| Basic Information | |
|---|---|
| Family ID | F035820 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 171 |
| Average Sequence Length | 44 residues |
| Representative Sequence | LAKLGSLTNLRAVRDPSSDTGWKIELGPFPGWRDVPTW |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 171 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.26 % |
| % of genes near scaffold ends (potentially truncated) | 90.64 % |
| % of genes from short scaffolds (< 2000 bps) | 95.91 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.398 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (33.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.088 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (50.292 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 21.21% Coil/Unstructured: 78.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 171 Family Scaffolds |
|---|---|---|
| PF00069 | Pkinase | 7.60 |
| PF13620 | CarboxypepD_reg | 7.02 |
| PF13635 | DUF4143 | 6.43 |
| PF01850 | PIN | 4.09 |
| PF05016 | ParE_toxin | 2.92 |
| PF08309 | LVIVD | 2.92 |
| PF07676 | PD40 | 2.34 |
| PF01934 | HepT-like | 2.34 |
| PF13470 | PIN_3 | 1.75 |
| PF00400 | WD40 | 1.75 |
| PF01402 | RHH_1 | 1.75 |
| PF01909 | NTP_transf_2 | 1.75 |
| PF07927 | HicA_toxin | 1.75 |
| PF04365 | BrnT_toxin | 1.17 |
| PF01408 | GFO_IDH_MocA | 1.17 |
| PF00486 | Trans_reg_C | 1.17 |
| PF15919 | HicB_lk_antitox | 1.17 |
| PF02604 | PhdYeFM_antitox | 1.17 |
| PF13173 | AAA_14 | 0.58 |
| PF03465 | eRF1_3 | 0.58 |
| PF04014 | MazE_antitoxin | 0.58 |
| PF03007 | WES_acyltransf | 0.58 |
| PF01654 | Cyt_bd_oxida_I | 0.58 |
| PF02452 | PemK_toxin | 0.58 |
| PF06769 | YoeB_toxin | 0.58 |
| PF13614 | AAA_31 | 0.58 |
| PF02673 | BacA | 0.58 |
| PF13581 | HATPase_c_2 | 0.58 |
| PF02661 | Fic | 0.58 |
| PF16347 | DUF4976 | 0.58 |
| PF14384 | BrnA_antitoxin | 0.58 |
| PF07715 | Plug | 0.58 |
| PF05168 | HEPN | 0.58 |
| PF16277 | DUF4926 | 0.58 |
| PF01927 | Mut7-C | 0.58 |
| PF01118 | Semialdhyde_dh | 0.58 |
| PF14437 | MafB19-deam | 0.58 |
| PF08843 | AbiEii | 0.58 |
| PF05193 | Peptidase_M16_C | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 171 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 30.41 |
| COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 2.92 |
| COG2445 | Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 family | General function prediction only [R] | 2.34 |
| COG2361 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 2.34 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 1.75 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 1.17 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 1.17 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 1.17 |
| COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 0.58 |
| COG4908 | Uncharacterized conserved protein, contains a NRPS condensation (elongation) domain | General function prediction only [R] | 0.58 |
| COG4115 | Toxin component of the Txe-Axe toxin-antitoxin module, Txe/YoeB family | Defense mechanisms [V] | 0.58 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.58 |
| COG2250 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.58 |
| COG1968 | Undecaprenyl pyrophosphate phosphatase | Lipid transport and metabolism [I] | 0.58 |
| COG1895 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.58 |
| COG1656 | Uncharacterized conserved protein, contains PIN-related Mut7-C RNAse domain | General function prediction only [R] | 0.58 |
| COG1271 | Cytochrome bd-type quinol oxidase, subunit 1 | Energy production and conversion [C] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.40 % |
| Unclassified | root | N/A | 7.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001213|JGIcombinedJ13530_101645974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
| 3300001547|JGI20215J15232_1049481 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300002822|BMAI_1029547 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1054 | Open in IMG/M |
| 3300002822|BMAI_1139259 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300003988|Ga0055475_10232898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium → unclassified Cyanobium → Cyanobium sp. N.Huapi 1H5 | 584 | Open in IMG/M |
| 3300004023|Ga0055441_10088132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300004030|Ga0055444_10214507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 720 | Open in IMG/M |
| 3300004051|Ga0055492_10143979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 564 | Open in IMG/M |
| 3300004061|Ga0055487_10106673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 515 | Open in IMG/M |
| 3300004065|Ga0055481_10353159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 624 | Open in IMG/M |
| 3300005219|Ga0069004_10205643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 589 | Open in IMG/M |
| 3300005590|Ga0070727_10255095 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300005615|Ga0070702_100895785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
