| Basic Information | |
|---|---|
| Family ID | F035813 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 171 |
| Average Sequence Length | 44 residues |
| Representative Sequence | TAAEAKRLMRSVLDHYLEERRIFSRRVVQDLQALDEEAEPK |
| Number of Associated Samples | 148 |
| Number of Associated Scaffolds | 171 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.60 % |
| % of genes near scaffold ends (potentially truncated) | 97.08 % |
| % of genes from short scaffolds (< 2000 bps) | 92.98 % |
| Associated GOLD sequencing projects | 136 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (63.743 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (11.111 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.105 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.538 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.17% β-sheet: 0.00% Coil/Unstructured: 47.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 171 Family Scaffolds |
|---|---|---|
| PF03740 | PdxJ | 86.55 |
| PF00933 | Glyco_hydro_3 | 11.11 |
| PF07311 | Dodecin | 1.17 |
| PF01425 | Amidase | 0.58 |
| PF00155 | Aminotran_1_2 | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 171 Family Scaffolds |
|---|---|---|---|
| COG0854 | Pyridoxine 5'-phosphate synthase PdxJ | Coenzyme transport and metabolism [H] | 86.55 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 11.11 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 1.17 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 63.74 % |
| All Organisms | root | All Organisms | 36.26 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459019|G14TP7Y01A5ZPN | Not Available | 613 | Open in IMG/M |
| 3300000890|JGI11643J12802_11043688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 566 | Open in IMG/M |
| 3300000956|JGI10216J12902_103715043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1116 | Open in IMG/M |
| 3300003861|Ga0031654_10159076 | Not Available | 641 | Open in IMG/M |
| 3300005180|Ga0066685_10511539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 831 | Open in IMG/M |
| 3300005186|Ga0066676_10817427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 630 | Open in IMG/M |
| 3300005328|Ga0070676_10355294 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1008 | Open in IMG/M |
| 3300005336|Ga0070680_100087665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2574 | Open in IMG/M |
| 3300005340|Ga0070689_100283778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1374 | Open in IMG/M |
| 3300005347|Ga0070668_100151531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1875 | Open in IMG/M |
| 3300005354|Ga0070675_100383278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1252 | Open in IMG/M |
| 3300005438|Ga0070701_10116737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae | 1498 | Open in IMG/M |
| 3300005468|Ga0070707_100930417 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300005544|Ga0070686_101744769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 529 | Open in IMG/M |
| 3300005546|Ga0070696_100383347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1096 | Open in IMG/M |
| 3300005548|Ga0070665_101342870 | Not Available | 724 | Open in IMG/M |
| 3300005559|Ga0066700_10842573 | Not Available | 614 | Open in IMG/M |
| 3300005563|Ga0068855_100323694 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1703 | Open in IMG/M |
| 3300005614|Ga0068856_101403633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 713 | Open in IMG/M |
| 3300005615|Ga0070702_100755814 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 747 | Open in IMG/M |
| 3300005616|Ga0068852_100224187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1789 | Open in IMG/M |
| 3300005616|Ga0068852_101930489 | Not Available | 613 | Open in IMG/M |
| 3300005618|Ga0068864_100183746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1913 | Open in IMG/M |
| 3300005618|Ga0068864_102025582 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 582 | Open in IMG/M |
| 3300005764|Ga0066903_101037675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1504 | Open in IMG/M |
| 3300005836|Ga0074470_11183426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1177 | Open in IMG/M |
| 3300005841|Ga0068863_101751618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 631 | Open in IMG/M |
| 3300005842|Ga0068858_100618724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1051 | Open in IMG/M |
| 3300006032|Ga0066696_10058441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2193 | Open in IMG/M |
