NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F035813

Metagenome / Metatranscriptome Family F035813

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F035813
Family Type Metagenome / Metatranscriptome
Number of Sequences 171
Average Sequence Length 44 residues
Representative Sequence TAAEAKRLMRSVLDHYLEERRIFSRRVVQDLQALDEEAEPK
Number of Associated Samples 148
Number of Associated Scaffolds 171

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.60 %
% of genes near scaffold ends (potentially truncated) 97.08 %
% of genes from short scaffolds (< 2000 bps) 92.98 %
Associated GOLD sequencing projects 136
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (63.743 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen
(11.111 % of family members)
Environment Ontology (ENVO) Unclassified
(42.105 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(48.538 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 52.17%    β-sheet: 0.00%    Coil/Unstructured: 47.83%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 171 Family Scaffolds
PF03740PdxJ 86.55
PF00933Glyco_hydro_3 11.11
PF07311Dodecin 1.17
PF01425Amidase 0.58
PF00155Aminotran_1_2 0.58

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 171 Family Scaffolds
COG0854Pyridoxine 5'-phosphate synthase PdxJCoenzyme transport and metabolism [H] 86.55
COG1472Periplasmic beta-glucosidase and related glycosidasesCarbohydrate transport and metabolism [G] 11.11
COG3360Flavin-binding protein dodecinGeneral function prediction only [R] 1.17
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.58


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A63.74 %
All OrganismsrootAll Organisms36.26 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459019|G14TP7Y01A5ZPNNot Available613Open in IMG/M
3300000890|JGI11643J12802_11043688All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria566Open in IMG/M
3300000956|JGI10216J12902_103715043All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae1116Open in IMG/M
3300003861|Ga0031654_10159076Not Available641Open in IMG/M
3300005180|Ga0066685_10511539All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria831Open in IMG/M
3300005186|Ga0066676_10817427All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria630Open in IMG/M
3300005328|Ga0070676_10355294All Organisms → cellular organisms → Bacteria → Proteobacteria1008Open in IMG/M
3300005336|Ga0070680_100087665All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2574Open in IMG/M
3300005340|Ga0070689_100283778All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1374Open in IMG/M
3300005347|Ga0070668_100151531All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1875Open in IMG/M
3300005354|Ga0070675_100383278All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1252Open in IMG/M
3300005438|Ga0070701_10116737All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae1498Open in IMG/M
3300005468|Ga0070707_100930417All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300005544|Ga0070686_101744769All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria529Open in IMG/M
3300005546|Ga0070696_100383347All Organisms → cellular organisms → Bacteria → Proteobacteria1096Open in IMG/M
3300005548|Ga0070665_101342870Not Available724Open in IMG/M
3300005559|Ga0066700_10842573Not Available614Open in IMG/M
3300005563|Ga0068855_100323694All Organisms → cellular organisms → Bacteria → Proteobacteria1703Open in IMG/M
3300005614|Ga0068856_101403633All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae713Open in IMG/M
3300005615|Ga0070702_100755814All Organisms → cellular organisms → Bacteria → Proteobacteria747Open in IMG/M
3300005616|Ga0068852_100224187All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1789Open in IMG/M
3300005616|Ga0068852_101930489Not Available613Open in IMG/M
3300005618|Ga0068864_100183746All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1913Open in IMG/M
3300005618|Ga0068864_102025582All Organisms → cellular organisms → Bacteria → Proteobacteria582Open in IMG/M
3300005764|Ga0066903_101037675All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae1504Open in IMG/M
3300005836|Ga0074470_11183426All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1177Open in IMG/M
