NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F035788

Metagenome / Metatranscriptome Family F035788

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F035788
Family Type Metagenome / Metatranscriptome
Number of Sequences 171
Average Sequence Length 82 residues
Representative Sequence WTFFFMAGEIKATVFGFDKQKTLRAALKRLIANVKSQHCNSIEITQVTGKSFLKVPYVSVSAHPRHLQKGLVFSPK
Number of Associated Samples 150
Number of Associated Scaffolds 171

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 10.65 %
% of genes near scaffold ends (potentially truncated) 86.55 %
% of genes from short scaffolds (< 2000 bps) 90.06 %
Associated GOLD sequencing projects 141
AlphaFold2 3D model prediction Yes
3D model pTM-score0.66

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (76.608 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(14.620 % of family members)
Environment Ontology (ENVO) Unclassified
(23.977 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(35.673 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 17.31%    β-sheet: 27.88%    Coil/Unstructured: 54.81%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.66
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 171 Family Scaffolds
PF00166Cpn10 64.33
PF00118Cpn60_TCP1 16.37
PF13500AAA_26 0.58
PF00072Response_reg 0.58
PF04041Glyco_hydro_130 0.58
PF00989PAS 0.58
PF01381HTH_3 0.58
PF04238DUF420 0.58
PF00296Bac_luciferase 0.58
PF12779WXXGXW 0.58
PF05598DUF772 0.58
PF01610DDE_Tnp_ISL3 0.58

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 171 Family Scaffolds
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 64.33
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 16.37
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.58
COG2152Predicted glycosyl hydrolase, GH43/DUF377 familyCarbohydrate transport and metabolism [G] 0.58
COG2322Cytochrome oxidase assembly protein CtaM/YozB, DUF420 familyPosttranslational modification, protein turnover, chaperones [O] 0.58
COG3464TransposaseMobilome: prophages, transposons [X] 0.58


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms76.61 %
UnclassifiedrootN/A23.39 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573000|GPBTN7E01D4X4ZNot Available517Open in IMG/M
3300001686|C688J18823_10603913All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4700Open in IMG/M
3300004092|Ga0062389_102895662Not Available641Open in IMG/M
3300004114|Ga0062593_103289170All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4518Open in IMG/M
3300004157|Ga0062590_101094585All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4767Open in IMG/M
3300004401|Ga0068980_1148878All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1153Open in IMG/M
3300004631|Ga0058899_11833653All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium846Open in IMG/M
3300004631|Ga0058899_12052599All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4728Open in IMG/M
3300004635|Ga0062388_102116941All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4584Open in IMG/M
3300005184|Ga0066671_10330615All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium963Open in IMG/M
3300005187|Ga0066675_10805043All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium710Open in IMG/M
3300005340|Ga0070689_101113131Not Available706Open in IMG/M
3300005434|Ga0070709_11490131All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4549Open in IMG/M
3300005436|Ga0070713_100203602All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1789Open in IMG/M
3300005533|Ga0070734_10684870All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4583Open in IMG/M
3300005535|Ga0070684_100795206All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium884Open in IMG/M
3300005535|Ga0070684_101153264All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4729Open in IMG/M
3300005541|Ga0070733_10716530All Organisms → cellular organisms → Bacteria → Acidobacteria672Open in IMG/M
3300005544|Ga0070686_100773181All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium772Open in IMG/M
3300005577|Ga0068857_102170127Not Available545Open in IMG/M