| 3300006237|Ga0097621_100350830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1312 | Open in IMG/M |
| 3300006237|Ga0097621_101130755 | Not Available | 736 | Open in IMG/M |
| 3300006604|Ga0074060_11623020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 683 | Open in IMG/M |
| 3300006871|Ga0075434_102025084 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 581 | Open in IMG/M |
| 3300006904|Ga0075424_101980930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 615 | Open in IMG/M |
| 3300007799|Ga0105049_10526031 | Not Available | 875 | Open in IMG/M |
| 3300009081|Ga0105098_10733553 | Not Available | 527 | Open in IMG/M |
| 3300009091|Ga0102851_10371477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1428 | Open in IMG/M |
| 3300009093|Ga0105240_11830155 | Not Available | 632 | Open in IMG/M |
| 3300009098|Ga0105245_11149489 | Not Available | 823 | Open in IMG/M |
| 3300009098|Ga0105245_13029713 | Not Available | 521 | Open in IMG/M |
| 3300009100|Ga0075418_11765140 | Not Available | 673 | Open in IMG/M |
| 3300009100|Ga0075418_12567603 | Not Available | 556 | Open in IMG/M |
| 3300009101|Ga0105247_10559355 | Not Available | 842 | Open in IMG/M |
| 3300009148|Ga0105243_10282692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1495 | Open in IMG/M |
| 3300009156|Ga0111538_13499650 | Not Available | 545 | Open in IMG/M |
| 3300009162|Ga0075423_11316442 | Not Available | 772 | Open in IMG/M |
| 3300009171|Ga0105101_10068493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1723 | Open in IMG/M |
| 3300009177|Ga0105248_13349452 | Not Available | 509 | Open in IMG/M |
| 3300009545|Ga0105237_11549094 | Not Available | 670 | Open in IMG/M |
| 3300010360|Ga0126372_13014109 | Not Available | 522 | Open in IMG/M |
| 3300010361|Ga0126378_11831948 | Not Available | 690 | Open in IMG/M |
| 3300010371|Ga0134125_10191920 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2274 | Open in IMG/M |
| 3300010373|Ga0134128_12822843 | Not Available | 535 | Open in IMG/M |
| 3300010375|Ga0105239_12171776 | Not Available | 645 | Open in IMG/M |
| 3300010401|Ga0134121_12675593 | Not Available | 543 | Open in IMG/M |
| 3300012198|Ga0137364_10686883 | Not Available | 772 | Open in IMG/M |
| 3300012519|Ga0157352_1063752 | Not Available | 580 | Open in IMG/M |
| 3300012914|Ga0157297_10388946 | Not Available | 555 | Open in IMG/M |
| 3300012957|Ga0164303_11317985 | Not Available | 535 | Open in IMG/M |
| 3300012971|Ga0126369_10517984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1253 | Open in IMG/M |
| 3300012985|Ga0164308_10144609 | All Organisms → cellular organisms → Bacteria | 1747 | Open in IMG/M |
| 3300013104|Ga0157370_10008140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 11344 | Open in IMG/M |
| 3300013296|Ga0157374_11662232 | Not Available | 663 | Open in IMG/M |
| 3300013307|Ga0157372_11304601 | Not Available | 838 | Open in IMG/M |
| 3300014166|Ga0134079_10186159 | Not Available | 862 | Open in IMG/M |
| 3300014968|Ga0157379_12165651 | Not Available | 552 | Open in IMG/M |
| 3300015372|Ga0132256_100430919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1424 | Open in IMG/M |
| 3300015372|Ga0132256_101995703 | Not Available | 687 | Open in IMG/M |
| 3300015373|Ga0132257_101991529 | Not Available | 749 | Open in IMG/M |
| 3300015373|Ga0132257_104260696 | Not Available | 520 | Open in IMG/M |
| 3300015373|Ga0132257_104556618 | Not Available | 504 | Open in IMG/M |
| 3300018058|Ga0187766_11313777 | Not Available | 528 | Open in IMG/M |
| 3300018075|Ga0184632_10400926 | Not Available | 576 | Open in IMG/M |
| 3300018078|Ga0184612_10263330 | Not Available | 889 | Open in IMG/M |
| 3300018429|Ga0190272_10404188 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1116 | Open in IMG/M |
| 3300018476|Ga0190274_13226616 | Not Available | 549 | Open in IMG/M |
| 3300018481|Ga0190271_10271866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1740 | Open in IMG/M |
| 3300018920|Ga0190273_12284837 | Not Available | 511 | Open in IMG/M |
| 3300019356|Ga0173481_10675215 | Not Available | 554 | Open in IMG/M |
| 3300025321|Ga0207656_10192211 | Not Available | 983 | Open in IMG/M |
| 3300025909|Ga0207705_11306443 | Not Available | 554 | Open in IMG/M |
| 3300025914|Ga0207671_11070107 | Not Available | 634 | Open in IMG/M |
| 3300025917|Ga0207660_10160340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis | 1735 | Open in IMG/M |
| 3300025919|Ga0207657_10210166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1562 | Open in IMG/M |