| 3300005836|Ga0074470_11214908 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300006224|Ga0079037_100405777 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300006224|Ga0079037_100970937 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300006224|Ga0079037_101139789 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300006224|Ga0079037_101444009 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300006224|Ga0079037_101600933 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300006224|Ga0079037_102302977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300006467|Ga0099972_11710075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → unclassified Holophagales → Holophagales bacterium | 1056 | Open in IMG/M |
| 3300006577|Ga0074050_12099344 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300009053|Ga0105095_10421555 | Not Available | 737 | Open in IMG/M |
| 3300009075|Ga0105090_10285483 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300009075|Ga0105090_10612812 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300009078|Ga0105106_10545059 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300009078|Ga0105106_10882657 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300009091|Ga0102851_10074103 | All Organisms → cellular organisms → Bacteria | 2848 | Open in IMG/M |
| 3300009091|Ga0102851_11763455 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300009091|Ga0102851_11968227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300009091|Ga0102851_12389117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 604 | Open in IMG/M |
| 3300009091|Ga0102851_12542184 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300009091|Ga0102851_12590216 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300009091|Ga0102851_12885690 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300009091|Ga0102851_12922851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 549 | Open in IMG/M |
| 3300009091|Ga0102851_13485584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300009111|Ga0115026_10541848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 873 | Open in IMG/M |
| 3300009111|Ga0115026_10577284 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300009111|Ga0115026_10984468 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300009131|Ga0115027_11318662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300009131|Ga0115027_11726546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 522 | Open in IMG/M |
| 3300009146|Ga0105091_10238521 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300009153|Ga0105094_10465927 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300009153|Ga0105094_10750090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 573 | Open in IMG/M |
| 3300009165|Ga0105102_10286850 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas | 849 | Open in IMG/M |
| 3300009166|Ga0105100_10143470 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
| 3300009167|Ga0113563_11602296 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300009167|Ga0113563_11888646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae | 712 | Open in IMG/M |
| 3300009167|Ga0113563_12310820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 647 | Open in IMG/M |
| 3300009170|Ga0105096_10240317 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 919 | Open in IMG/M |
| 3300009179|Ga0115028_10629919 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 806 | Open in IMG/M |
| 3300009504|Ga0114946_10197042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 1089 | Open in IMG/M |
| 3300009506|Ga0118657_10519471 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1 → unclassified candidate division KSB1 → candidate division KSB1 bacterium RBG_16_48_16 | 1537 | Open in IMG/M |
| 3300009506|Ga0118657_12234971 | Not Available | 625 | Open in IMG/M |
| 3300009868|Ga0130016_10900797 | Not Available | 516 | Open in IMG/M |
| 3300010392|Ga0118731_104945603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 517 | Open in IMG/M |
| 3300010392|Ga0118731_110031405 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 750 | Open in IMG/M |
| 3300010392|Ga0118731_112164052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300010392|Ga0118731_115486002 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300010412|Ga0136852_10553237 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300010412|Ga0136852_11623376 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300010430|Ga0118733_102304863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1067 | Open in IMG/M |
| 3300010430|Ga0118733_107629485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 561 | Open in IMG/M |
| 3300011262|Ga0151668_1055543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 555 | Open in IMG/M |
| 3300012931|Ga0153915_10602373 | Not Available | 1263 | Open in IMG/M |
| 3300012964|Ga0153916_10774928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1039 | Open in IMG/M |
| 3300014315|Ga0075350_1096195 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300014324|Ga0075352_1124295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
| 3300015372|Ga0132256_103599960 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300024056|Ga0124853_1208086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 2392 | Open in IMG/M |
| 3300024056|Ga0124853_1517238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 2289 | Open in IMG/M |
| 3300024233|Ga0224521_1021343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1496 | Open in IMG/M |
| 3300024240|Ga0224522_1031159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1357 | Open in IMG/M |