3300005841|Ga0068863_101751618All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria631Open in IMG/M
3300005842|Ga0068858_100618724All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae1051Open in IMG/M
3300006032|Ga0066696_10058441All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2193Open in IMG/M
3300006237|Ga0097621_100350830All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1312Open in IMG/M
3300006237|Ga0097621_101130755Not Available736Open in IMG/M
3300006604|Ga0074060_11623020All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales683Open in IMG/M
3300006871|Ga0075434_102025084All Organisms → cellular organisms → Bacteria → Proteobacteria581Open in IMG/M
3300006904|Ga0075424_101980930All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae615Open in IMG/M
3300007799|Ga0105049_10526031Not Available875Open in IMG/M
3300009081|Ga0105098_10733553Not Available527Open in IMG/M
3300009091|Ga0102851_10371477All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae1428Open in IMG/M
3300009093|Ga0105240_11830155Not Available632Open in IMG/M
3300009098|Ga0105245_11149489Not Available823Open in IMG/M
3300009098|Ga0105245_13029713Not Available521Open in IMG/M
3300009100|Ga0075418_11765140Not Available673Open in IMG/M
3300009100|Ga0075418_12567603Not Available556Open in IMG/M
3300009101|Ga0105247_10559355Not Available842Open in IMG/M
3300009148|Ga0105243_10282692All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae1495Open in IMG/M
3300009156|Ga0111538_13499650Not Available545Open in IMG/M
3300009162|Ga0075423_11316442Not Available772Open in IMG/M
3300009171|Ga0105101_10068493All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1723Open in IMG/M
3300009177|Ga0105248_13349452Not Available509Open in IMG/M
3300009545|Ga0105237_11549094Not Available670Open in IMG/M
3300010360|Ga0126372_13014109Not Available522Open in IMG/M
3300010361|Ga0126378_11831948Not Available690Open in IMG/M
3300010371|Ga0134125_10191920All Organisms → cellular organisms → Bacteria → Proteobacteria2274Open in IMG/M
3300010373|Ga0134128_12822843Not Available535Open in IMG/M
3300010375|Ga0105239_12171776Not Available645Open in IMG/M
3300010401|Ga0134121_12675593Not Available543Open in IMG/M
3300012198|Ga0137364_10686883Not Available772Open in IMG/M
3300012519|Ga0157352_1063752Not Available580Open in IMG/M
3300012914|Ga0157297_10388946Not Available555Open in IMG/M
3300012957|Ga0164303_11317985Not Available535Open in IMG/M
3300012971|Ga0126369_10517984All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1253Open in IMG/M
3300012985|Ga0164308_10144609All Organisms → cellular organisms → Bacteria1747Open in IMG/M
3300013104|Ga0157370_10008140All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria11344Open in IMG/M
3300013296|Ga0157374_11662232Not Available663Open in IMG/M
3300013307|Ga0157372_11304601Not Available838Open in IMG/M
3300014166|Ga0134079_10186159Not Available862Open in IMG/M
3300014968|Ga0157379_12165651Not Available552Open in IMG/M
3300015372|Ga0132256_100430919All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1424Open in IMG/M
3300015372|Ga0132256_101995703Not Available687Open in IMG/M
3300015373|Ga0132257_101991529Not Available749Open in IMG/M
3300015373|Ga0132257_104260696Not Available520Open in IMG/M
3300015373|Ga0132257_104556618Not Available504Open in IMG/M
3300018058|Ga0187766_11313777Not Available528Open in IMG/M
3300018075|Ga0184632_10400926Not Available576Open in IMG/M
3300018078|Ga0184612_10263330Not Available889Open in IMG/M
3300018429|Ga0190272_10404188All Organisms → cellular organisms → Bacteria → Proteobacteria1116Open in IMG/M
3300018476|Ga0190274_13226616Not Available549Open in IMG/M
3300018481|Ga0190271_10271866All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1740Open in IMG/M
3300018920|Ga0190273_12284837Not Available511Open in IMG/M
3300019356|Ga0173481_10675215Not Available554Open in IMG/M
3300025321|Ga0207656_10192211Not Available983Open in IMG/M
3300025909|Ga0207705_11306443Not Available554Open in IMG/M
3300025914|Ga0207671_11070107Not Available634Open in IMG/M
3300025917|Ga0207660_10160340All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis1735Open in IMG/M
3300025919|Ga0207657_10210166All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1562Open in IMG/M