| 3300025920|Ga0207649_10445176 | Not Available | 977 | Open in IMG/M |
| 3300025921|Ga0207652_11335816 | Not Available | 620 | Open in IMG/M |
| 3300025926|Ga0207659_11710650 | Not Available | 536 | Open in IMG/M |
| 3300025931|Ga0207644_10148123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1814 | Open in IMG/M |
| 3300025932|Ga0207690_10076238 | Not Available | 2328 | Open in IMG/M |
| 3300025934|Ga0207686_10240841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1316 | Open in IMG/M |
| 3300025935|Ga0207709_10196872 | Not Available | 1436 | Open in IMG/M |
| 3300025936|Ga0207670_11876238 | Not Available | 510 | Open in IMG/M |
| 3300025937|Ga0207669_10564262 | Not Available | 920 | Open in IMG/M |
| 3300025941|Ga0207711_10453215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 1194 | Open in IMG/M |
| 3300025941|Ga0207711_11167691 | Not Available | 711 | Open in IMG/M |
| 3300025945|Ga0207679_10977067 | Not Available | 776 | Open in IMG/M |
| 3300025945|Ga0207679_10979546 | Not Available | 775 | Open in IMG/M |
| 3300025960|Ga0207651_11222639 | Not Available | 675 | Open in IMG/M |
| 3300025981|Ga0207640_10016554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4292 | Open in IMG/M |
| 3300025981|Ga0207640_10473451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1037 | Open in IMG/M |
| 3300026068|Ga0208657_1011291 | Not Available | 826 | Open in IMG/M |
| 3300026078|Ga0207702_10218319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1776 | Open in IMG/M |
| 3300026088|Ga0207641_12635246 | Not Available | 500 | Open in IMG/M |
| 3300026095|Ga0207676_11271220 | Not Available | 730 | Open in IMG/M |
| 3300026095|Ga0207676_11658886 | Not Available | 637 | Open in IMG/M |
| 3300026142|Ga0207698_10885366 | Not Available | 899 | Open in IMG/M |
| 3300026142|Ga0207698_11510257 | Not Available | 687 | Open in IMG/M |
| 3300027617|Ga0210002_1077213 | Not Available | 591 | Open in IMG/M |
| 3300027715|Ga0208665_10084931 | Not Available | 962 | Open in IMG/M |
| 3300027787|Ga0209074_10487402 | Not Available | 533 | Open in IMG/M |
| 3300027877|Ga0209293_10462239 | Not Available | 663 | Open in IMG/M |
| 3300027909|Ga0209382_11785328 | Not Available | 599 | Open in IMG/M |
| 3300027915|Ga0209069_10121118 | Not Available | 1278 | Open in IMG/M |
| 3300027955|Ga0209078_1081326 | Not Available | 939 | Open in IMG/M |
| 3300028379|Ga0268266_11998229 | Not Available | 553 | Open in IMG/M |
| 3300028381|Ga0268264_10441244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1259 | Open in IMG/M |
| 3300028596|Ga0247821_10820255 | Not Available | 614 | Open in IMG/M |
| 3300028596|Ga0247821_10853351 | Not Available | 603 | Open in IMG/M |
| 3300028736|Ga0302214_1051424 | Not Available | 845 | Open in IMG/M |
| 3300028741|Ga0302256_10130273 | Not Available | 674 | Open in IMG/M |
| 3300028743|Ga0302262_10196210 | Not Available | 689 | Open in IMG/M |
| 3300028855|Ga0302257_1112055 | Not Available | 608 | Open in IMG/M |
| 3300028856|Ga0302295_1009315 | All Organisms → cellular organisms → Bacteria | 1735 | Open in IMG/M |
| 3300029923|Ga0311347_11021651 | Not Available | 502 | Open in IMG/M |
| 3300029987|Ga0311334_11104726 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 662 | Open in IMG/M |
| 3300030000|Ga0311337_10826260 | Not Available | 804 | Open in IMG/M |
| 3300030002|Ga0311350_10238237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1620 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1096553 | Not Available | 638 | Open in IMG/M |
| 3300031521|Ga0311364_10141069 | Not Available | 2502 | Open in IMG/M |
| 3300031538|Ga0310888_10696703 | Not Available | 623 | Open in IMG/M |
| 3300031547|Ga0310887_10441630 | Not Available | 774 | Open in IMG/M |
| 3300031716|Ga0310813_10732169 | Not Available | 885 | Open in IMG/M |
| 3300031722|Ga0311351_10595277 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300031722|Ga0311351_10731469 | Not Available | 754 | Open in IMG/M |
| 3300031722|Ga0311351_11339013 | Not Available | 550 | Open in IMG/M |
| 3300031726|Ga0302321_100350645 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
| 3300031726|Ga0302321_101001052 | Not Available | 951 | Open in IMG/M |
| 3300031726|Ga0302321_103006100 | Not Available | 550 | Open in IMG/M |
| 3300031726|Ga0302321_103602307 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 503 | Open in IMG/M |
| 3300031793|Ga0318548_10140086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 1176 | Open in IMG/M |
| 3300031820|Ga0307473_10142979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1349 | Open in IMG/M |