| (restricted) 3300024528|Ga0255045_10398283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 564 | Open in IMG/M |
| 3300025557|Ga0210141_1029365 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300025799|Ga0210122_1089304 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300026026|Ga0210129_1130870 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300027743|Ga0209593_10034519 | All Organisms → cellular organisms → Bacteria | 1990 | Open in IMG/M |
| 3300027828|Ga0209692_10508609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300027871|Ga0209397_10176875 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| (restricted) 3300027881|Ga0255055_10761539 | Not Available | 515 | Open in IMG/M |
| 3300027885|Ga0209450_10257874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 1250 | Open in IMG/M |
| 3300027900|Ga0209253_10301858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1243 | Open in IMG/M |
| 3300027900|Ga0209253_10330638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 1175 | Open in IMG/M |
| 3300027917|Ga0209536_101186181 | Not Available | 937 | Open in IMG/M |
| 3300027917|Ga0209536_102457320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Candidatus Sulfomarinibacteraceae → Candidatus Sulfomarinibacter → Candidatus Sulfomarinibacter kjeldsenii | 615 | Open in IMG/M |
| 3300027975|Ga0209391_10075886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 1531 | Open in IMG/M |
| (restricted) 3300028045|Ga0233414_10463593 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300030613|Ga0299915_10544048 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300030613|Ga0299915_10844180 | Not Available | 567 | Open in IMG/M |
| 3300031665|Ga0316575_10216959 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300031727|Ga0316576_10000911 | All Organisms → cellular organisms → Bacteria | 15070 | Open in IMG/M |
| 3300031728|Ga0316578_10267098 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300031733|Ga0316577_10805342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300031834|Ga0315290_10210446 | Not Available | 1692 | Open in IMG/M |
| 3300031834|Ga0315290_10626774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 932 | Open in IMG/M |
| 3300031834|Ga0315290_11447090 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300032173|Ga0315268_12489415 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300032251|Ga0316198_10021994 | All Organisms → cellular organisms → Bacteria | 3922 | Open in IMG/M |
| 3300032251|Ga0316198_10203011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1146 | Open in IMG/M |
| 3300032256|Ga0315271_10659790 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300032258|Ga0316191_10199345 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
| 3300032259|Ga0316190_10659422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp. | 696 | Open in IMG/M |
| 3300032260|Ga0316192_10910941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp. | 589 | Open in IMG/M |
| 3300032262|Ga0316194_10428465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 836 | Open in IMG/M |
| 3300032263|Ga0316195_10443680 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300032263|Ga0316195_10803194 | Not Available | 506 | Open in IMG/M |
| 3300032273|Ga0316197_10621386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 560 | Open in IMG/M |
| 3300032401|Ga0315275_12441501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 542 | Open in IMG/M |
| 3300033406|Ga0316604_10592291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300033406|Ga0316604_10789667 | Not Available | 521 | Open in IMG/M |
| 3300033408|Ga0316605_11029279 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300033408|Ga0316605_11557103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 642 | Open in IMG/M |
| 3300033408|Ga0316605_11673266 | Not Available | 619 | Open in IMG/M |
| 3300033408|Ga0316605_11826885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300033408|Ga0316605_11864650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 585 | Open in IMG/M |
| 3300033408|Ga0316605_11973843 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300033413|Ga0316603_10132254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 2034 | Open in IMG/M |
| 3300033413|Ga0316603_10381083 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
| 3300033413|Ga0316603_10586468 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300033413|Ga0316603_10861338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
| 3300033413|Ga0316603_10877735 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300033413|Ga0316603_11131774 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300033413|Ga0316603_11420735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 658 | Open in IMG/M |
| 3300033413|Ga0316603_11765266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300033414|Ga0316619_10755414 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300033416|Ga0316622_100094224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 2981 | Open in IMG/M |
| 3300033416|Ga0316622_100288346 | All Organisms → cellular organisms → Bacteria | 1799 | Open in IMG/M |
| 3300033416|Ga0316622_100795396 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300033416|Ga0316622_101119439 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300033416|Ga0316622_101306812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 848 | Open in IMG/M |