3300025920|Ga0207649_10445176Not Available977Open in IMG/M
3300025921|Ga0207652_11335816Not Available620Open in IMG/M
3300025926|Ga0207659_11710650Not Available536Open in IMG/M
3300025931|Ga0207644_10148123All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1814Open in IMG/M
3300025932|Ga0207690_10076238Not Available2328Open in IMG/M
3300025934|Ga0207686_10240841All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1316Open in IMG/M
3300025935|Ga0207709_10196872Not Available1436Open in IMG/M
3300025936|Ga0207670_11876238Not Available510Open in IMG/M
3300025937|Ga0207669_10564262Not Available920Open in IMG/M
3300025941|Ga0207711_10453215All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales1194Open in IMG/M
3300025941|Ga0207711_11167691Not Available711Open in IMG/M
3300025945|Ga0207679_10977067Not Available776Open in IMG/M
3300025945|Ga0207679_10979546Not Available775Open in IMG/M
3300025960|Ga0207651_11222639Not Available675Open in IMG/M
3300025981|Ga0207640_10016554All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria4292Open in IMG/M
3300025981|Ga0207640_10473451All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1037Open in IMG/M
3300026068|Ga0208657_1011291Not Available826Open in IMG/M
3300026078|Ga0207702_10218319All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1776Open in IMG/M
3300026088|Ga0207641_12635246Not Available500Open in IMG/M
3300026095|Ga0207676_11271220Not Available730Open in IMG/M
3300026095|Ga0207676_11658886Not Available637Open in IMG/M
3300026142|Ga0207698_10885366Not Available899Open in IMG/M
3300026142|Ga0207698_11510257Not Available687Open in IMG/M
3300027617|Ga0210002_1077213Not Available591Open in IMG/M
3300027715|Ga0208665_10084931Not Available962Open in IMG/M
3300027787|Ga0209074_10487402Not Available533Open in IMG/M
3300027877|Ga0209293_10462239Not Available663Open in IMG/M
3300027909|Ga0209382_11785328Not Available599Open in IMG/M
3300027915|Ga0209069_10121118Not Available1278Open in IMG/M
3300027955|Ga0209078_1081326Not Available939Open in IMG/M
3300028379|Ga0268266_11998229Not Available553Open in IMG/M
3300028381|Ga0268264_10441244All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1259Open in IMG/M
3300028596|Ga0247821_10820255Not Available614Open in IMG/M
3300028596|Ga0247821_10853351Not Available603Open in IMG/M
3300028736|Ga0302214_1051424Not Available845Open in IMG/M
3300028741|Ga0302256_10130273Not Available674Open in IMG/M
3300028743|Ga0302262_10196210Not Available689Open in IMG/M
3300028855|Ga0302257_1112055Not Available608Open in IMG/M
3300028856|Ga0302295_1009315All Organisms → cellular organisms → Bacteria1735Open in IMG/M
3300029923|Ga0311347_11021651Not Available502Open in IMG/M
3300029987|Ga0311334_11104726All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes662Open in IMG/M
3300030000|Ga0311337_10826260Not Available804Open in IMG/M
3300030002|Ga0311350_10238237All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1620Open in IMG/M
(restricted) 3300031150|Ga0255311_1096553Not Available638Open in IMG/M
3300031521|Ga0311364_10141069Not Available2502Open in IMG/M
3300031538|Ga0310888_10696703Not Available623Open in IMG/M
3300031547|Ga0310887_10441630Not Available774Open in IMG/M
3300031716|Ga0310813_10732169Not Available885Open in IMG/M
3300031722|Ga0311351_10595277All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300031722|Ga0311351_10731469Not Available754Open in IMG/M
3300031722|Ga0311351_11339013Not Available550Open in IMG/M
3300031726|Ga0302321_100350645All Organisms → cellular organisms → Bacteria1594Open in IMG/M
3300031726|Ga0302321_101001052Not Available951Open in IMG/M
3300031726|Ga0302321_103006100Not Available550Open in IMG/M
3300031726|Ga0302321_103602307All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes503Open in IMG/M
3300031793|Ga0318548_10140086All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales1176Open in IMG/M
3300031820|Ga0307473_10142979All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1349Open in IMG/M
3300031831|Ga0318564_10086359All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1388Open in IMG/M
3300031847|Ga0310907_10033820All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1866Open in IMG/M
3300031847|Ga0310907_10890828Not Available503Open in IMG/M