3300005591|Ga0070761_10776896All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300005842|Ga0068858_100688145All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4995Open in IMG/M
3300005842|Ga0068858_102292304All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4534Open in IMG/M
3300005843|Ga0068860_102703629Not Available515Open in IMG/M
3300005952|Ga0080026_10239704All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4545Open in IMG/M
3300006052|Ga0075029_100001096All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae15530Open in IMG/M
3300006052|Ga0075029_101319952All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia507Open in IMG/M
3300006162|Ga0075030_101117484Not Available620Open in IMG/M
3300006358|Ga0068871_101485413All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4640Open in IMG/M
3300006854|Ga0075425_100707296All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1157Open in IMG/M
3300009088|Ga0099830_10872450All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales744Open in IMG/M
3300009090|Ga0099827_11391142All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4611Open in IMG/M
3300009143|Ga0099792_11091270All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4537Open in IMG/M
3300009176|Ga0105242_12088052Not Available610Open in IMG/M
3300009548|Ga0116107_1187706All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4549Open in IMG/M
3300009616|Ga0116111_1129472All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4613Open in IMG/M
3300009628|Ga0116125_1204740All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4562Open in IMG/M
3300009637|Ga0116118_1182701All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium664Open in IMG/M
3300009637|Ga0116118_1191421All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4645Open in IMG/M
3300009639|Ga0116122_1266906All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4528Open in IMG/M
3300009644|Ga0116121_1285150All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4531Open in IMG/M
3300009665|Ga0116135_1403940Not Available555Open in IMG/M
3300010379|Ga0136449_100365640All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium2582Open in IMG/M
3300010379|Ga0136449_101415566All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1072Open in IMG/M
3300010379|Ga0136449_104054085Not Available546Open in IMG/M
3300010397|Ga0134124_11895632Not Available631Open in IMG/M
3300010399|Ga0134127_12573922All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4589Open in IMG/M
3300011120|Ga0150983_11209059All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4687Open in IMG/M
3300012096|Ga0137389_10441860All Organisms → cellular organisms → Bacteria1113Open in IMG/M
3300012199|Ga0137383_11045921All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4593Open in IMG/M
3300012209|Ga0137379_11747164All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4518Open in IMG/M
3300012957|Ga0164303_11424571All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4519Open in IMG/M
3300014152|Ga0181533_1217525All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4728Open in IMG/M
3300014153|Ga0181527_1217849All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae786Open in IMG/M
3300014155|Ga0181524_10375253All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4627Open in IMG/M
3300014156|Ga0181518_10197907All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41046Open in IMG/M
3300014165|Ga0181523_10379663All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae789Open in IMG/M
3300014200|Ga0181526_11091124Not Available501Open in IMG/M
3300014491|Ga0182014_10162899All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41244Open in IMG/M
3300014494|Ga0182017_10165256All Organisms → cellular organisms → Bacteria1428Open in IMG/M
3300014494|Ga0182017_10742276All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4594Open in IMG/M
3300014495|Ga0182015_10380165All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae913Open in IMG/M
3300014839|Ga0182027_10028159All Organisms → cellular organisms → Bacteria7338Open in IMG/M
3300014839|Ga0182027_10156116Not Available2683Open in IMG/M