| 3300033416|Ga0316622_101880730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 696 | Open in IMG/M |
| 3300033416|Ga0316622_102213504 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 637 | Open in IMG/M |
| 3300033416|Ga0316622_102691516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 571 | Open in IMG/M |
| 3300033416|Ga0316622_102878526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 550 | Open in IMG/M |
| 3300033418|Ga0316625_101112644 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300033418|Ga0316625_101361135 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300033418|Ga0316625_102587278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 515 | Open in IMG/M |
| 3300033419|Ga0316601_100341802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 1387 | Open in IMG/M |
| 3300033419|Ga0316601_101471375 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 686 | Open in IMG/M |
| 3300033429|Ga0316193_10355220 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300033429|Ga0316193_10521958 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300033429|Ga0316193_10797580 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300033434|Ga0316613_10262279 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300033480|Ga0316620_11363320 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300033481|Ga0316600_10495247 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales | 848 | Open in IMG/M |
| 3300033483|Ga0316629_11304388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalogenimonas → Dehalogenimonas alkenigignens | 584 | Open in IMG/M |
| 3300033483|Ga0316629_11840744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 501 | Open in IMG/M |
| 3300033485|Ga0316626_10224674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 1490 | Open in IMG/M |
| 3300033485|Ga0316626_10636890 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300033485|Ga0316626_10638336 | Not Available | 922 | Open in IMG/M |
| 3300033485|Ga0316626_10711589 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300033485|Ga0316626_11316001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300033485|Ga0316626_11742239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 563 | Open in IMG/M |
| 3300033485|Ga0316626_11978394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300033488|Ga0316621_10292920 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1066 | Open in IMG/M |
| 3300033488|Ga0316621_10626394 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300033488|Ga0316621_11090762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300033493|Ga0316631_10075890 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1144 | Open in IMG/M |
| 3300033513|Ga0316628_100930770 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300033513|Ga0316628_102319118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300033513|Ga0316628_103708496 | Not Available | 549 | Open in IMG/M |
| 3300033521|Ga0316616_100245438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 1839 | Open in IMG/M |
| 3300033521|Ga0316616_103227634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 614 | Open in IMG/M |
| 3300033521|Ga0316616_104406139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 530 | Open in IMG/M |
| 3300033521|Ga0316616_104752849 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300033557|Ga0316617_100958341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 833 | Open in IMG/M |
| 3300033557|Ga0316617_101368030 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300033557|Ga0316617_102068186 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300034052|Ga0373889_088241 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300034081|Ga0373911_085263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 33.33% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 11.70% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 7.60% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 5.26% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 5.85% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 4.09% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.51% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 2.34% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.34% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 2.92% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.75% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 1.75% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.17% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 1.17% |
| Mangrove Soil | Environmental → Aquatic → Marine → Oceanic → Sediment → Mangrove Soil | 1.17% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.17% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 1.17% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 1.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.17% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.17% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.17% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 1.17% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.58% |