3300031901|Ga0307406_10379024All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1114Open in IMG/M
3300031913|Ga0310891_10150105Not Available755Open in IMG/M
3300031918|Ga0311367_10506294Not Available1238Open in IMG/M
3300031943|Ga0310885_10274180Not Available863Open in IMG/M
3300031995|Ga0307409_100242723All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1641Open in IMG/M
3300031996|Ga0308176_12326777Not Available572Open in IMG/M
3300032012|Ga0310902_10153227All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales1307Open in IMG/M
3300032013|Ga0310906_10996212Not Available602Open in IMG/M
3300032177|Ga0315276_11157421Not Available817Open in IMG/M
3300032256|Ga0315271_10357219All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1215Open in IMG/M
3300032275|Ga0315270_11020130Not Available548Open in IMG/M
3300032276|Ga0316188_10599831Not Available596Open in IMG/M
3300033408|Ga0316605_10867658Not Available861Open in IMG/M
3300033408|Ga0316605_11385390Not Available681Open in IMG/M
3300033412|Ga0310810_11307739Not Available570Open in IMG/M
3300033413|Ga0316603_11302534Not Available688Open in IMG/M
3300033419|Ga0316601_100387005All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1312Open in IMG/M
3300033488|Ga0316621_10790857Not Available693Open in IMG/M
3300033513|Ga0316628_102385825Not Available699Open in IMG/M
3300034149|Ga0364929_0219475Not Available633Open in IMG/M
3300034157|Ga0370506_113137Not Available612Open in IMG/M
3300034157|Ga0370506_172525Not Available511Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen11.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.85%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere5.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.09%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.09%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.51%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.51%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.34%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.34%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.34%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.75%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.75%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.75%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.75%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.75%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.75%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.75%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.17%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.17%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.17%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.17%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.17%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.17%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.17%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.58%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.58%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.58%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.58%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow0.58%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.58%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.58%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.58%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.58%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.58%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.58%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.58%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.58%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.58%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.58%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.58%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.58%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.58%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.58%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.58%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459019Litter degradation MG4EngineeredOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003861Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CREnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007799Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009171Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012519Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026068Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027617Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027715Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027877Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027955Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028596Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14EnvironmentalOpen in IMG/M