| 3300031831|Ga0318564_10086359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1388 | Open in IMG/M |
| 3300031847|Ga0310907_10033820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1866 | Open in IMG/M |
| 3300031847|Ga0310907_10890828 | Not Available | 503 | Open in IMG/M |
| 3300031901|Ga0307406_10379024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1114 | Open in IMG/M |
| 3300031913|Ga0310891_10150105 | Not Available | 755 | Open in IMG/M |
| 3300031918|Ga0311367_10506294 | Not Available | 1238 | Open in IMG/M |
| 3300031943|Ga0310885_10274180 | Not Available | 863 | Open in IMG/M |
| 3300031995|Ga0307409_100242723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1641 | Open in IMG/M |
| 3300031996|Ga0308176_12326777 | Not Available | 572 | Open in IMG/M |
| 3300032012|Ga0310902_10153227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 1307 | Open in IMG/M |
| 3300032013|Ga0310906_10996212 | Not Available | 602 | Open in IMG/M |
| 3300032177|Ga0315276_11157421 | Not Available | 817 | Open in IMG/M |
| 3300032256|Ga0315271_10357219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1215 | Open in IMG/M |
| 3300032275|Ga0315270_11020130 | Not Available | 548 | Open in IMG/M |
| 3300032276|Ga0316188_10599831 | Not Available | 596 | Open in IMG/M |
| 3300033408|Ga0316605_10867658 | Not Available | 861 | Open in IMG/M |
| 3300033408|Ga0316605_11385390 | Not Available | 681 | Open in IMG/M |
| 3300033412|Ga0310810_11307739 | Not Available | 570 | Open in IMG/M |
| 3300033413|Ga0316603_11302534 | Not Available | 688 | Open in IMG/M |
| 3300033419|Ga0316601_100387005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1312 | Open in IMG/M |
| 3300033488|Ga0316621_10790857 | Not Available | 693 | Open in IMG/M |
| 3300033513|Ga0316628_102385825 | Not Available | 699 | Open in IMG/M |
| 3300034149|Ga0364929_0219475 | Not Available | 633 | Open in IMG/M |
| 3300034157|Ga0370506_113137 | Not Available | 612 | Open in IMG/M |
| 3300034157|Ga0370506_172525 | Not Available | 511 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 11.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.09% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.09% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.34% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.34% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.75% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.75% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.75% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.75% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.75% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.17% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.17% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.17% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.17% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.17% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.17% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.17% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.58% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.58% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.58% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.58% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.58% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.58% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.58% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.58% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.58% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.58% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.58% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.58% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.58% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.58% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.58% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.58% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.58% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.58% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003861 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007799 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026068 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027715 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027955 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028736 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_3 | Environmental | Open in IMG/M |