| Wetland | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Wetland | 0.58% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.58% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.58% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.58% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.58% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.58% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.58% |
| Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001547 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site C1 Bulk | Environmental | Open in IMG/M |
| 3300002822 | Illumina_Fosmid_Bertioga | Environmental | Open in IMG/M |
| 3300003988 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2 | Environmental | Open in IMG/M |
| 3300004023 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordA_D2 | Environmental | Open in IMG/M |
| 3300004030 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordA_D2 | Environmental | Open in IMG/M |
| 3300004051 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2 | Environmental | Open in IMG/M |
| 3300004061 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004065 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D2 | Environmental | Open in IMG/M |
| 3300005219 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D2 | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009504 | Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment | Environmental | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300009868 | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant | Engineered | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010412 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300011262 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_5, total | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300014315 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300024056 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300024233 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T0 | Environmental | Open in IMG/M |
| 3300024240 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T25 | Environmental | Open in IMG/M |
| 3300024528 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23 | Environmental | Open in IMG/M |
| 3300025557 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025799 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026026 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027828 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027881 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27 | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027975 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
| 3300030613 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 | Environmental | Open in IMG/M |
| 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Host-Associated | Open in IMG/M |
| 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Host-Associated | Open in IMG/M |
| 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Host-Associated | Open in IMG/M |
| 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Host-Associated | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032251 | Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxic | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032258 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cm | Environmental | Open in IMG/M |
| 3300032259 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 | Environmental | Open in IMG/M |
| 3300032260 | Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrow | Environmental | Open in IMG/M |
| 3300032262 | Coastal sediment microbial communities from Maine, United States - Cross River sediment 1 | Environmental | Open in IMG/M |
| 3300032263 | Coastal sediment microbial communities from Maine, United States - Phippsburg sediment 1 | Environmental | Open in IMG/M |
| 3300032273 | Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A oxic | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300033406 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033429 | Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2 | Environmental | Open in IMG/M |
| 3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033493 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D3_A | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300034052 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A4.2 | Engineered | Open in IMG/M |
| 3300034081 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B4A4.3 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ13530_1016459742 | 3300001213 | Wetland | MTNLRAVRDPASDTGWKIEIGRFPGWAVVPDWQP* |
| JGI20215J15232_10494812 | 3300001547 | Wetland | LADADLTKRPLHTLPYEPLLAKLKSLTSLRAVCDPSSDTGLKIEIGPFPGRMEASGW* |
| BMAI_10295471 | 3300002822 | Mangrove Soil | LHGLSYDELITKLRTLSNVRAIRDRESSTSWMIEVGPFPGWAEVPTW* |
| BMAI_11392593 | 3300002822 | Mangrove Soil | DELIAKLHSLTNLRAVRDEESSTGWKIEVGPFPGWAEVPTW* |
| Ga0055475_102328982 | 3300003988 | Natural And Restored Wetlands | KPPLHTLPHDELIAKLRSLTNLRAVRDADDPTGWTIELGPFPGWSDTPTW* |
| Ga0055441_100881322 | 3300004023 | Natural And Restored Wetlands | LLAKLKSLTNLRAVPDETSTTGWKIEIGSLPSWEKVPTW* |
| Ga0055444_102145072 | 3300004030 | Natural And Restored Wetlands | PDLSKPPLHTLPYDELMAKLRSFTNLEVVEDEASSTGYRLEVGPFPGWMDVPTW* |
| Ga0055492_101439792 | 3300004051 | Natural And Restored Wetlands | PHDELIAKLKTLTNLRAVRDEDSSTGWKIEVGPFPGWAEVPTW* |
| Ga0055487_101066731 | 3300004061 | Natural And Restored Wetlands | ALPHDELLAKLHSLTNLRAVRDASSPNGWKIDLGPFPGWTEVPEW* |