3300028736Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_3EnvironmentalOpen in IMG/M
3300028741Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_4EnvironmentalOpen in IMG/M
3300028743Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4EnvironmentalOpen in IMG/M
3300028855Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_4EnvironmentalOpen in IMG/M
3300028856Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_4EnvironmentalOpen in IMG/M
3300029923II_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030002II_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300031150 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4EnvironmentalOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031722II_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032276Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1EnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033488Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_CEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M
3300034157Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_18EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
4MG_039054702170459019Switchgrass, Maize And Mischanthus LitterAEAKRLMRGILDHYLEQRRIFSRRVVQDLAALEDDERK
JGI11643J12802_1104368813300000890SoilASAHYPDADVAAEAKRLMRSVLDHYLEARGIESRRVVQDLAALEDDKEMR*
JGI10214J12806_1250598523300000891SoilTLIALATERYPDSDTATEAKRLMRGVLDHYLEERRIFSRRVVQDLAALEDDK*
JGI10216J12902_10371504313300000956SoilAEAKRLMRSVLDHYLEERRIFSRRVVQDLQALDEEAESK*
Ga0031654_1015907623300003861Freshwater Lake SedimentTAAEAKHLMREVLDHYLEERRIFSRRVAQDLQAIDEESEST*
Ga0062592_10132778723300004480SoilLIALAEQQFNDVETAGEAKRLMRSVLDHHLEQRGVESRRVVQDLQALDDEGERGD*
Ga0066685_1051153913300005180SoilTAAEAKRLMRSVLDHYLEERRIFSRRVVQDLQALDEEAEPK*
Ga0066676_1081742713300005186SoilANERYPDPQTATEAKRLMRSVLDHYLEERRIFSRRVVQDLQALDEEAEPK*
Ga0070676_1035529413300005328Miscanthus RhizosphereDTATEAKRLMRGVLDHYLEERRIFSRRVVQDLAALEDDK*
Ga0070680_10008766553300005336Corn RhizosphereSERYTDADVAAEAKRLMRGVLDHYLEARRIFSRRVVQDLAALEDDERN*
Ga0070689_10028377833300005340Switchgrass RhizosphereSFPDAESAADAKRLMRDVLDHHLDERRIVSRRVVRDLVSLEEGME*
Ga0070668_10015153133300005347Switchgrass RhizospherePDADIAAEAKRLMRDVLDHYLEERRIVSRRVVRDLVNLEEEGS*
Ga0070675_10038327833300005354Miscanthus RhizosphereALAANAFPDSEVAAEAKRLMREVLDHHLEQRHIVSRRVVRDLMALDE*
Ga0070701_1011673713300005438Corn, Switchgrass And Miscanthus RhizosphereAANAMPDAETAAEAKRLMREILDHYLEERRIFSRRVVQDLQAIDEEST*
Ga0070707_10093041713300005468Corn, Switchgrass And Miscanthus RhizosphereTAAEAKRLMREVLDHYLEQRGVESRRVVQDLQALEDEANPTHD*
Ga0070686_10174476913300005544Switchgrass RhizosphereNAMPDAETAAEAKRLMREILDHYLEERRIFSRRVVQDLQAIDEEST*
Ga0070696_10038334723300005546Corn, Switchgrass And Miscanthus RhizosphereERYPDSDTATEAKRLMRGVLDHYLEERRIFSRRVVQDLAALEDDK*
Ga0070665_10134287023300005548Switchgrass RhizosphereAAEAKRLMRDVLDHYLEERRIVSRRVVRDLVNLEEEGS*
Ga0066700_1084257313300005559SoilKRLMRSVLDHYLEERRIFSRRVVQDLQALDEETESK*
Ga0068855_10032369433300005563Corn RhizosphereEAKRLMRGVLDHYLDERRIFSRRVVQDLAALEDER*
Ga0068856_10140363323300005614Corn RhizosphereGRFAGAATLGEAKRLMRAVLDHYLESRRLASRRIVQDLQALEGEEES*
Ga0070702_10075581423300005615Corn, Switchgrass And Miscanthus RhizosphereDGDVAAEAKRLMRGVLDHYLDERRIFSRRVVQDLAALEDDR*
Ga0068852_10022418733300005616Corn RhizosphereAEVAAEAKRLMREVLDHYLEARHIFSRRVVRDLQALDEEGPAA*
Ga0068852_10193048923300005616Corn RhizosphereAEARYPDAETAGEAKRLMRLVLDHYLEERRIFSRRVVQDLQALDDERDPP*
Ga0068864_10018374613300005618Switchgrass RhizosphereALAAGSFPDAESAADAKRLMRDVLDHHLDERRIVSRRVVRDLVSLEEGME*
Ga0068864_10202558213300005618Switchgrass RhizosphereDSEAAAEAKRLMRGVLDHYLEERRIFSRRVVQDLAALEDDK*