3300014839|Ga0182027_10474337Not Available1372Open in IMG/M
3300014968|Ga0157379_10708717All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae945Open in IMG/M
3300015374|Ga0132255_101052220All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1222Open in IMG/M
3300016341|Ga0182035_10268402All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1386Open in IMG/M
3300016341|Ga0182035_12109172Not Available512Open in IMG/M
3300016357|Ga0182032_10248580All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1381Open in IMG/M
3300016357|Ga0182032_10363737All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41161Open in IMG/M
3300016371|Ga0182034_12035339All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4507Open in IMG/M
3300016445|Ga0182038_11420833Not Available622Open in IMG/M
3300016750|Ga0181505_10930179All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4692Open in IMG/M
3300017823|Ga0187818_10235919All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae799Open in IMG/M
3300017924|Ga0187820_1254772Not Available565Open in IMG/M
3300017929|Ga0187849_1386390All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4513Open in IMG/M
3300017931|Ga0187877_1230083All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4720Open in IMG/M
3300017988|Ga0181520_10324212All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41143Open in IMG/M
3300017996|Ga0187891_1009387All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5357Open in IMG/M
3300018002|Ga0187868_1074713All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1369Open in IMG/M
3300018004|Ga0187865_1282335Not Available550Open in IMG/M
3300018008|Ga0187888_1151721All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae947Open in IMG/M
3300018021|Ga0187882_1388488Not Available530Open in IMG/M
3300018024|Ga0187881_10485767Not Available502Open in IMG/M
3300018026|Ga0187857_10129767All Organisms → cellular organisms → Bacteria → Acidobacteria1209Open in IMG/M
3300018033|Ga0187867_10160784All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1289Open in IMG/M
3300018034|Ga0187863_10879145All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4509Open in IMG/M
3300018038|Ga0187855_10379366All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae824Open in IMG/M
3300018040|Ga0187862_10825450All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4536Open in IMG/M
3300018043|Ga0187887_10389946All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae822Open in IMG/M
3300018047|Ga0187859_10836961All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4529Open in IMG/M
3300018057|Ga0187858_10735447All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4587Open in IMG/M
3300018057|Ga0187858_10959687All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4501Open in IMG/M
3300019188|Ga0184599_138359Not Available534Open in IMG/M
3300019788|Ga0182028_1215769All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2334Open in IMG/M
3300020583|Ga0210401_10607446All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae955Open in IMG/M
3300021404|Ga0210389_10955012Not Available666Open in IMG/M
3300021404|Ga0210389_11198943All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4584Open in IMG/M
3300021405|Ga0210387_11386671Not Available605Open in IMG/M
3300021475|Ga0210392_10830171Not Available691Open in IMG/M
3300021559|Ga0210409_10920562All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae748Open in IMG/M
3300025454|Ga0208039_1031712All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1035Open in IMG/M
3300025906|Ga0207699_10796605All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4695Open in IMG/M
3300025906|Ga0207699_11369601All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4523Open in IMG/M
3300025937|Ga0207669_11509731All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4573Open in IMG/M
3300026035|Ga0207703_10557601All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41081Open in IMG/M
3300026551|Ga0209648_10057656All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3303Open in IMG/M
3300027045|Ga0207726_1013394Not Available1356Open in IMG/M