| 3300028741 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_4 | Environmental | Open in IMG/M |
| 3300028743 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4 | Environmental | Open in IMG/M |
| 3300028855 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_4 | Environmental | Open in IMG/M |
| 3300028856 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_4 | Environmental | Open in IMG/M |
| 3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032276 | Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| 3300034157 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_18 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4MG_03905470 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | AEAKRLMRGILDHYLEQRRIFSRRVVQDLAALEDDERK |
| JGI11643J12802_110436881 | 3300000890 | Soil | ASAHYPDADVAAEAKRLMRSVLDHYLEARGIESRRVVQDLAALEDDKEMR* |
| JGI10214J12806_125059852 | 3300000891 | Soil | TLIALATERYPDSDTATEAKRLMRGVLDHYLEERRIFSRRVVQDLAALEDDK* |
| JGI10216J12902_1037150431 | 3300000956 | Soil | AEAKRLMRSVLDHYLEERRIFSRRVVQDLQALDEEAESK* |
| Ga0031654_101590762 | 3300003861 | Freshwater Lake Sediment | TAAEAKHLMREVLDHYLEERRIFSRRVAQDLQAIDEESEST* |
| Ga0062592_1013277872 | 3300004480 | Soil | LIALAEQQFNDVETAGEAKRLMRSVLDHHLEQRGVESRRVVQDLQALDDEGERGD* |
| Ga0066685_105115391 | 3300005180 | Soil | TAAEAKRLMRSVLDHYLEERRIFSRRVVQDLQALDEEAEPK* |
| Ga0066676_108174271 | 3300005186 | Soil | ANERYPDPQTATEAKRLMRSVLDHYLEERRIFSRRVVQDLQALDEEAEPK* |
| Ga0070676_103552941 | 3300005328 | Miscanthus Rhizosphere | DTATEAKRLMRGVLDHYLEERRIFSRRVVQDLAALEDDK* |
| Ga0070680_1000876655 | 3300005336 | Corn Rhizosphere | SERYTDADVAAEAKRLMRGVLDHYLEARRIFSRRVVQDLAALEDDERN* |
| Ga0070689_1002837783 | 3300005340 | Switchgrass Rhizosphere | SFPDAESAADAKRLMRDVLDHHLDERRIVSRRVVRDLVSLEEGME* |
| Ga0070668_1001515313 | 3300005347 | Switchgrass Rhizosphere | PDADIAAEAKRLMRDVLDHYLEERRIVSRRVVRDLVNLEEEGS* |
| Ga0070675_1003832783 | 3300005354 | Miscanthus Rhizosphere | ALAANAFPDSEVAAEAKRLMREVLDHHLEQRHIVSRRVVRDLMALDE* |
| Ga0070701_101167371 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | AANAMPDAETAAEAKRLMREILDHYLEERRIFSRRVVQDLQAIDEEST* |
| Ga0070707_1009304171 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | TAAEAKRLMREVLDHYLEQRGVESRRVVQDLQALEDEANPTHD* |
| Ga0070686_1017447691 | 3300005544 | Switchgrass Rhizosphere | NAMPDAETAAEAKRLMREILDHYLEERRIFSRRVVQDLQAIDEEST* |
| Ga0070696_1003833472 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | ERYPDSDTATEAKRLMRGVLDHYLEERRIFSRRVVQDLAALEDDK* |
| Ga0070665_1013428702 | 3300005548 | Switchgrass Rhizosphere | AAEAKRLMRDVLDHYLEERRIVSRRVVRDLVNLEEEGS* |
| Ga0066700_108425731 | 3300005559 | Soil | KRLMRSVLDHYLEERRIFSRRVVQDLQALDEETESK* |
| Ga0068855_1003236943 | 3300005563 | Corn Rhizosphere | EAKRLMRGVLDHYLDERRIFSRRVVQDLAALEDER* |
| Ga0068856_1014036332 | 3300005614 | Corn Rhizosphere | GRFAGAATLGEAKRLMRAVLDHYLESRRLASRRIVQDLQALEGEEES* |
| Ga0070702_1007558142 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | DGDVAAEAKRLMRGVLDHYLDERRIFSRRVVQDLAALEDDR* |
| Ga0068852_1002241873 | 3300005616 | Corn Rhizosphere | AEVAAEAKRLMREVLDHYLEARHIFSRRVVRDLQALDEEGPAA* |
| Ga0068852_1019304892 | 3300005616 | Corn Rhizosphere | AEARYPDAETAGEAKRLMRLVLDHYLEERRIFSRRVVQDLQALDDERDPP* |
| Ga0068864_1001837461 | 3300005618 | Switchgrass Rhizosphere | ALAAGSFPDAESAADAKRLMRDVLDHHLDERRIVSRRVVRDLVSLEEGME* |
| Ga0068864_1020255821 | 3300005618 | Switchgrass Rhizosphere | DSEAAAEAKRLMRGVLDHYLEERRIFSRRVVQDLAALEDDK* |
| Ga0066903_1010376751 | 3300005764 | Tropical Forest Soil | EAKRLMRDVLDHYLEHRRIFSRRIVQDLAALDDEPTEAR* |
| Ga0074470_111834263 | 3300005836 | Sediment (Intertidal) | TAAEAKRLMREVLDHYLEQRGVESRRVVQDLQALEDGAKAPND* |
| Ga0068863_1017516182 | 3300005841 | Switchgrass Rhizosphere | ATEHYPDADVAGEAKRLMRRVLDHYLDERRIFSRRVVQDLAALDDEDDGR* |
| Ga0068858_1006187241 | 3300005842 | Switchgrass Rhizosphere | PDARTAGEAKQLMRTILDHYLEERKIFSRRVVRDLQALDEEGEAS* |
| Ga0066696_100584411 | 3300006032 | Soil | AQTAAEAKRLMRSVLEHYLEQRRIFSRRVVQDLAALDDDGDAK* |
| Ga0097621_1003508303 | 3300006237 | Miscanthus Rhizosphere | DARTAGEAKQLMRTILDHYLEERKIFSRRVVRDLQALDEEGEAS* |
| Ga0097621_1011307551 | 3300006237 | Miscanthus Rhizosphere | KRLMRDVLDHHLDERRIVSRRVVRDLVSLEEGME* |
| Ga0074060_116230202 | 3300006604 | Soil | PDAATAAEAKRLMREVLDHYLEERRIFSRRVVQDLQLIDEESEP* |
| Ga0075434_1020250841 | 3300006871 | Populus Rhizosphere | AAEAKRLMREVLDHHLEERRIVSRRVVRDLMLLEEDKP* |
| Ga0075424_1019809301 | 3300006904 | Populus Rhizosphere | AAEAKRLMRSVLDHYLEARGIESRRVVQDLAALEDDKEMR* |