Ga0066903_10103767513300005764Tropical Forest SoilEAKRLMRDVLDHYLEHRRIFSRRIVQDLAALDDEPTEAR*
Ga0074470_1118342633300005836Sediment (Intertidal)TAAEAKRLMREVLDHYLEQRGVESRRVVQDLQALEDGAKAPND*
Ga0068863_10175161823300005841Switchgrass RhizosphereATEHYPDADVAGEAKRLMRRVLDHYLDERRIFSRRVVQDLAALDDEDDGR*
Ga0068858_10061872413300005842Switchgrass RhizospherePDARTAGEAKQLMRTILDHYLEERKIFSRRVVRDLQALDEEGEAS*
Ga0066696_1005844113300006032SoilAQTAAEAKRLMRSVLEHYLEQRRIFSRRVVQDLAALDDDGDAK*
Ga0097621_10035083033300006237Miscanthus RhizosphereDARTAGEAKQLMRTILDHYLEERKIFSRRVVRDLQALDEEGEAS*
Ga0097621_10113075513300006237Miscanthus RhizosphereKRLMRDVLDHHLDERRIVSRRVVRDLVSLEEGME*
Ga0074060_1162302023300006604SoilPDAATAAEAKRLMREVLDHYLEERRIFSRRVVQDLQLIDEESEP*
Ga0075434_10202508413300006871Populus RhizosphereAAEAKRLMREVLDHHLEERRIVSRRVVRDLMLLEEDKP*
Ga0075424_10198093013300006904Populus RhizosphereAAEAKRLMRSVLDHYLEARGIESRRVVQDLAALEDDKEMR*
Ga0105049_1052603123300007799FreshwaterTLDFSDPDSALEAKRLMREVLDHYLDTRQIFSRRVVRDLQAMDGEGHDS*
Ga0105098_1073355313300009081Freshwater SedimentAEAKRLMRDVLDHYLDSRRIESRRIVADLRSLDGEP*
Ga0102851_1037147713300009091Freshwater WetlandsAKRLMREVLDHHLEERRIFSRRVVRDLMALDEEGTAT*
Ga0105240_1183015523300009093Corn RhizosphereKRLMRGVLDHYLEARRIFSRRVVQDLAALEDDERN*
Ga0105245_1114948923300009098Miscanthus RhizosphereAKRLMREILDHYLEERRIFSRRVVQDLQAIDEEST*
Ga0105245_1302971313300009098Miscanthus RhizosphereAAVAKQLMRTVLDHYLEERRIFSRRVVRDLQALDEESEAP*
Ga0075418_1176514013300009100Populus RhizosphereSEHYADARVAAEARELMRSVLDHYLEERRIFSRRVVRDLQALDEESETP*
Ga0075418_1256760323300009100Populus RhizosphereALAAGSFPDAESAADAKRLMRDVLDHHLEERRIVSRRVVRDLVSLEEENP*
Ga0105247_1055935523300009101Switchgrass RhizosphereSDTATEAKRLMRCVLDHYLEERRIFSRRVVQDLAALEDDK*
Ga0105243_1028269233300009148Miscanthus RhizosphereRWAPEAKQLMRTVLDHYLEERRIFSRRVVQDLQALDEESETP*
Ga0111538_1349965013300009156Populus RhizosphereKRLMRSVLDHYLEARGIESRRVVQDLAALEDDKEMR*
Ga0075423_1131644223300009162Populus RhizosphereLALAARRFPDAEVAAEAKRLMREVLDHYLEARHIFSRRVVRDLQALDEEGPAA*
Ga0105101_1006849333300009171Freshwater SedimentLAESRYPDAETAAEAKRLMRDVLDHYLDSRRIESRRIVADLQALDGER*
Ga0105248_1334945213300009177Switchgrass RhizosphereYADARVAAEAKQLMRTVLDHYLEERRIFSRRVVQDLQALDEESETP*
Ga0105237_1154909413300009545Corn RhizosphereTEAKRLMRGVLDHYLEERRIFSRRVVQDLAALEDDK*
Ga0105249_1200322513300009553Switchgrass RhizosphereLLALAEQRYPDAATAAEAKRLMREVLDHYLEQRGVESRRVVQDLQALEDEVGTPHD*
Ga0126372_1301410913300010360Tropical Forest SoilEAKRLMREVLDYYLEQRGVESRRVVQDLQALEDETGTPDD*
Ga0126378_1183194823300010361Tropical Forest SoilPDAAAEAKRLMREVLDYYLERRTIVSRRVVRDLQAMEEEGEGDTQ*
Ga0134125_1019192043300010371Terrestrial SoilAEGRFAGAATLGEAKRLMRAVLDHYLESRRLASRRIVQDLQALEGEEES*
Ga0134128_1282284313300010373Terrestrial SoilPDAETAAEAKRLMRLVLDHYLEARRIFSRRVVQDLQALDDERDIP*
Ga0105239_1217177613300010375Corn RhizosphereLATAHYPDAEVAAEAKRLMRSVLDHYLEARGIESRRVVQDLAALEDDKEMR*
Ga0134121_1267559323300010401Terrestrial SoilAEAKRLMREVLDHHLEERRIVSRRVVRDLMALDE*
Ga0137364_1068688323300012198Vadose Zone SoilLMRSVLDHYLEERRIFSRRVVQDLQALDEEAEPK*
Ga0157352_106375213300012519Unplanted SoilATEQYPDGDVAAEAKRLMRSVLDHYLDERRIFSRRVVQDLAALEDDR*
Ga0157297_1038894613300012914SoilRFDDASTAAEAKRLMREVIDHHLDARTIQSRKVVRDLWALEEESNE*
Ga0164303_1131798513300012957SoilHYPDAEAAAEAKRLMRSVLDHYLEARGIESRRVVQDLAALEDDKEMR*
Ga0126369_1051798413300012971Tropical Forest SoilMREVLDHYLEQRGVESRRVVQDLQALEDETGTPDD*
Ga0164308_1014460933300012985SoilDAEVASEAKRLMRGVLDHYLEERRIFSRRVVQDLAALDDDREP*
Ga0157370_1000814013300013104Corn RhizosphereRLMRLVLDHYLEARRIFSRRVVQDLQALDDERDIP*
Ga0157374_1166223223300013296Miscanthus RhizosphereASERYTDADLAHEPKRLMRGVLDHYLEARRIFSRRVVQDLAALEDDERK*
Ga0157372_1130460123300013307Corn RhizosphereLIALATERYPDSEAAAEAKRLMRGVLDHYLEERRIFSRRVVQDLAALEDDK*
Ga0157375_1132407223300013308Miscanthus RhizosphereRGATLLALAANAFPDSEVAAEAKRLMREVLDHHLEQRHIVSRRVVRDLMALDE*
Ga0134079_1018615923300014166Grasslands SoilLANERYPDAQTAAEAKRLMRSVLDHYLEQRRIFSRRVVQDLAALDDDGEAK*
Ga0157379_1216565123300014968Switchgrass RhizosphereLIALATEHYPDADVAGEAKRLMRRVLDHYLDERRIFSRRVVQDLAALEDDR*
Ga0132256_10043091933300015372Arabidopsis RhizosphereQGRYPDARVAAEAKLLMRTVLDHYLEERRIFSRRVVRDLAALEDDGELP*
Ga0132256_10199570313300015372Arabidopsis RhizosphereDADIAAEAKRLMRDVLDHYLEERRIVSRRVVRDLVNLEEEGS*
Ga0132257_10199152923300015373Arabidopsis RhizosphereLAARRCDDPATALEAKRLMRDVLDHYLEQRGVQSRRVVQDLQALEDEP*