3300027842|Ga0209580_10557492All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4569Open in IMG/M
3300027854|Ga0209517_10118019All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1752Open in IMG/M
3300027857|Ga0209166_10239532All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae966Open in IMG/M
3300027862|Ga0209701_10687191All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4529Open in IMG/M
3300027884|Ga0209275_10320436All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae864Open in IMG/M
3300027889|Ga0209380_10578761All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4651Open in IMG/M
3300027898|Ga0209067_10000102All Organisms → cellular organisms → Bacteria → Acidobacteria56619Open in IMG/M
3300027903|Ga0209488_10858755Not Available639Open in IMG/M
3300027911|Ga0209698_10649269All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae807Open in IMG/M
3300028381|Ga0268264_12664660Not Available504Open in IMG/M
3300028747|Ga0302219_10349704Not Available577Open in IMG/M
3300029944|Ga0311352_11354982Not Available536Open in IMG/M
3300029993|Ga0302304_10313614Not Available573Open in IMG/M
3300029999|Ga0311339_11163724All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4709Open in IMG/M
3300030054|Ga0302182_10381492Not Available591Open in IMG/M
3300030057|Ga0302176_10218997All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae760Open in IMG/M
3300030580|Ga0311355_10674680All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae965Open in IMG/M
3300030617|Ga0311356_11944221Not Available521Open in IMG/M
3300030730|Ga0307482_1049894All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1014Open in IMG/M
3300030913|Ga0265759_108685Not Available560Open in IMG/M
3300031028|Ga0302180_10058520All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2301Open in IMG/M
3300031099|Ga0308181_1104069All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4617Open in IMG/M
3300031241|Ga0265325_10306299All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4708Open in IMG/M
3300031525|Ga0302326_11303376All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae990Open in IMG/M
3300031545|Ga0318541_10090461All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1631Open in IMG/M
3300031546|Ga0318538_10252297All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4948Open in IMG/M
3300031546|Ga0318538_10284645All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae890Open in IMG/M
3300031573|Ga0310915_10939792Not Available605Open in IMG/M
3300031680|Ga0318574_10240974All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1045Open in IMG/M
3300031682|Ga0318560_10489046All Organisms → cellular organisms → Bacteria → Acidobacteria667Open in IMG/M
3300031747|Ga0318502_10349305All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae875Open in IMG/M
3300031753|Ga0307477_10016952All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4974Open in IMG/M
3300031771|Ga0318546_10459791All Organisms → cellular organisms → Bacteria → Acidobacteria892Open in IMG/M
3300031781|Ga0318547_10467261All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae778Open in IMG/M
3300031796|Ga0318576_10319219All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4734Open in IMG/M
3300031833|Ga0310917_10627211All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae729Open in IMG/M
3300031912|Ga0306921_12292770Not Available566Open in IMG/M
3300031941|Ga0310912_11515849All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4504Open in IMG/M
3300031946|Ga0310910_10093324All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2220Open in IMG/M
3300032035|Ga0310911_10182333All Organisms → cellular organisms → Bacteria1190Open in IMG/M
3300032039|Ga0318559_10504863All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4564Open in IMG/M
3300032043|Ga0318556_10569842All Organisms → cellular organisms → Bacteria → Acidobacteria591Open in IMG/M
3300032059|Ga0318533_10534746All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae859Open in IMG/M
3300032068|Ga0318553_10129055All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1303Open in IMG/M