| Ga0105049_105260312 | 3300007799 | Freshwater | TLDFSDPDSALEAKRLMREVLDHYLDTRQIFSRRVVRDLQAMDGEGHDS* |
| Ga0105098_107335531 | 3300009081 | Freshwater Sediment | AEAKRLMRDVLDHYLDSRRIESRRIVADLRSLDGEP* |
| Ga0102851_103714771 | 3300009091 | Freshwater Wetlands | AKRLMREVLDHHLEERRIFSRRVVRDLMALDEEGTAT* |
| Ga0105240_118301552 | 3300009093 | Corn Rhizosphere | KRLMRGVLDHYLEARRIFSRRVVQDLAALEDDERN* |
| Ga0105245_111494892 | 3300009098 | Miscanthus Rhizosphere | AKRLMREILDHYLEERRIFSRRVVQDLQAIDEEST* |
| Ga0105245_130297131 | 3300009098 | Miscanthus Rhizosphere | AAVAKQLMRTVLDHYLEERRIFSRRVVRDLQALDEESEAP* |
| Ga0075418_117651401 | 3300009100 | Populus Rhizosphere | SEHYADARVAAEARELMRSVLDHYLEERRIFSRRVVRDLQALDEESETP* |
| Ga0075418_125676032 | 3300009100 | Populus Rhizosphere | ALAAGSFPDAESAADAKRLMRDVLDHHLEERRIVSRRVVRDLVSLEEENP* |
| Ga0105247_105593552 | 3300009101 | Switchgrass Rhizosphere | SDTATEAKRLMRCVLDHYLEERRIFSRRVVQDLAALEDDK* |
| Ga0105243_102826923 | 3300009148 | Miscanthus Rhizosphere | RWAPEAKQLMRTVLDHYLEERRIFSRRVVQDLQALDEESETP* |
| Ga0111538_134996501 | 3300009156 | Populus Rhizosphere | KRLMRSVLDHYLEARGIESRRVVQDLAALEDDKEMR* |
| Ga0075423_113164422 | 3300009162 | Populus Rhizosphere | LALAARRFPDAEVAAEAKRLMREVLDHYLEARHIFSRRVVRDLQALDEEGPAA* |
| Ga0105101_100684933 | 3300009171 | Freshwater Sediment | LAESRYPDAETAAEAKRLMRDVLDHYLDSRRIESRRIVADLQALDGER* |
| Ga0105248_133494521 | 3300009177 | Switchgrass Rhizosphere | YADARVAAEAKQLMRTVLDHYLEERRIFSRRVVQDLQALDEESETP* |
| Ga0105237_115490941 | 3300009545 | Corn Rhizosphere | TEAKRLMRGVLDHYLEERRIFSRRVVQDLAALEDDK* |
| Ga0105249_120032251 | 3300009553 | Switchgrass Rhizosphere | LLALAEQRYPDAATAAEAKRLMREVLDHYLEQRGVESRRVVQDLQALEDEVGTPHD* |
| Ga0126372_130141091 | 3300010360 | Tropical Forest Soil | EAKRLMREVLDYYLEQRGVESRRVVQDLQALEDETGTPDD* |
| Ga0126378_118319482 | 3300010361 | Tropical Forest Soil | PDAAAEAKRLMREVLDYYLERRTIVSRRVVRDLQAMEEEGEGDTQ* |
| Ga0134125_101919204 | 3300010371 | Terrestrial Soil | AEGRFAGAATLGEAKRLMRAVLDHYLESRRLASRRIVQDLQALEGEEES* |
| Ga0134128_128228431 | 3300010373 | Terrestrial Soil | PDAETAAEAKRLMRLVLDHYLEARRIFSRRVVQDLQALDDERDIP* |
| Ga0105239_121717761 | 3300010375 | Corn Rhizosphere | LATAHYPDAEVAAEAKRLMRSVLDHYLEARGIESRRVVQDLAALEDDKEMR* |
| Ga0134121_126755932 | 3300010401 | Terrestrial Soil | AEAKRLMREVLDHHLEERRIVSRRVVRDLMALDE* |
| Ga0137364_106868832 | 3300012198 | Vadose Zone Soil | LMRSVLDHYLEERRIFSRRVVQDLQALDEEAEPK* |
| Ga0157352_10637521 | 3300012519 | Unplanted Soil | ATEQYPDGDVAAEAKRLMRSVLDHYLDERRIFSRRVVQDLAALEDDR* |
| Ga0157297_103889461 | 3300012914 | Soil | RFDDASTAAEAKRLMREVIDHHLDARTIQSRKVVRDLWALEEESNE* |
| Ga0164303_113179851 | 3300012957 | Soil | HYPDAEAAAEAKRLMRSVLDHYLEARGIESRRVVQDLAALEDDKEMR* |
| Ga0126369_105179841 | 3300012971 | Tropical Forest Soil | MREVLDHYLEQRGVESRRVVQDLQALEDETGTPDD* |
| Ga0164308_101446093 | 3300012985 | Soil | DAEVASEAKRLMRGVLDHYLEERRIFSRRVVQDLAALDDDREP* |
| Ga0157370_100081401 | 3300013104 | Corn Rhizosphere | RLMRLVLDHYLEARRIFSRRVVQDLQALDDERDIP* |
| Ga0157374_116622322 | 3300013296 | Miscanthus Rhizosphere | ASERYTDADLAHEPKRLMRGVLDHYLEARRIFSRRVVQDLAALEDDERK* |
| Ga0157372_113046012 | 3300013307 | Corn Rhizosphere | LIALATERYPDSEAAAEAKRLMRGVLDHYLEERRIFSRRVVQDLAALEDDK* |
| Ga0157375_113240722 | 3300013308 | Miscanthus Rhizosphere | RGATLLALAANAFPDSEVAAEAKRLMREVLDHHLEQRHIVSRRVVRDLMALDE* |
| Ga0134079_101861592 | 3300014166 | Grasslands Soil | LANERYPDAQTAAEAKRLMRSVLDHYLEQRRIFSRRVVQDLAALDDDGEAK* |
| Ga0157379_121656512 | 3300014968 | Switchgrass Rhizosphere | LIALATEHYPDADVAGEAKRLMRRVLDHYLDERRIFSRRVVQDLAALEDDR* |
| Ga0132256_1004309193 | 3300015372 | Arabidopsis Rhizosphere | QGRYPDARVAAEAKLLMRTVLDHYLEERRIFSRRVVRDLAALEDDGELP* |
| Ga0132256_1019957031 | 3300015372 | Arabidopsis Rhizosphere | DADIAAEAKRLMRDVLDHYLEERRIVSRRVVRDLVNLEEEGS* |
| Ga0132257_1019915292 | 3300015373 | Arabidopsis Rhizosphere | LAARRCDDPATALEAKRLMRDVLDHYLEQRGVQSRRVVQDLQALEDEP* |
| Ga0132257_1042606961 | 3300015373 | Arabidopsis Rhizosphere | MRAVLDHYLEQRGVESRRLVQDLQAIDHDEQDTR* |
| Ga0132257_1045566181 | 3300015373 | Arabidopsis Rhizosphere | AQAKRLMRDVLDHHLEERRIVSRRVVRDLVSLEEEPE* |
| Ga0187766_113137772 | 3300018058 | Tropical Peatland | MTEAAAEAKRLMREVLDHYLERRTIASRRVVRDLLAID |
| Ga0184632_104009261 | 3300018075 | Groundwater Sediment | AEAKRLMRDVLDHYLEQRGVESRRVVQDLEALEDEVGTPHD |
| Ga0184612_102633302 | 3300018078 | Groundwater Sediment | LAARTFPDAEVAAEAKRLMREVLDHYLEARHIFSRRVVRDLQALDEEGPAA |
| Ga0190272_104041883 | 3300018429 | Soil | QRYPDSETAAEAKRLMRDVLDHYLESRRIESRRIAADLQALDDESE |