Ga0132257_10426069613300015373Arabidopsis RhizosphereMRAVLDHYLEQRGVESRRLVQDLQAIDHDEQDTR*
Ga0132257_10455661813300015373Arabidopsis RhizosphereAQAKRLMRDVLDHHLEERRIVSRRVVRDLVSLEEEPE*
Ga0187766_1131377723300018058Tropical PeatlandMTEAAAEAKRLMREVLDHYLERRTIASRRVVRDLLAID
Ga0184632_1040092613300018075Groundwater SedimentAEAKRLMRDVLDHYLEQRGVESRRVVQDLEALEDEVGTPHD
Ga0184612_1026333023300018078Groundwater SedimentLAARTFPDAEVAAEAKRLMREVLDHYLEARHIFSRRVVRDLQALDEEGPAA
Ga0190272_1040418833300018429SoilQRYPDSETAAEAKRLMRDVLDHYLESRRIESRRIAADLQALDDESE
Ga0190274_1322661613300018476SoilAKQLMRTVLDHYLEERRIFSRRVVQDLQALDEESETP
Ga0190271_1027186633300018481SoilRGATLIALAERRFADPEVAAEAKRLMREVIDHYLEARRIESRRIVADLIAIDETSRPE
Ga0190273_1228483723300018920SoilEAKRLMRDVLDHYLESRRIESRRIAADLQSLDDESE
Ga0173481_1067521513300019356SoilNAHYPDADVAAEAKRLMRSVLDHYLEARGIESRRVVQDLAALEDDKEMR
Ga0207656_1019221113300025321Corn RhizosphereAGSFPDADIAAEAKRLMRDVLDHYLEERRIVSRRVVRDLVNLEEEGS
Ga0207705_1130644313300025909Corn RhizosphereDVAAEAKRLMRGVLDHYLEARRIFSRRVVQDLAALEDDERN
Ga0207671_1107010723300025914Corn RhizosphereTAAEAKRLMRLVLDHYLEARRIFSRRVVQDLQALDDERDIP
Ga0207660_1016034033300025917Corn RhizosphereALASERYTDADVAAEAKRLMRGVLDHYLEARRIFSRRVVQDLAALEDDERN
Ga0207657_1021016613300025919Corn RhizosphereALIALAEARYPHAETAGEAKRLMRLVLDHYLEERRIFSRRVVQDLQALDDERDPP
Ga0207649_1044517623300025920Corn RhizosphereDAETAGEAKRLMRLVLDHYLEERRIFSRRVVQDLQALDDERDPP
Ga0207652_1133581613300025921Corn RhizosphereKRLMRQVLDHYLEARAIVSRRIVQDLIALDDERDAT
Ga0207659_1171065023300025926Miscanthus RhizosphereKRLMREVLDHYLEARHIFSRRVVRDLQALDEEGPAA
Ga0207644_1014812313300025931Switchgrass RhizosphereGLAANAMPDAETAAEAKRLMREILDHYLEERRIFSRRVVQDLQAIDEESSP
Ga0207690_1007623843300025932Corn RhizosphereEAKRLMRGVLDHYLDERRIFSRRVVQDLAALEDER
Ga0207686_1024084133300025934Miscanthus RhizosphereATERYPDSDTATEAKRLMRGVLDHYLEERRIFSRRVVQDLAALEDDK
Ga0207709_1019687213300025935Miscanthus RhizosphereARVAAEAKQLMRTVLDHYLEERRIFSRRVVQDLQALDEESETP
Ga0207670_1187623813300025936Switchgrass RhizosphereGSFPDAESAADAKRLMRDVLDHHLDERRIVSRRVVRDLVSLEEGME
Ga0207669_1056426223300025937Miscanthus RhizosphereAAEAKRLMREILDHYLEERRIFSRRVVQDLQAIDEEST
Ga0207711_1045321513300025941Switchgrass RhizosphereATERYADPRIATEAKQLMRSVLDHYLEERHIFSRRVVQDLQALDEESETP
Ga0207711_1116769123300025941Switchgrass RhizosphereATEAKQLMRSVLDHYLEERHIFSRRVVQDLQALDEESETP
Ga0207679_1097706723300025945Corn RhizosphereARRLMRGILDHYLEERRIFSRRVVRDLAALEDDQGPQ
Ga0207679_1097954623300025945Corn RhizospherePDAEVAAEAKRLMREVLDHYLEARHIFSRRVVRDLQALDEEGPAA
Ga0207651_1122263913300025960Switchgrass RhizosphereRLMRDVLDHYLEQRGIESRRVVQDLQALGEEWSSER
Ga0207640_1001655413300025981Corn RhizosphereYPDAETAAEAKRLMRLVLDHYLEARRIFSRRVVQDLQALDDERDIP
Ga0207640_1047345133300025981Corn RhizosphereDADIAAEAKRLMRDVLDHYLEERRIVSRRVVRDLVNLEEEGS
Ga0208657_101129123300026068Natural And Restored WetlandsLAESRYPDTETAAEAKRLMRDVLDHYLDSRRIESRRILADLQALNGDH
Ga0207702_1021831933300026078Corn RhizosphereVAAEAKRLMRGILDHYLEERRIFSRRVVRDLAALEDDGELP
Ga0207641_1263524613300026088Switchgrass RhizosphereIALAEERYPDAETASEAKRLMRLVLDHYLEERRIFSRRVVQDLQALDDERDIP
Ga0207676_1127122023300026095Switchgrass RhizosphereALAAGSFPDAESAADAKRLMRDVLDHHLDERRIVSRRVVRDLVSLEEGME
Ga0207676_1165888613300026095Switchgrass RhizosphereRYPDSEAAAEAKRLMRGVLDHYLEERRIFSRRVVQDLAALEDDK
Ga0207698_1088536613300026142Corn RhizosphereATERYPDSEAAAEAKRLMRGVLDHYLEERRIFSRRVVQDLAALEDDK
Ga0207698_1151025713300026142Corn RhizosphereGEAKRLMRLVLDHYLEERRIFSRRVVQDLQALDDERDPP
Ga0210002_107721313300027617Arabidopsis Thaliana RhizosphereASAHYPDADVAAEAKRLMRSVLDHYLEARGIESRRVVQDLAALEDDKEMR
Ga0208665_1008493123300027715Deep SubsurfaceTLLALAESRYPDAETAAEAKRLMRDVLDHYLDSRRIESRRIVADLQALDGER
Ga0209074_1048740223300027787Agricultural SoilLIALATERYPDSEAAAEAKRLMRGVLDHYLEERRIFSRRVVQDLAALEDDK
Ga0209293_1046223913300027877WetlandAETAAEAKRLMRDVLDHYLDSRRIESRRIVADLQALDGER
Ga0209382_1178532823300027909Populus RhizosphereRVAAEARELMRTVLDHYLEERRIFSRRVVRDLQALDEESETP
Ga0209069_1012111833300027915WatershedsAKRLMREVLDHYLEERRIFSRRVVQDLQAIDEESESS
Ga0209078_108132623300027955Freshwater SedimentLAESRYPDAETAAEAKRLMRDVLDHYLDSRRIESRRIVADLQALDGER
Ga0268266_1199822923300028379Switchgrass RhizosphereDGDVAAEAKRLMRGVLDHYLDERRIFSRRVVQDLAALEDDR