3300032076|Ga0306924_10348075All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1699Open in IMG/M
3300032119|Ga0316051_1002684All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1190Open in IMG/M
3300032119|Ga0316051_1025835All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4560Open in IMG/M
3300032160|Ga0311301_10054604All Organisms → cellular organisms → Bacteria8980Open in IMG/M
3300032160|Ga0311301_10313249All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2498Open in IMG/M
3300032421|Ga0310812_10371713All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4641Open in IMG/M
3300032783|Ga0335079_10409134All Organisms → cellular organisms → Bacteria → Acidobacteria1461Open in IMG/M
3300032783|Ga0335079_12127924Not Available537Open in IMG/M
3300032828|Ga0335080_10134956All Organisms → cellular organisms → Bacteria → Acidobacteria2736Open in IMG/M
3300032828|Ga0335080_11418260All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia690Open in IMG/M
3300033290|Ga0318519_10775500Not Available589Open in IMG/M
3300033513|Ga0316628_103531557All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4564Open in IMG/M
3300033823|Ga0334837_047689Not Available1127Open in IMG/M
3300033890|Ga0334810_186813Not Available502Open in IMG/M
3300034163|Ga0370515_0017603All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3310Open in IMG/M
3300034681|Ga0370546_005338All Organisms → cellular organisms → Bacteria1346Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.62%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland11.11%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland5.26%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.68%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.68%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog4.09%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.09%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen3.51%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.34%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.34%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.92%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.92%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.75%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.75%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.17%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.17%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.17%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.17%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.17%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.17%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.17%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.58%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.58%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.58%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.58%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.58%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.58%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.58%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.58%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.58%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.58%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.58%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.58%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.58%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.58%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.58%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.58%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573000Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms)EnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004401Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004631Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009616Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100EnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009637Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300019188Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZE2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300025454Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027045Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029993Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030054Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030730Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030913Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA6 