| Ga0055481_103531592 | 3300004065 | Natural And Restored Wetlands | RDELLAKLQSLTNFRAVRDPEAPNGWSIELDTFPGWKDVATW* |
| Ga0069004_102056431 | 3300005219 | Natural And Restored Wetlands | LTKRPLHTLPYEPLLAKLKSLTSLRAVCDPSSDTGLKIEIGPFPGRMEASGW* |
| Ga0070727_102550951 | 3300005590 | Marine Sediment | AKLKSLTNLRAVPDETSSTGWKIEIGPFPGWEEVPEW* |
| Ga0070702_1008957852 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | EELLAKLRALTNLRAVPDPSSATGYKIEAGPFPGWATVPRW* |
| Ga0074470_112149081 | 3300005836 | Sediment (Intertidal) | FQTLPRKELLAKLRALTNLRAVPDPSSATGYKIEAGPFSGWASVPGW* |
| Ga0079037_1004057771 | 3300006224 | Freshwater Wetlands | TLPHDELLAKLKSLTNLRAVRDPASDTGYSIELDPFPGWAVVPEWNP* |
| Ga0079037_1009709372 | 3300006224 | Freshwater Wetlands | ELLAKLKSLTNLRAVRDPASETGWKIEVGPFPGWKDVPTWQP* |
| Ga0079037_1011397891 | 3300006224 | Freshwater Wetlands | PPLHTLRHDELLAKLDSLTNLRAVRDDSSSTGWTITSGPFPGWATVPEWNP* |
| Ga0079037_1014440091 | 3300006224 | Freshwater Wetlands | LAKLKSLTNLRAVKDAASPTGWKIEVGPFPGWRDVPTW* |
| Ga0079037_1016009331 | 3300006224 | Freshwater Wetlands | HTLRHDELLAKLDSLTNLRAVRDDSSSTGWTITFGPFPGWANVPTW* |
| Ga0079037_1023029771 | 3300006224 | Freshwater Wetlands | PLHALPLDQLLAKLRSLTNFRAVRDPASSTGWKIEIGPFPGWRDVPSW* |
| Ga0099972_117100751 | 3300006467 | Marine | ELIAKLQSLTNLRAVRDPESSTGWSIDIGPFPGWKEVPEW* |
| Ga0074050_120993442 | 3300006577 | Soil | PDPSEPPFQTLPREELLAKLRALTNLRAVPDPASATGYKIEAGTFPGWGSVPEW* |
| Ga0105095_104215551 | 3300009053 | Freshwater Sediment | LTNLRAVRDPASDSGWKVEIGPFPGWATVSEWNP* |
| Ga0105090_102854834 | 3300009075 | Freshwater Sediment | LRSFTNLRAVRDPKAANGWAIELGPFPGWRDVPNW* |
| Ga0105090_106128121 | 3300009075 | Freshwater Sediment | PHDELLAKLRSLTNLRAVRDPESSTGWKIEVGPFPGWATVPEW* |
| Ga0105106_105450591 | 3300009078 | Freshwater Sediment | MPDLSHPPLHTLPHDELLAKLESLTNLRAVRDEKAPSGWTVEVGHVPTW* |
| Ga0105106_108826571 | 3300009078 | Freshwater Sediment | LHSLTNLRAVRDPASDTGWTIELGPFPGWRDAPTW* |
| Ga0102851_100741036 | 3300009091 | Freshwater Wetlands | LARLKSLTNLRAVRDPGSDTGWKIEVGPFPGWAEVPTWNP* |
| Ga0102851_117634551 | 3300009091 | Freshwater Wetlands | LPHDALLAKLKSLTNLRAVRDPASETGWKIEVGPFPGWKDVPTWQP* |
| Ga0102851_119682272 | 3300009091 | Freshwater Wetlands | AKLRSLTNLRAVRDPASSTGWKIEVGPFPGWKNVPTW* |
| Ga0102851_123891171 | 3300009091 | Freshwater Wetlands | KPPLHTLPHDELIAKLETLTNLRAVRDSNSSTGWTIELGPFPGWAVVPEWNP* |
| Ga0102851_125421841 | 3300009091 | Freshwater Wetlands | HDELLAKLDSLTNLRAVRDDSSSTGWTITSGPFPGWATVPEWNP* |
| Ga0102851_125902161 | 3300009091 | Freshwater Wetlands | PPLHTLPHDELLAKLHTLTNLRAVRNASSDTGWTIELGPFPGWANVPTW* |
| Ga0102851_128856901 | 3300009091 | Freshwater Wetlands | LVAKLRSLTNLRAVRDPAAPTGWKIDVGPFPGWKDVPTW* |
| Ga0102851_129228512 | 3300009091 | Freshwater Wetlands | LHTLPHDELLAKLKSLTNLRAVPDPSSDTGWKVEVGPFPGWAEVPTWNP* |
| Ga0102851_134855842 | 3300009091 | Freshwater Wetlands | TLRSLTNLRAAKDPTSSTGWSIEVGPFAGWKDVPEW* |
| Ga0115026_105418483 | 3300009111 | Wetland | LDKPPLHTLPHDELLAKLRSLTNLRAVRDPASDTGWTIELGPFPGWRDVPTW* |
| Ga0115026_105772843 | 3300009111 | Wetland | LHTLPHDELLAKLHSLTNLRAVRNPSSSTGWTIELGPFPGWRDVPDWNP* |
| Ga0115026_109844681 | 3300009111 | Wetland | PHGELLAKLHSLTNLRAVRDPASFTGWTIELGPFPGWREIPTW* |
| Ga0115027_113186621 | 3300009131 | Wetland | HDQLLAKLKSLTNLHAVRDSSSDTGWKIEIGPFRGWAIVPEWQP* |
| Ga0115027_117265461 | 3300009131 | Wetland | MQRTGAALRHDALLATLRALTNLRAVRDKGSDTGWKIEVGPFPGWAKVPMWNP* |
| Ga0105091_102385213 | 3300009146 | Freshwater Sediment | VAKLKSLTNFRATRDPSSPDGWKIEIGPFPGWAVVPDW* |
| Ga0105094_104659271 | 3300009153 | Freshwater Sediment | PDLSKPPLNTLPHDELLAKLKSLTNLRAVRDPSSDTGWKVEVGPFPGWRDVPTW* |
| Ga0105094_107500901 | 3300009153 | Freshwater Sediment | VSLPALTNLRSVRDPASDTGWKVEIGPFPGWRDVPTW* |
| Ga0105102_102868501 | 3300009165 | Freshwater Sediment | ELIAKLQSLTNLRAVRDPESATGWKIEVGPFPGWKNVPAW* |
| Ga0105100_101434701 | 3300009166 | Freshwater Sediment | MPDLSHPPLHTLPHDELLAKLESLTNLRAVRDEKAPSGWTVEVGHVPNW* |
| Ga0113563_116022961 | 3300009167 | Freshwater Wetlands | TLPLDQLLAKLRPLTNLRAVRDPASDTGWKVEIGPFPGWALVPTWQP* |
| Ga0113563_118886461 | 3300009167 | Freshwater Wetlands | PHDELLTRLRSLTNLRAVRDPKSSTGWTVELGPFPGWKNIPAW* |
| Ga0113563_123108202 | 3300009167 | Freshwater Wetlands | HTLPHDELLAKLGLLTNLRAVPDETSDTGWTIEIGPFPGWAEVPEWNP* |
| Ga0105096_102403171 | 3300009170 | Freshwater Sediment | LIAKLRSLTNLRAVRDPDSDTGWKIEIGPFPGWAVVPTWQP* |
| Ga0115028_106299193 | 3300009179 | Wetland | LAKLGSLTNLRAVRDPSSDTGWKIELGPFPGWRDVPTW* |
| Ga0114946_101970422 | 3300009504 | Sediment | RDELVAKLKSLTNLRAVRDPEAEGGWRIDLAPFPGWRDVPTW* |
| Ga0118657_105194712 | 3300009506 | Mangrove Sediment | KLHSLTNLRAVRDEESGTGWKIEVGPFPGWAEVPTW* |
| Ga0118657_122349713 | 3300009506 | Mangrove Sediment | KQTLHALPHDKLVAKLKSLTNLQAVRDPESSTGWSIEVGSFPGWKDVPQW* |
| Ga0130016_109007971 | 3300009868 | Wastewater | DRPPLHSLPHGELIAKLGSLTNLRAVRDPSADTGWTIDVGPFPGWRDVPTW* |
| Ga0118731_1049456032 | 3300010392 | Marine | LAKLRSLTNLRAVRDESSTTGWSIEIGPFPGWEQVPAW* |
| Ga0118731_1100314051 | 3300010392 | Marine | PPFHSLPYEELLAKLHSFTNVRAIEDPTSSTGWQLEVGPFPGWADFPTW* |
| Ga0118731_1121640522 | 3300010392 | Marine | LPELLAKLESLTNLRAVRDVDSSTGWSIEIGPFPGWKEVPTW* |
| Ga0118731_1154860021 | 3300010392 | Marine | PFNLLPYDELLGRLRSLTNLRAVRDPDSSTGWTLELAPFPGWEEVSMW* |
| Ga0136852_105532371 | 3300010412 | Mangrove Sediment | HTLTNLRAVCDDNSSTGWKIEVGPFPGWATLPTW* |