Ga0268264_1044124433300028381Switchgrass RhizosphereDRDTATEAKRLMRGVLDHYLEERRIFSRRVVQDLAALEDDK
Ga0247821_1082025513300028596SoilPDAETAAEAKRLMRGVLDHYLEERRIFSRRVVQDLAALDDERERE
Ga0247821_1085335123300028596SoilAKRLMREVLDHYLEQRRIFSRRIVQDLQALDEQDER
Ga0302214_105142413300028736FenAAEAKRLMREVLDHYLEERRIFSRRVVQDLQAIDEEGSQ
Ga0302256_1013027323300028741FenEAKRLMRDVLDHYLEERRIFSRRVVQDLQAIDEESEPT
Ga0302262_1019621023300028743FenDAQSASEAKRLMRDVLDHYLEERRIFSRRVVQDLQAIDEESEPT
Ga0302257_111205513300028855FenRYPDAATAAEAKRLMREVLDHYLEQRGVESRRVVQDLQALEDEVSPHHD
Ga0302295_100931533300028856FenAKRLMRDVLDHYLEERRIFSRRVVQDLQAIDEESESS
Ga0311347_1045988113300029923FenTLLALAEQRYPDAATAAEAKRLMREVLDHYLEQRGVESRRVVQDLQALEDEVSPHHD
Ga0311347_1102165113300029923FenAANSLPDAQSAAEAKRLMRDVLDHYLEERRIFSRRVVQDLQAIDEESEPT
Ga0311334_1110472613300029987FenYPDAATAAEAKRLMREVLDHYLEQRGVESRRVVQDLQALEDEMSPHHD
Ga0311337_1082626023300030000FenPDAQSASEAKRLMRDVLDHYLEERRIFSRRVVQDLQAIDEESEPT
Ga0311350_1023823733300030002FenKHLMREVLDHYLEERRIFSRRVVQDLQAIDEEGSQ
(restricted) Ga0255311_109655313300031150Sandy SoilVATEAKQLMRTVLDHYLEERRIFSRVVVRDLQALDEEDETP
Ga0311364_1014106943300031521FenRYPDAATAAEAKRLMREVLDHYLEQRGVESRRVVQDLQALEDDVSPHHD
Ga0310888_1069670313300031538SoilDPETAADAKRLMREVLDHYLEQRRIFSRRIVQDLQALDEQDER
Ga0310887_1044163023300031547SoilATEAKRLMRSVLDHYLEARDIESRRVVQDLAALEDDKETR
Ga0310813_1073216913300031716SoilADVAAEAKRLMRGVLDHYLEARRIFSRRVVQDLAALEDDERK
Ga0311351_1059527713300031722FenPDAQTAAEAKRLMRDVLDHYLEERRIFSRRVVQDLQAIDEESEPS
Ga0311351_1073146923300031722FenEVAAEAKRLMREVLDHYLEERRIFSRRVVRDLQALDEEGTAS
Ga0311351_1133901323300031722FenAEAKRLMRDVLDHYLEERRIFSRRVVQDLQAIDEEGEPS
Ga0302321_10035064533300031726FenANSLPDAQAAAEAKRLMRDVLDHYLEERRIFSRRVVQDLQAIDEESEPL
Ga0302321_10100105213300031726FenKRLMRDVLDHYLEERRIFSRRVVQDLQAIDEESESS
Ga0302321_10300610023300031726FenEAKRLMRDVLDHYLEERRIFSRRVVQDLQALDEESETS
Ga0302321_10360230723300031726FenYPDAATAAEAKRLMREVLDHYLEQRGVESRRVVQDLQALEDDVSPHHD
Ga0318548_1014008613300031793SoilYGDARVAAEARELMRSVLDHYLEERRIFSRRVVRDLQALDEERETP
Ga0307473_1014297933300031820Hardwood Forest SoilPDAQTAAEAKRLMRTVLDHYLEERRIFSRRVVQDLQALDEESPEK
Ga0318564_1008635933300031831SoilASSAAEAKRLMRDVLDHYLEHRRIFSRRIVQDLAALDDEPTEAR
Ga0310907_1003382033300031847SoilIALATERYPDSDTATEAKRLMRGVLDHYLEERRIFSRRVVQDLAALEDDK
Ga0310907_1089082813300031847SoilVAAEAKLLMRTVLDHYLEERRIFSRRVVRDLQAMDEESETP
Ga0307406_1037902433300031901RhizosphereAHYPDADVAAEAKRLMRSVLDHYLEARGIESRRVVQDLAALEDDKEMR
Ga0310891_1015010523300031913SoilAHYPDADVATEAKRLMRSVLDHYLEARGIESRRVVQDLAALEDDKEMR
Ga0311367_1050629413300031918FenGLAANSLPDAQAAAEAKRLMRDVLDHYLEERRIFSRRVVQDLQAIDEESEPL
Ga0310885_1027418013300031943SoilKRLMRSVLDHYLEARGIESRRVVQDLAALEDDKEMR
Ga0307409_10024272313300031995RhizosphereQRYPDNDTAAEAKRLMRDVLDHYLESRRIESRRIATDLQIIDEESGHR
Ga0308176_1232677713300031996SoilRLMRGILDHYLEERRIFSRRVVQDLAALEDDRDLQ
Ga0310902_1015322713300032012SoilETAADAKRLMREVLDHYLEQRRIFSRRIVQDLQALDEQDER
Ga0310906_1099621213300032013SoilLALATAHYPDAEAAAEAKRLMRSVLDHYLEARGIESRRVVQDLAALEDDKEMR
Ga0315276_1115742113300032177SedimentLGLAANAFPDAETAAEAKRLMREVLDHYLEERRIFSRRVVQDLQAIDEEGEP
Ga0315271_1035721913300032256SedimentIALAEHRFPDAETAAEAKRLMREVLDHYLEQRGIESRRVVQDLQALGERSDAHD
Ga0315270_1102013023300032275SedimentEAKRLMREVLDHYLDTRAIFSRRIVRDLQAIEGEGQDS
Ga0316188_1059983123300032276Worm BurrowNAMPDAQTAAEAKRLMRDVLDHYLEERRIFSRRVVQDLQAIDEESEST
Ga0316605_1086765823300033408SoilLLALAEGRYPDAETAAQAKRLMREVLDHHLEQRGIESRRVVRDLLALGEDGEPR
Ga0316605_1138539023300033408SoilESRYPDAETAAEAKRLMRDVLDHYLDSRRIESRRIVADLQALDGER
Ga0310810_1130773923300033412SoilERDRYPDADVAAEAKRLMRGILDHYLEQRRIFSRRVVQDLAALEDDERK
Ga0316603_1130253413300033413SoilETAAQAKRLMREVLDHHLEQRGIESRRVVRDLLALGEDGEPR
Ga0316601_10038700533300033419SoilLALADGRYADAETAGEAKRLMREVLDHYLEQRGVESRRVVQDLQALEDEGSGSRD
Ga0316621_1079085713300033488SoilLGAGRYDDAATAAEAKRLMREIIDHHLEARTIMSRKVVRDLMALDDEKTE
Ga0316628_10238582513300033513SoilDAEVAAEAKRLMRSVLDHYLEERRIFSRRIVQDLAALDDDKDAR
Ga0364929_0219475_476_6313300034149SedimentAREFPDAETAAEAKRLMRDVLDHYLEQRGVESRRVVQDLQALGGEGSDRSD
Ga0370506_113137_491_6103300034157Untreated Peat SoilAEAKRLMREVLDHHLDTRAIFSRRIVRDLQAIEGEGHDS
Ga0370506_172525_2_1573300034157Untreated Peat SoilLAAGAYPDAESAAEAKRLMREVLDHYLEERHIASRRIVRDLIALDEEGSGT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.