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031099Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032119Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033823Peat soil microbial communities from Stordalen Mire, Sweden - 714 S3 30-34EnvironmentalOpen in IMG/M
3300033890Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-MEnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M
3300034681Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
N55_039220702189573000Grass SoilTSVFGFDRQKSLRTALKRLIAGVESQHCNSIEITQVVDKSFWKVPYVSVSAHPRNLQKGICFSAMGPAPIRH
C688J18823_1060391323300001686SoilEKAVQEAGWSFFFMAGEIKATVFGFDRQKALRAAFKRLIVDVKSQRCNGIEITQITDGSFCRFPYVSVSAHARHLQNGMRFSG*
Ga0062389_10289566223300004092Bog Forest SoilGWAPVNQGRPAFDKTVHDAGWTFFFLAGEIRANCFGFDRQKALRGALHQLTNGVKSHHCNSIEISGVTSKSFLRFPYVHVSAHMRHLQKGMLLGS*
Ga0062593_10328917013300004114SoilAVKIAHSAFEREVQAAGWTFFFMAGVIKSTVFGFDRQKRLGEALARLLTSVKSQHCNSIEITQVTEKSFLKVPYVTMSAHARHLQKGLQFVQR*
Ga0062590_10109458513300004157SoilESNSNGWAALTGTRSTFEKAIQEAGWTFFFMAGELKTTVFGFDRQKALGVALKRLIVDVKSQHCNGIEITQIINQSFCRLPYVSVSAHPRHLQKGMRFSG*
Ga0068980_114887813300004401Peatlands SoilMAGEIKATVFGFDKPKALRAAVKRLITDVKSQHCNSIEITRVVGKSFLRVPYVSVSAHARHLQKGMFFPG*
Ga0058899_1183365333300004631Forest SoilIKTTVFGFDREKAMSTALHRLIANVKTQRCNSIEITQVTDSSFLKMPYVSVCAHPRHLQQGLTFSGQR*
Ga0058899_1205259913300004631Forest SoilAFEKEVSEAGWTFFFMAGAIHATVFGFDRQKSLRAALRRLITNVKSHNCNAIEITQVSVKSFLKVPYVSVSAHARHLQKDLTFAGQIFADAI*
Ga0062388_10211694123300004635Bog Forest SoilYSSGWAALRNPGSLAAEIKGWTFFFMAGEIKSTVFGFDRQKTLGAALKRLVTSVKLTRCNSFEITQVTSKSFLKVPYVCITAHRRHLQKGLVFSCP*
Ga0066671_1033061533300005184SoilFGFDRQKALRAAMKQLIADVKSQHCNSIEITRVVAKSFLSLPYLSISAHPRHLQKGMLFSANGGPRSGIRLTGSI*
Ga0066675_1080504313300005187SoilGFDRQKALRTALKRLATNVKAQHCNSIEITQVLGKSFLSVPYVSVSAHPRHLQKGVSFLRLTQSKWRLTAS*
Ga0070689_10111313113300005340Switchgrass RhizosphereTVFGFDRENALHAALKRLMADAKSQHCNSIEITQILDKSLWRVPYVSVSAHARHLQKGMCFSG*
Ga0070709_1149013113300005434Corn, Switchgrass And Miscanthus RhizosphereMAGEIKTTVFGFGSKKALRAALKRIIAEVKSQHCNSFEITRVVGKSFLKVPYVSVFAHPLHLQKGICFPVNGAGSDPVLFHRRNLQRG*
Ga0070713_10020360213300005436Corn, Switchgrass And Miscanthus RhizosphereAAVKDNLSTFEKAVEEAGWTCFFMAGEIKVTVYGFDRQKALRAALKRLVMDVESQHCNTIEITAVVGKSFWRIPYVSVSAHARHLQKDRFFSGSNPALSSLAHSNGD*
Ga0070734_1068487013300005533Surface SoilWTFFFMAGEMKATVFGFDRQETLRTALKRLIADVRSQHCNCIEIAGVVNKTFLRMPYVSVSAHARHLQKGPLFSGSKLDSARLSCSLPRL*
Ga0070684_10079520633300005535Corn RhizosphereGWTFFFMAGEIKTTVFGFDREKALRTALRRLIADAKTQKCNGLEITHVTDKSFLKMPYVTVSAHPRHLQKGATFSGSDSFKLNSR*
Ga0070684_10115326413300005535Corn RhizosphereLFFMAGEIKTTVFGFDRQHALRAALKRLVAVVNSQHCNGIEITRVTDKSFLKVPYVSVS
Ga0070733_1071653023300005541Surface SoilWTFFFMAGEMKTSVFGFDRQKALHAALNRLTTNAKSQRCNSIEITRDMDKSFLRIPYVSVSAHPRHLQRGICFSG*
Ga0070686_10077318113300005544Switchgrass RhizosphereIQEAGWTFFFMAGELKTTVFGFDRQKALGVALKRLIVDVKSQHCNGIEITQIINQSFCRLPYVSVSAHPRHLQKGMRFSG*
Ga0068857_10217012713300005577Corn RhizosphereEIRATIFGFDRQKSLSRALSGLMTAVKAQNCNGIEITRIADKSFLGVPSVSVYAHARHLQKGLVFSGQQ*
Ga0070761_1077689623300005591SoilNGARPAFESEIREAGWTFFFMAGEIRSAVFGFDKQKTMRTALSRLIANVKSQNCNGIEITQVADKTFLGVPYVSVSAHARHLQKGLTFSGQQLNGSI*
Ga0068858_10068814513300005842Switchgrass RhizosphereNGWSAVTDERTAFEKEVEKAGWTFFFMAGEIKVTVFDFDRQKALRAAWNRLIANVKSQHCNCIQITRVTGKSFLRVPYLSIYAHPRHLQKGAVFLRQGYSV*
Ga0068858_10229230413300005842Switchgrass RhizosphereTRPTFEKAIQEAGWTFFFMAGEIKTTVFGYDRPKALRAALNRLIVDVKSQHCNGIEITQILDRSFCSVPYVTVSAHPRHLQKGMQFSG*
Ga0068860_10270362923300005843Switchgrass RhizosphereRQKALGVALKRLIVDVKSQHCNGIEITQIINQSFCRLPYVSVSAHPRHLQKGMRFSG*
Ga0080026_1023970413300005952Permafrost SoilMAGEIKISVFGFDKQKALHTALERLITNVKSHQCNSMEITHVTDKSFLKLPYVCVTAHLRHLQKGSVFAGAAMQPLA*
