPKMNRSAKGGQGRACTMEAKAFSFTHRTKVFADGTVRKNNT
Ga0207663_10003949113300025916Corn, Switchgrass And Miscanthus RhizosphereAMNQSANGGFGRARTMRAKAFSFTHRTKVIADGTERKNSA
Ga0209849_100799613300026215SoilRPKVGQGRACTMKAKAFSFTHRTKVFADGTVRKNGA
Ga0209761_114028213300026313Grasslands SoilMNRSAKGGFGRARTMRAKAFSFTHRTKVIADGTERKNS
Ga0209686_101151043300026315SoilVSIVRWDPMGKPKMNRSAKGGQARVCTSETKAFSFTHRTKVFADGTVRKNSA
Ga0209471_133630513300026318SoilRPKVGQGRVCASKTKAFSFTHRTKVFADGTVQKNNA
Ga0257169_109042513300026469SoilRPKVGQGRVCTSKTKAFSFTHRTKVFAGGTVQKNSA
Ga0209325_100198823300027050Forest SoilGAAPKMNRSAKGGQGRACTMEAKAFSFTHRTKVFADGTVRKNNA
Ga0208603_100422513300027109Forest SoilTGRPKVGQGRVCNIETKAFSFTHRTKVFAGGTVRKNSA
Ga0209622_100971113300027502Forest SoilPKVGQGRACNMEAKAFSFTHRTKVFADGTVRKNSV
Ga0209492_105185713300027721Freshwater SedimentRPKVGQGRACSMEAKAFSSTHRTKVFAGGTVWKIGA
Ga0208989_1016241113300027738Forest SoilTGRPKVGQGRACTMKAKAFSFTHRNKVFADGTVRKNNA
Ga0209039_1005793723300027825Bog Forest SoilAKGGQGRACTMEAKAYSFTHRTKVFADGTVGKNNA
Ga0209039_1011093023300027825Bog Forest SoilMNRSAKGGLGRACTMKAKAFSFTHRTKVIADGTERKNNA
Ga0209039_1013367413300027825Bog Forest SoilMMNRSAKGGIGRACTMEAKAFSFTHRTKVFAGGTVRKNSA
Ga0209590_1033155113300027882Vadose Zone SoilPKVGQGRVCTSKTKAFSFTHRTKVFAGGTVQKNSA
Ga0302146_1042109413300028867BogGTGRPKVGQGRACTMKAKAFSFTHRAKVFADGTVGKNSA
Ga0311352_1048976423300029944PalsaERNRSAKGGTGQACTMKAKAFSFTHRTKVFADCTVRKSDA
Ga0311346_1072628823300029952BogPKVGQGRACTMKAKAFSFTHRAKVFADGTVGKNSA
Ga0302175_1003101823300030014FenMNRSAKGGLGRACTMKAKAFSFTHRTKVIADGTERKN
Ga0311348_1055489923300030019FenNRSAKGGLGRACTMKAKAFSFTHRTKVIADGTERKNNA
Ga0265753_111690713300030862SoilPKVGQGRVCTSETKAFSFTHRTKVFADGTVRKNSV
Ga0308194_1011543623300031421SoilPQGRTGRPKVGQGRARTMGAKAFSYTHRTKVFADGTVRKIMA
Ga0170819_1770543023300031469Forest SoilMNRSAKGGFGRARTMRAKAFSFTHRTKVIADGTERKNNA
Ga0170818_10384949123300031474Forest SoilHPAMNRSAKGGFGRARTMRAKAFSFTHRTKVIADGTERKNSA
Ga0318516_1042353513300031543SoilPKVGQGRVCTSETKAFSFTHRTKVFADGTVRKNSA
Ga0318528_1073346613300031561SoilVMNRSAKGGLGRARTMRAKAFSFTHRTKVIADGTERKNSA
Ga0318573_1004171923300031564SoilMNRSAKGGLGRARTMRAKAFSFTHRTKVIADGTERKNSA
Ga0310915_1011397433300031573SoilPKVGQGRVCTMETKAFSFTHRTKVFAGGTVRKSSV
Ga0318572_1014863913300031681SoilGRPKVGQGRVCTSETKAFSFTHRTKVFADGTVQKNNA
Ga0318501_1009072613300031736SoilGRNQWGHPVMNRSAKGGLGRARTMRAKAFSFTHRTKVIADGTERKNSA
Ga0306918_1064369413300031744SoilPKVGQGRACTLKAKAFSFTHRTKVFADGTVRKNDA
Ga0306918_1083944213300031744SoilMNRSAKGGQGRVCIAKTKAFSFTHHTKVVADGTVRKNN
Ga0307475_1149496523300031754Hardwood Forest SoilVKFPGPTRPKVGQGRVCTSETKAFSFTHRTKVFADG
Ga0318576_1015028323300031796SoilQWGHPVMNRSAKGGLGRARTMRAKAFSFTHRTKVIADGTERKNSA
Ga0307473_1011108013300031820Hardwood Forest SoilTGRPKVGQGRVCTSETKAFSFTHRTKVFADGTVQKNNA
Ga0307473_1046061123300031820Hardwood Forest SoilMNRSAKGGQGRACTMEAKAFPFTHRTKVFADGTVRKNNT
Ga0318499_1009698123300031832SoilRPKVGQGRARTMGAKAFSFTHRTKVFADGTVRKIRA
Ga0318512_1059687913300031846SoilRPKVGQGRVCTSETKAFSFTHRTKVFADGTVRKNSA
Ga0306926_1262425913300031954SoilMTRSAIGGQGRVCEMKTKAFSFTHRTKVIAGGTVRKNNDVTSGEL
Ga0318530_1016113523300031959SoilMNRSAKGGLGRARTMRAKAFSFTHRTKVIADGTERKN
Ga0318505_1002832333300032060SoilMNRSANGGQGRVRETGTKAFSFTHQTKVFAGSTVRKNNA
Ga0306924_1227827013300032076SoilTGRPKVGQGRARTMGAKAFSFTHRIKVFADGTVGKIKT
Ga0306924_1252302413300032076SoilKMNWSAKGGAGRACTMEAKAFSFSRRTKVFADGTVWKSKA
Ga0318518_1029076213300032090SoilMNRSAKGGVGRACTMKAKAFSFTRRTKVFADGTVRKNS
Ga0306920_10069097613300032261SoilTGRPKVGQGRACTMEAKAFSFTHRTKVFADGTVRKNSV
Ga0315742_1326194823300032756Forest SoilMNRSAKGGIGRACTMKAKAFSFTHRTKVIADGTGRK
Ga0326726_1051859213300033433Peat SoilNQWGHPVMNRSAKGGFGRACTMRAKAFSSTHRTKVIAGGTERKNNA
Ga0326726_1167886713300033433Peat SoilGATPEMNRSAKGGQGRACTMKAKAFSFTHRTKVFADGTVRKSGA
Ga0334790_238387_277_3843300033887SoilMNRSAKGGITMEAKAFSFTHRTKVIADGTGLKNNA
Ga0326723_0580268_392_5173300034090Peat SoilPKMNRSAKGGQGRACTMEAKAFSFTHRTKVFADGTVRKNSV
Ga0373948_0092428_587_7033300034817Rhizosphere SoilTGRPKVGQGRACTMEAKAFSSTHRTKVFAVGTVRKIWA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.