| Ga0190274_132266161 | 3300018476 | Soil | AKQLMRTVLDHYLEERRIFSRRVVQDLQALDEESETP |
| Ga0190271_102718663 | 3300018481 | Soil | RGATLIALAERRFADPEVAAEAKRLMREVIDHYLEARRIESRRIVADLIAIDETSRPE |
| Ga0190273_122848372 | 3300018920 | Soil | EAKRLMRDVLDHYLESRRIESRRIAADLQSLDDESE |
| Ga0173481_106752151 | 3300019356 | Soil | NAHYPDADVAAEAKRLMRSVLDHYLEARGIESRRVVQDLAALEDDKEMR |
| Ga0207656_101922111 | 3300025321 | Corn Rhizosphere | AGSFPDADIAAEAKRLMRDVLDHYLEERRIVSRRVVRDLVNLEEEGS |
| Ga0207705_113064431 | 3300025909 | Corn Rhizosphere | DVAAEAKRLMRGVLDHYLEARRIFSRRVVQDLAALEDDERN |
| Ga0207671_110701072 | 3300025914 | Corn Rhizosphere | TAAEAKRLMRLVLDHYLEARRIFSRRVVQDLQALDDERDIP |
| Ga0207660_101603403 | 3300025917 | Corn Rhizosphere | ALASERYTDADVAAEAKRLMRGVLDHYLEARRIFSRRVVQDLAALEDDERN |
| Ga0207657_102101661 | 3300025919 | Corn Rhizosphere | ALIALAEARYPHAETAGEAKRLMRLVLDHYLEERRIFSRRVVQDLQALDDERDPP |
| Ga0207649_104451762 | 3300025920 | Corn Rhizosphere | DAETAGEAKRLMRLVLDHYLEERRIFSRRVVQDLQALDDERDPP |
| Ga0207652_113358161 | 3300025921 | Corn Rhizosphere | KRLMRQVLDHYLEARAIVSRRIVQDLIALDDERDAT |
| Ga0207659_117106502 | 3300025926 | Miscanthus Rhizosphere | KRLMREVLDHYLEARHIFSRRVVRDLQALDEEGPAA |
| Ga0207644_101481231 | 3300025931 | Switchgrass Rhizosphere | GLAANAMPDAETAAEAKRLMREILDHYLEERRIFSRRVVQDLQAIDEESSP |
| Ga0207690_100762384 | 3300025932 | Corn Rhizosphere | EAKRLMRGVLDHYLDERRIFSRRVVQDLAALEDER |
| Ga0207686_102408413 | 3300025934 | Miscanthus Rhizosphere | ATERYPDSDTATEAKRLMRGVLDHYLEERRIFSRRVVQDLAALEDDK |
| Ga0207709_101968721 | 3300025935 | Miscanthus Rhizosphere | ARVAAEAKQLMRTVLDHYLEERRIFSRRVVQDLQALDEESETP |
| Ga0207670_118762381 | 3300025936 | Switchgrass Rhizosphere | GSFPDAESAADAKRLMRDVLDHHLDERRIVSRRVVRDLVSLEEGME |
| Ga0207669_105642622 | 3300025937 | Miscanthus Rhizosphere | AAEAKRLMREILDHYLEERRIFSRRVVQDLQAIDEEST |
| Ga0207711_104532151 | 3300025941 | Switchgrass Rhizosphere | ATERYADPRIATEAKQLMRSVLDHYLEERHIFSRRVVQDLQALDEESETP |
| Ga0207711_111676912 | 3300025941 | Switchgrass Rhizosphere | ATEAKQLMRSVLDHYLEERHIFSRRVVQDLQALDEESETP |
| Ga0207679_109770672 | 3300025945 | Corn Rhizosphere | ARRLMRGILDHYLEERRIFSRRVVRDLAALEDDQGPQ |
| Ga0207679_109795462 | 3300025945 | Corn Rhizosphere | PDAEVAAEAKRLMREVLDHYLEARHIFSRRVVRDLQALDEEGPAA |
| Ga0207651_112226391 | 3300025960 | Switchgrass Rhizosphere | RLMRDVLDHYLEQRGIESRRVVQDLQALGEEWSSER |
| Ga0207640_100165541 | 3300025981 | Corn Rhizosphere | YPDAETAAEAKRLMRLVLDHYLEARRIFSRRVVQDLQALDDERDIP |
| Ga0207640_104734513 | 3300025981 | Corn Rhizosphere | DADIAAEAKRLMRDVLDHYLEERRIVSRRVVRDLVNLEEEGS |
| Ga0208657_10112912 | 3300026068 | Natural And Restored Wetlands | LAESRYPDTETAAEAKRLMRDVLDHYLDSRRIESRRILADLQALNGDH |
| Ga0207702_102183193 | 3300026078 | Corn Rhizosphere | VAAEAKRLMRGILDHYLEERRIFSRRVVRDLAALEDDGELP |
| Ga0207641_126352461 | 3300026088 | Switchgrass Rhizosphere | IALAEERYPDAETASEAKRLMRLVLDHYLEERRIFSRRVVQDLQALDDERDIP |
| Ga0207676_112712202 | 3300026095 | Switchgrass Rhizosphere | ALAAGSFPDAESAADAKRLMRDVLDHHLDERRIVSRRVVRDLVSLEEGME |
| Ga0207676_116588861 | 3300026095 | Switchgrass Rhizosphere | RYPDSEAAAEAKRLMRGVLDHYLEERRIFSRRVVQDLAALEDDK |
| Ga0207698_108853661 | 3300026142 | Corn Rhizosphere | ATERYPDSEAAAEAKRLMRGVLDHYLEERRIFSRRVVQDLAALEDDK |
| Ga0207698_115102571 | 3300026142 | Corn Rhizosphere | GEAKRLMRLVLDHYLEERRIFSRRVVQDLQALDDERDPP |
| Ga0210002_10772131 | 3300027617 | Arabidopsis Thaliana Rhizosphere | ASAHYPDADVAAEAKRLMRSVLDHYLEARGIESRRVVQDLAALEDDKEMR |
| Ga0208665_100849312 | 3300027715 | Deep Subsurface | TLLALAESRYPDAETAAEAKRLMRDVLDHYLDSRRIESRRIVADLQALDGER |
| Ga0209074_104874022 | 3300027787 | Agricultural Soil | LIALATERYPDSEAAAEAKRLMRGVLDHYLEERRIFSRRVVQDLAALEDDK |
| Ga0209293_104622391 | 3300027877 | Wetland | AETAAEAKRLMRDVLDHYLDSRRIESRRIVADLQALDGER |
| Ga0209382_117853282 | 3300027909 | Populus Rhizosphere | RVAAEARELMRTVLDHYLEERRIFSRRVVRDLQALDEESETP |
| Ga0209069_101211183 | 3300027915 | Watersheds | AKRLMREVLDHYLEERRIFSRRVVQDLQAIDEESESS |
| Ga0209078_10813262 | 3300027955 | Freshwater Sediment | LAESRYPDAETAAEAKRLMRDVLDHYLDSRRIESRRIVADLQALDGER |
| Ga0268266_119982292 | 3300028379 | Switchgrass Rhizosphere | DGDVAAEAKRLMRGVLDHYLDERRIFSRRVVQDLAALEDDR |
| Ga0268264_104412443 | 3300028381 | Switchgrass Rhizosphere | DRDTATEAKRLMRGVLDHYLEERRIFSRRVVQDLAALEDDK |
| Ga0247821_108202551 | 3300028596 | Soil | PDAETAAEAKRLMRGVLDHYLEERRIFSRRVVQDLAALDDERERE |
| Ga0247821_108533512 | 3300028596 | Soil | AKRLMREVLDHYLEQRRIFSRRIVQDLQALDEQDER |
| Ga0302214_10514241 | 3300028736 | Fen | AAEAKRLMREVLDHYLEERRIFSRRVVQDLQAIDEEGSQ |