| Ga0136852_116233762 | 3300010412 | Mangrove Sediment | KLIAKLKTLTNLRAVRDEESSTGWSIEVGPFPGWAEVPTW* |
| Ga0118733_1023048631 | 3300010430 | Marine Sediment | LHTLPRDELLTKLRSLTNLQVVKSPTSSTGWSLEIGPFPGWDEVPTW* |
| Ga0118733_1076294852 | 3300010430 | Marine Sediment | LTRLHSMTNVQAVENPDSSTGWKLEVGPFPGWREVPEW* |
| Ga0151668_10555432 | 3300011262 | Marine | SGCGRCPSLDKPPLHTLPLEELLAKLRSLTNLRAVRDPESSTGWSIEIGPFPGWQEVPTW |
| Ga0153915_106023731 | 3300012931 | Freshwater Wetlands | LHTLPHDQLVTKLKSLTNLRAVRDPSSDTGWKLEIGPFPGWTVVPDWQP* |
| Ga0153916_107749283 | 3300012964 | Freshwater Wetlands | LAKLKALTNLRAVRDAASSTGWKIELGPFPGWRNIPAW* |
| Ga0075350_10961951 | 3300014315 | Natural And Restored Wetlands | KLKSLTNLRAVRDPESSTGWKIEVGPFPGWSEVPEW* |
| Ga0075352_11242951 | 3300014324 | Natural And Restored Wetlands | AKLRALTNLRAVPDPSSATGYKIEAGPFPGWASVPEW* |
| Ga0132256_1035999601 | 3300015372 | Arabidopsis Rhizosphere | DPSQPPFQTLPREELLAKLRALTNLRAVPDPASATGYKIEAGTFPGWGSVPEW* |
| Ga0124853_12080863 | 3300024056 | Freshwater Wetlands | MPDLSKPPLHTLPHDELLARLHPLTNLRAVRDDSLSTGWTIDLGPFPGWRDVPTW |
| Ga0124853_15172381 | 3300024056 | Freshwater Wetlands | VLATLRALTNLRAARDPGSDTGWKIDVGPFPGWAKVPTW |
| Ga0224521_10213431 | 3300024233 | Soil | PHDELVATLRALTNLRAVRDPASDSGWKVEIGPFPGWAKVPEWQP |
| Ga0224522_10311592 | 3300024240 | Soil | VVTLRALTNLRAVRDPASDSGWKVEIGPFPGWAKVPEWQP |
| (restricted) Ga0255045_103982831 | 3300024528 | Seawater | LLATLKSLTNVRIVEDPESSTGWKLDYAPFPGWVEVPEW |
| Ga0210141_10293651 | 3300025557 | Natural And Restored Wetlands | NDPTTNLRAVRDEESSTGWTIEIGPFPGWAEVPEW |
| Ga0210122_10893042 | 3300025799 | Natural And Restored Wetlands | MPDVTQPPLHTLPLDELLAKLRELTNVQVVRDEASPTGYKVEIGPFPGWQDTPTWFAPAAEASTE |
| Ga0210129_11308702 | 3300026026 | Natural And Restored Wetlands | LTKRPLHTLPYEPLLAKLKSLTSLRAVCDPSSDTGLKIEIGPFPGRMEASGW |
| Ga0209593_100345195 | 3300027743 | Freshwater Sediment | VAKLKSLTNFRATRDPSSPDGWKIEIGPFPGWAVVPDW |
| Ga0209692_105086092 | 3300027828 | Marine Sediment | LPHDELIAKLKSLTNLRAARDPESSTGWSVEIGPFPGWKEVPTW |
| Ga0209397_101768752 | 3300027871 | Wetland | KLKSLTNLRAVPDPESDTGWKVEIGPFPGWREVPAW |
| (restricted) Ga0255055_107615391 | 3300027881 | Seawater | DKPPLHTLSYDELMAKLRSLTNLRAVPEKDNATGYKVEPGPFPGWREVPTW |
| Ga0209450_102578744 | 3300027885 | Freshwater Lake Sediment | PMPDLSKPPLHTLPLDELLAKLRSLTNLRAVRDPSSDSGWKIELGPFPGWRDVPTW |
| Ga0209253_103018581 | 3300027900 | Freshwater Lake Sediment | PHDELLAKLKSLTNLRAVRDPSSDTGWKVEIGPFPGWAAVPTW |
| Ga0209253_103306382 | 3300027900 | Freshwater Lake Sediment | MPDLSKPPLHALSHGELLAKLKTLTNLRAVRDPSSDTGWKVEIGPFPGWREVPTW |
| Ga0209536_1011861812 | 3300027917 | Marine Sediment | MPEILETRMAKLHSLTNLRAVPDTTSATGYRLEAEEFPGWDPVPTW |
| Ga0209536_1024573202 | 3300027917 | Marine Sediment | PFHTLPHNELIAKLDDLTNLRAVPDPESSTGWKLEVGPFPGWAEVPEW |
| Ga0209391_100758864 | 3300027975 | Freshwater Sediment | DELIAKLKSLTNLRAVRDPESSTGWKIEVGPFPGWATVPEW |
| (restricted) Ga0233414_104635931 | 3300028045 | Seawater | KLHSLTNIRVVRNEESSTGWKVEVGPFPGWAEVPEW |
| Ga0299915_105440484 | 3300030613 | Soil | LHTLTNLRAVRAPAESIGWKIETGPFPGWRDVPTW |
| Ga0299915_108441803 | 3300030613 | Soil | KLRSVTNLRAARDAGSPTGWKIEAGPFAGWEEVPGW |
| Ga0316575_102169592 | 3300031665 | Rhizosphere | EELIAKLHSLTNLRAVRDPDSPTGWKIEVGPFPGWEEVPTWN |
| Ga0316576_100009111 | 3300031727 | Rhizosphere | LHALPHGELVAKLRSLTNIRAVRDPESSTGWTIELEPFPGWDELPTW |
| Ga0316578_102670981 | 3300031728 | Rhizosphere | ELIAKLHSLTNLRAVRDEESSTGWKIEVGPFPGWAEVPTW |
| Ga0316577_108053421 | 3300031733 | Rhizosphere | LHDELIAKLESLTNLRAVRDPESSTGWTIELGPFPGWKTVPSW |
| Ga0315290_102104462 | 3300031834 | Sediment | LATLRALTNMRAVRDPASGSGWKIEIGPFLGWKNVPRW |
| Ga0315290_106267741 | 3300031834 | Sediment | KLVAKLRSLTNLRAARDAASDTGWKIEIGPFPGWAVVPTWEP |
| Ga0315290_114470902 | 3300031834 | Sediment | REELIAKLHSLTNLRAVRDVSSPTGWKIEVGPFPGWKDVPTW |
| Ga0315268_124894152 | 3300032173 | Sediment | DLGKPPLHTVPHDQLVAKLRSLTNLRTARDPASDTGWKIEIGPFPGWATVPEWQP |
| Ga0316198_100219948 | 3300032251 | Sediment | ELLTKLRSLTNIRAVPDPNSFTGWKLEIGPFPGWEEVPTW |
| Ga0316198_102030112 | 3300032251 | Sediment | ELLAKLKSLTNLRAVRDSDSPSGWDIEAGPFPGWKDVPTW |
| Ga0315271_106597902 | 3300032256 | Sediment | LKSLTNLRAARDRASDTGWKVEIGPFPGLAKVPEWQP |
| Ga0316191_101993454 | 3300032258 | Worm Burrow | LAKLRTLTNLRAVEGPDSPTGWKLVVGPFPGWEEVPTW |
| Ga0316190_106594222 | 3300032259 | Worm Burrow | MRCAARLPRDEWLARLRSLTTLRAVRDTGSSTGWSIELGPGPGWTEVPDW |
| Ga0316192_109109411 | 3300032260 | Worm Burrow | WLARLRLLTTLRAVRDSGSSTGWSIELGPCPGWTEVPDW |
| Ga0316194_104284651 | 3300032262 | Sediment | KLKTLTNLRAVRSPDSATGWTIELAPFPGWKDVPTW |
| Ga0316195_104436802 | 3300032263 | Sediment | VHTLPHDELLMKLKSLTNLRAVRVPDTATGWTIELAPFPGWKDVPSW |
| Ga0316195_108031942 | 3300032263 | Sediment | ELLAKLHSLTNLRAVRDPAAADGWKIEVGPFPGWKEVPTW |
| Ga0316197_106213862 | 3300032273 | Sediment | DLDQAPLQTLPYEDLITKLQSLTNLRAVRDEASSTGWSIAIGPFPGWEEVPEW |
| Ga0315275_124415011 | 3300032401 | Sediment | HDELLAKLRSLTNLRAVRDPSSDTGWKVEVGPFPGWGEVPTW |
| Ga0316604_105922912 | 3300033406 | Soil | DQLLAKLKSLTNLRAVRDPSSDTGWKIEIGPFPGWKDVPIW |
| Ga0316604_107896672 | 3300033406 | Soil | LPHSELLAKLHSLTNLRAVRDPASDTGWTIELGPFPGWRTVPTW |
| Ga0316605_110292791 | 3300033408 | Soil | ATLRALTNLRAARDPGSDTGWKIEIGPFPGWAKVPTWNP |
| Ga0316605_115571032 | 3300033408 | Soil | TLPHDELLAKLHSLTNLRAVRDPSSDTGWTIELGPFPGWAEVPEWNP |
| Ga0316605_116732663 | 3300033408 | Soil | LAKLDSLTNLRAVRDDSSSTGWTITFGPFPGWRDVPTW |
| Ga0316605_118268852 | 3300033408 | Soil | LPYDELLAKLRSLTNLRAVRDDSSSNGWTIELGPFPGWRDVPTW |
| Ga0316605_118646501 | 3300033408 | Soil | KTLTNLRAVRDHASSTGWTIELDPFPGWREVPTWR |
| Ga0316605_119738432 | 3300033408 | Soil | AKLRSLTNLRAVRDPASDTGWTIEIGPFPGWRDVPTW |
| Ga0316603_101322542 | 3300033413 | Soil | LHSLTNLRAVRDPSSDTGWTIELGPFPGWRDVPTW |
| Ga0316603_103810831 | 3300033413 | Soil | LPHDELLAKLHSLTNLRAVREPASDTGWKIELGPFPGWRDVPTW |
| Ga0316603_105864684 | 3300033413 | Soil | KLKSLTNLRAVPDPSSDTGWKIEIGPFPGWVEVPEWQP |
| Ga0316603_108613381 | 3300033413 | Soil | LRSLTNLRAVRDPSSPAGWTIELGPFPGWRNVPTW |
| Ga0316603_108777351 | 3300033413 | Soil | LAKLRSLTNLRAVRDPASDTGWKVEVGPFPGWAIVPEWNP |
| Ga0316603_111317743 | 3300033413 | Soil | LHSLTNLRAVRDDSASTGWTIELGPFPGWRDVPTW |
| Ga0316603_114207352 | 3300033413 | Soil | SKPPVHTLPHDELLAKLHSLTNLRAVRDPSSPTGWTIELGPFPGWRNVPTW |
| Ga0316603_117652661 | 3300033413 | Soil | TLPHDELLAKLHSLTNLRAVRDPSSDTGWTIELGPFPGWRDVPTW |
| Ga0316619_107554142 | 3300033414 | Soil | SLTNLRAVRDPASDTGYSIELDPFPGWAVVPEWNP |
| Ga0316622_1000942241 | 3300033416 | Soil | HTLPHDELLAKLKSLTNLRAVRDPASPGGWKIDLDPFPGWAEVPAW |
| Ga0316622_1002883463 | 3300033416 | Soil | LAKLDSLTNLRAVRDPSSDTGWTIELGPFPGWRDVPTW |
| Ga0316622_1007953962 | 3300033416 | Soil | LPHDELLAKLGLLTNLRAVPDETSDTGWTIEIGPFPGWAEVPEWNP |
| Ga0316622_1011194391 | 3300033416 | Soil | DELVAKLKGLTNLRAVRDPKSSTGWTVELGPFPGWKNIPAW |
| Ga0316622_1013068121 | 3300033416 | Soil | KPPLHTLPREALFATLHSLTNLRAVRDASSPAGWKVEVAPFPGWRDVPTW |
| Ga0316622_1018807302 | 3300033416 | Soil | KPPLHTLPHGELLAKLRSLTNLRAVRDPSSSTGWTIELGPFPGWRNVPTW |
| Ga0316622_1022135041 | 3300033416 | Soil | KLKSLTNLRAVRDANSSTGWTVELGPFPGWKDIPSW |
| Ga0316622_1026915161 | 3300033416 | Soil | HTLPHDELIAKLNTLTNLRAVRDPTSDTGWTIEIGPFPGWAEVPTW |
| Ga0316622_1028785262 | 3300033416 | Soil | MQRTGAALPHDALLATLRALTNLRAARDPGSDTGWKIEIGPFPGWAKVPTWNP |
| Ga0316625_1011126441 | 3300033418 | Soil | LGSLTNLRAVRDPSSDTGWTIELGPFPGWANVPTW |
| Ga0316625_1013611351 | 3300033418 | Soil | MPDLTKPPLHALPYAELLAKLRSLTNLRAVRDPSSDAGWTIELVPFPGWRDVPTW |
| Ga0316625_1025872782 | 3300033418 | Soil | KLRSLTNLRAVRDPGSDTGWKLEVGPFPGWAVVPRWH |
| Ga0316601_1003418023 | 3300033419 | Soil | LRSLTNLRAVRDTSSSTGWTIELGPFPGWRDVPTW |
| Ga0316601_1014713753 | 3300033419 | Soil | PPLHTLPHDELIAKLHSLTNLRAVRDPAAPTGWTIELGPFPGWRDIPTW |
| Ga0316193_103552203 | 3300033429 | Sediment | PHDELITKLESLTNLRAVRDPESPTGWTIELGPFPGWKDVPTW |
| Ga0316193_105219581 | 3300033429 | Sediment | KLDTHTNIRMVRDEDSSTGWTQEVGPFQGWAEVPEW |
| Ga0316193_107975801 | 3300033429 | Sediment | LPRNELVAKLKSLTNLRAVRDEISSTGWSIEIGHLPRWEELPEW |
| Ga0316613_102622791 | 3300033434 | Soil | LTKPPLHTLPHDELIAKLHSLTNLRAVRDDSASTGWTIELGPFPGWRDVPTW |
| Ga0316620_113633201 | 3300033480 | Soil | RSLTNLRAVRDPASDTGWKIEVGPFPGWAIVPEWNP |
| Ga0316600_104952473 | 3300033481 | Soil | AKLHSLTNLRAVRDPESSTGWTIELGPFPGWATVPTW |
| Ga0316629_113043881 | 3300033483 | Soil | LPHDELLAKLHSLTNLRAVRDPSSPTGWTIELGPFPGWRDVPTW |
| Ga0316629_118407441 | 3300033483 | Soil | PDLSKPPFHTLPHDELLAKLHSLTNLRAVRDPSSPTGWRIELGPFPGWRNVPSW |
| Ga0316626_102246741 | 3300033485 | Soil | MPDLSKPPLHTLPHGELIAKLGSLTNLRAVRDPASDTGWTIELGPFPGWRDVPTW |
| Ga0316626_106368903 | 3300033485 | Soil | ELLAKLHSLTNLRAVRDPAAPSGWTIELGPFPGWRDVPTW |
| Ga0316626_106383361 | 3300033485 | Soil | HTLPHEELLAKLKSLTNLRAVRDPGSDTGWKIEIGPFPGWAEVPEW |
| Ga0316626_107115893 | 3300033485 | Soil | KLKSLTNLRAVPDPTSDTGWNVEIGPFPGWAEVPEWNP |
| Ga0316626_113160012 | 3300033485 | Soil | QLLTKLKSLTNLRAVRDPSSDTGWKIEFGPFPGWKDVPTW |
| Ga0316626_117422391 | 3300033485 | Soil | LLAKLHSLTNLRAVRDPSSDTGWTIELGPFPGWAEVPEWNP |
| Ga0316626_119783942 | 3300033485 | Soil | LSKPPLRTLPHGELLAKLDSLTNLRAVRDRAAPTGWTIETAPFPGWRDVPTW |
| Ga0316621_102929204 | 3300033488 | Soil | KPPLHTLPYDELLAKLRSLTNLRAVRDPSSPTGWTIELGPFPGWRDVPTW |
| Ga0316621_106263941 | 3300033488 | Soil | DLTKPPLHTLPHDDLLAKLHSLTNLRAVRNPSSSTGWTIELGPFPGWRDVPTW |
| Ga0316621_110907622 | 3300033488 | Soil | TLHSLTNLRAVRDPESSTGWTIELGPFPGWRDVPTW |
| Ga0316631_100758901 | 3300033493 | Soil | LKPLTNLRAVRDPSSDTGWKIEFGPFPGWKDVPTW |
| Ga0316628_1009307701 | 3300033513 | Soil | PPLHTLPREELIAKLHSLTNLRAVRDASSPTGWKVDVGPFPGRKNVPTW |
| Ga0316628_1023191182 | 3300033513 | Soil | KLTSLTNLRAVRDAKAATGWSIELGPFPGWKDVPTW |
| Ga0316628_1037084962 | 3300033513 | Soil | SLTNLRAVPDPASDTGWKVEVGPFPGWATVPEWQP |
| Ga0316616_1002454381 | 3300033521 | Soil | LHTLPHDELLAKLKSLTNLRAVRDPASDTGWKIEIGPFPGWATVPEWQP |
| Ga0316616_1032276342 | 3300033521 | Soil | HSLTNLRAVRDPSSDTGWTIELGPFPGWAEVPEWNP |
| Ga0316616_1044061391 | 3300033521 | Soil | PLHTLPYDELLAKLHSLTNLRAVRDPASDTGWTIELGPFPGWRDVPTW |
| Ga0316616_1047528491 | 3300033521 | Soil | HTLPHDELLAKLKSLTNLRAVRDPASDTGWKIEVGPFPGWATVPEWQP |
| Ga0316617_1009583411 | 3300033557 | Soil | TLRALTNLRAVRDPGSDTGWKIEVGPFPGWAKVPTWNP |
| Ga0316617_1013680302 | 3300033557 | Soil | LPREALFATLHSLTNLRAVRDASSPTGWKIDIAPFPGWRDVPAW |
| Ga0316617_1020681861 | 3300033557 | Soil | LHTLPHDELLAKLGSLTNLRAVRDPSSDTGWTIELGPFPGWAEVPAW |
| Ga0373889_088241_359_511 | 3300034052 | Sediment Slurry | KPPLHTLPRETLLATLDRLTNLRVAADAATPTGYKIEIGPFPGWQDVPTW |
| Ga0373911_085263_29_196 | 3300034081 | Sediment Slurry | MPDLSRPPLHVLPIDALLAKLRSLTNLRAVRDPASSAGWRIEIGPFPGWRDVPTW |
| ⦗Top⦘ |