| Ga0302256_101302732 | 3300028741 | Fen | EAKRLMRDVLDHYLEERRIFSRRVVQDLQAIDEESEPT |
| Ga0302262_101962102 | 3300028743 | Fen | DAQSASEAKRLMRDVLDHYLEERRIFSRRVVQDLQAIDEESEPT |
| Ga0302257_11120551 | 3300028855 | Fen | RYPDAATAAEAKRLMREVLDHYLEQRGVESRRVVQDLQALEDEVSPHHD |
| Ga0302295_10093153 | 3300028856 | Fen | AKRLMRDVLDHYLEERRIFSRRVVQDLQAIDEESESS |
| Ga0311347_104598811 | 3300029923 | Fen | TLLALAEQRYPDAATAAEAKRLMREVLDHYLEQRGVESRRVVQDLQALEDEVSPHHD |
| Ga0311347_110216511 | 3300029923 | Fen | AANSLPDAQSAAEAKRLMRDVLDHYLEERRIFSRRVVQDLQAIDEESEPT |
| Ga0311334_111047261 | 3300029987 | Fen | YPDAATAAEAKRLMREVLDHYLEQRGVESRRVVQDLQALEDEMSPHHD |
| Ga0311337_108262602 | 3300030000 | Fen | PDAQSASEAKRLMRDVLDHYLEERRIFSRRVVQDLQAIDEESEPT |
| Ga0311350_102382373 | 3300030002 | Fen | KHLMREVLDHYLEERRIFSRRVVQDLQAIDEEGSQ |
| (restricted) Ga0255311_10965531 | 3300031150 | Sandy Soil | VATEAKQLMRTVLDHYLEERRIFSRVVVRDLQALDEEDETP |
| Ga0311364_101410694 | 3300031521 | Fen | RYPDAATAAEAKRLMREVLDHYLEQRGVESRRVVQDLQALEDDVSPHHD |
| Ga0310888_106967031 | 3300031538 | Soil | DPETAADAKRLMREVLDHYLEQRRIFSRRIVQDLQALDEQDER |
| Ga0310887_104416302 | 3300031547 | Soil | ATEAKRLMRSVLDHYLEARDIESRRVVQDLAALEDDKETR |
| Ga0310813_107321691 | 3300031716 | Soil | ADVAAEAKRLMRGVLDHYLEARRIFSRRVVQDLAALEDDERK |
| Ga0311351_105952771 | 3300031722 | Fen | PDAQTAAEAKRLMRDVLDHYLEERRIFSRRVVQDLQAIDEESEPS |
| Ga0311351_107314692 | 3300031722 | Fen | EVAAEAKRLMREVLDHYLEERRIFSRRVVRDLQALDEEGTAS |
| Ga0311351_113390132 | 3300031722 | Fen | AEAKRLMRDVLDHYLEERRIFSRRVVQDLQAIDEEGEPS |
| Ga0302321_1003506453 | 3300031726 | Fen | ANSLPDAQAAAEAKRLMRDVLDHYLEERRIFSRRVVQDLQAIDEESEPL |
| Ga0302321_1010010521 | 3300031726 | Fen | KRLMRDVLDHYLEERRIFSRRVVQDLQAIDEESESS |
| Ga0302321_1030061002 | 3300031726 | Fen | EAKRLMRDVLDHYLEERRIFSRRVVQDLQALDEESETS |
| Ga0302321_1036023072 | 3300031726 | Fen | YPDAATAAEAKRLMREVLDHYLEQRGVESRRVVQDLQALEDDVSPHHD |
| Ga0318548_101400861 | 3300031793 | Soil | YGDARVAAEARELMRSVLDHYLEERRIFSRRVVRDLQALDEERETP |
| Ga0307473_101429793 | 3300031820 | Hardwood Forest Soil | PDAQTAAEAKRLMRTVLDHYLEERRIFSRRVVQDLQALDEESPEK |
| Ga0318564_100863593 | 3300031831 | Soil | ASSAAEAKRLMRDVLDHYLEHRRIFSRRIVQDLAALDDEPTEAR |
| Ga0310907_100338203 | 3300031847 | Soil | IALATERYPDSDTATEAKRLMRGVLDHYLEERRIFSRRVVQDLAALEDDK |
| Ga0310907_108908281 | 3300031847 | Soil | VAAEAKLLMRTVLDHYLEERRIFSRRVVRDLQAMDEESETP |
| Ga0307406_103790243 | 3300031901 | Rhizosphere | AHYPDADVAAEAKRLMRSVLDHYLEARGIESRRVVQDLAALEDDKEMR |
| Ga0310891_101501052 | 3300031913 | Soil | AHYPDADVATEAKRLMRSVLDHYLEARGIESRRVVQDLAALEDDKEMR |
| Ga0311367_105062941 | 3300031918 | Fen | GLAANSLPDAQAAAEAKRLMRDVLDHYLEERRIFSRRVVQDLQAIDEESEPL |
| Ga0310885_102741801 | 3300031943 | Soil | KRLMRSVLDHYLEARGIESRRVVQDLAALEDDKEMR |
| Ga0307409_1002427231 | 3300031995 | Rhizosphere | QRYPDNDTAAEAKRLMRDVLDHYLESRRIESRRIATDLQIIDEESGHR |
| Ga0308176_123267771 | 3300031996 | Soil | RLMRGILDHYLEERRIFSRRVVQDLAALEDDRDLQ |
| Ga0310902_101532271 | 3300032012 | Soil | ETAADAKRLMREVLDHYLEQRRIFSRRIVQDLQALDEQDER |
| Ga0310906_109962121 | 3300032013 | Soil | LALATAHYPDAEAAAEAKRLMRSVLDHYLEARGIESRRVVQDLAALEDDKEMR |
| Ga0315276_111574211 | 3300032177 | Sediment | LGLAANAFPDAETAAEAKRLMREVLDHYLEERRIFSRRVVQDLQAIDEEGEP |
| Ga0315271_103572191 | 3300032256 | Sediment | IALAEHRFPDAETAAEAKRLMREVLDHYLEQRGIESRRVVQDLQALGERSDAHD |
| Ga0315270_110201302 | 3300032275 | Sediment | EAKRLMREVLDHYLDTRAIFSRRIVRDLQAIEGEGQDS |
| Ga0316188_105998312 | 3300032276 | Worm Burrow | NAMPDAQTAAEAKRLMRDVLDHYLEERRIFSRRVVQDLQAIDEESEST |
| Ga0316605_108676582 | 3300033408 | Soil | LLALAEGRYPDAETAAQAKRLMREVLDHHLEQRGIESRRVVRDLLALGEDGEPR |
| Ga0316605_113853902 | 3300033408 | Soil | ESRYPDAETAAEAKRLMRDVLDHYLDSRRIESRRIVADLQALDGER |
| Ga0310810_113077392 | 3300033412 | Soil | ERDRYPDADVAAEAKRLMRGILDHYLEQRRIFSRRVVQDLAALEDDERK |
| Ga0316603_113025341 | 3300033413 | Soil | ETAAQAKRLMREVLDHHLEQRGIESRRVVRDLLALGEDGEPR |
| Ga0316601_1003870053 | 3300033419 | Soil | LALADGRYADAETAGEAKRLMREVLDHYLEQRGVESRRVVQDLQALEDEGSGSRD |
| Ga0316621_107908571 | 3300033488 | Soil | LGAGRYDDAATAAEAKRLMREIIDHHLEARTIMSRKVVRDLMALDDEKTE |
| Ga0316628_1023858251 | 3300033513 | Soil | DAEVAAEAKRLMRSVLDHYLEERRIFSRRIVQDLAALDDDKDAR |
| Ga0364929_0219475_476_631 | 3300034149 | Sediment | AREFPDAETAAEAKRLMRDVLDHYLEQRGVESRRVVQDLQALGGEGSDRSD |
| Ga0370506_113137_491_610 | 3300034157 | Untreated Peat Soil | AEAKRLMREVLDHHLDTRAIFSRRIVRDLQAIEGEGHDS |
| Ga0370506_172525_2_157 | 3300034157 | Untreated Peat Soil | LAAGAYPDAESAAEAKRLMREVLDHYLEERHIASRRIVRDLIALDEEGSGT |
| ⦗Top⦘ |