Ga0075029_100001096183300006052WatershedsMAGEIEATAFGFDGQKTLGAALSRLTRNAAAQHCNSIEITHVARKSFLKVPYVCVSAHARHFQKGLAFSG*
Ga0075029_10131995223300006052WatershedsGWSFFFMAGQIKSTVFGVDREKALQTALKRLMADARSQHCNSIEITQIPDKSPWRVPYVSVSVDARHLQKGMCFSS*
Ga0075030_10111748413300006162WatershedsQKALRAALKRLIGDVRSQRCNSIEITRVMDRSFLRMPYVSVSAHPRHLQRGVLFSG*
Ga0068871_10148541323300006358Miscanthus RhizosphereAFEETIHEEGWTLFFMAGEIKATVFGFDRQNALGAALKRLIAAVKSQHCNSIEITGVVDKSFLKVPYVSVSAHARHLQKGRLFSSVETGS*
Ga0075425_10070729633300006854Populus RhizosphereFGFDRPKSLRRALSRLIANVKSQDCNGIEITGITRKSFLKLPYVTVYAHPRHLQRGLVFSGRR*
Ga0099830_1087245023300009088Vadose Zone SoilFDRQKALRAALKRLITDVKSQHCNSIEITRVMGKSFLSVPYVSVSAHPRHLQKGMVFSG*
Ga0099827_1139114223300009090Vadose Zone SoilMGSGQRRTSTFEKAIREAEWTFSFMAGEIKTTVFGFDRQKAVRAALKRLIAEVKSQHCNSIEITRVVDKSFLSVPYVSVSAHLRHLQKGLVFLGRQ*
Ga0099792_1109127023300009143Vadose Zone SoilSTFEKTIQEAGWTFFFMAGEIKATVFGFDRQKALRAALMRLMADVKSQHCNSIEITRVIGKSFLKVPYVSVSAHPRHLQKGMFFTG*
Ga0105242_1208805213300009176Miscanthus RhizosphereKAIQEAGWTFFFMAGELKTTVFGFDRQKALGVALKRLIVDVKSQHCNGIEITQIINQSFCRLPYVSVSAHPRHLQKGMRFSG*
Ga0116107_118770623300009548PeatlandFEKEVREAGWTFFFMAGEIKATAFGFDRQKTLRAALKRLIGKVESQNCNSIEITQVTGKSFLKLPYVSVSAHPRHLQKGLVFDQAFYNAI*
Ga0116111_112947213300009616PeatlandSTFEKEVPEAGWTFFFMAGEIKATVFGFDKQKTRGAALERLIKSVKSQKCNSIEITQVKDNSFLKVPYVSVSAHPRHLQKGLVFSGQG*
Ga0116125_120474013300009628PeatlandPRAPDSSGWTALNVTRSAFETEVREAGWTFFFMAARIKTAAFGFDKQKTLRTALERLIANAKSHHYNGIEITQIVSKTFLKMPYVSVSAHARHLQKGLTFSG*
Ga0116118_118270133300009637PeatlandGFDRQKTLRTALQRLIAKVTSQHCNSIEITQVMSNSFLKVPYVSVSARPRHLQKGLTFSGQR*
Ga0116118_119142123300009637PeatlandTRSGFEKGIRDAGWTFFFMAGEIKTTVFAFDKQKALRAALRRLIANAKSQHCNSIEITGVAGKSFLKTPYMTVSAHPRHLQKGLVFSVNGSLP*
Ga0116122_126690613300009639PeatlandVQNARSTFEKEVPAAGWTFFFMAGEIKATVFGFDKQKTRRAALKRLIGNVKSQSCNSIEITQVTDSSFLKVPYVSVSAHPRHLQKGLVFSGQRQ*
Ga0116121_128515023300009644PeatlandGWTFFFLAGEIKATVFGFDRQKTLRDALKRLIANVKSHDCNSIEITQVSNKSFLKVPYVSVSAHVRHLQKGLVFSGRA*
Ga0116135_140394023300009665PeatlandFFMAGLIKTTVFGFDRQKTLRVALRRLIRNVKSHNCNAIEIAEVTAKSFLKLPYVSVSAHARHLQKGRTFHEPIPAGSI*
Ga0136449_10036564033300010379Peatlands SoilFFFMAGEIKATVFGFDKPKALRAALKRLITDVKSQHCNSIEITRVVGKSFLRVPYVSVSAHARHLQKGMFFPG*
Ga0136449_10141556613300010379Peatlands SoilFDRQKTLRTALQRLIAKVKSRDCNSIEITRVTGKSFLGMPYVTVSAHPRHLQKGLVFAAHLS*
Ga0136449_10405408513300010379Peatlands SoilTFLFMAGEIKTVAIGFNKQKTLGAALKRLIANVKSQHCNSIEITQVARRTFLKVPYVSVSAHPRHLQKGLVFSGRA*
Ga0134124_1189563223300010397Terrestrial SoilFIAGEIKATVFGFDRQKALRGALKRLTADVKSQHCNSIEITRVKSNSLLRVPYVSVAAHPRHLQKGMYFSG*
Ga0134127_1257392223300010399Terrestrial SoilQAIQEAGWSFFFMAGEIKTTVFGFDRENALHAALKRLMADAKSQHCNSIEITQILDKSLWRVPYVSVSAHARHLQKGMCFSG*
Ga0150983_1120905913300011120Forest SoilARSTFEKTIQEAGWTFFFMAGEIKATVFGFDRQKALRAALKRLIADVKSQHCNSIEITRVIRRSFLRVPYVSVSAHPRHLQKGMLFSG*
Ga0137389_1044186033300012096Vadose Zone SoilFGFDRQKALRAALKRLITDVKSQHCNSIEITRVMGKSFLSVPYVSVSAHPRHLQKGMVFSG*
Ga0137383_1104592113300012199Vadose Zone SoilVPRFEKAIQEAGWTFFFMAGKIKATVFGFDRQKALRAALKRLIADVKSQHCNSIEITWVTDKSFFKVPYVSVSAHPRHLQKGMLFSG*
Ga0137379_1174716423300012209Vadose Zone SoilEKTIQEEGWTFFFMAGEIKTTVFGFDKQKALRTALKRLIADVKSQHCNSIEITRVVGKSFLSVPYVSVSAHPRHLQKGMLFSG*
Ga0164303_1142457113300012957SoilGWAAVKISHSGFEREVQAAGWTFFFMAGVIKSTVFGFDRQKRLGEALARLLTSVKSQHCNSIEITQVTEKSFLKVPYVTMSAHARHLQKGLQFVQR*
Ga0181533_121752513300014152BogEKEVPAAGWTFFFMAGEIKTTVFGFDKQKMRGAALEQLIKSVKLQKCNSIEITQVKDNSFLKVPYVSVSAHPRHLQKGLVFSGQG*
Ga0181527_121784913300014153BogTFEKEVPAAGWTFFFMAGEIKATVFGFDKQKMRGAALERLIKSVKLQKCNSIEITQVKDNSFLKVPYVSVSAHPRHLQKGLVFSGQG*
Ga0134075_1041714923300014154Grasslands SoilRAALKRLIADVKSQHCNSIEITRVMSKSFLKVPYVSVSAHPRHLQKGMLFSG*
Ga0181524_1037525323300014155BogEAGWTWFFMAGEIKTTVFGSDRQETLRTALQRLVAKVKSQHCNSIEITQVTSNSFLKMPYVSVSAHPRHLQRGLTFSGQL*
Ga0181518_1019790713300014156BogIKATAFGFDRQKTLRAALKRLIGKVQSQNCNSIEITQVTGESFLKLPYVSVSAHPRHLQKGLVFDQAFYNAI*
Ga0181523_1037966333300014165BogFFFLAGEIKTTVFGFDKQKTLRAALKRLIANVKSKHCNSIEITRAADKSFLKVPYVSVTAHPRHLQKGLVFSGQA*
Ga0181526_1109112413300014200BogTTVFGFDREKAMSTALGRLIANVKEQKYNSIEITQVTGSSFLKVPYVSVCAHPRHLQKGMTFGG*
Ga0182014_1016289913300014491BogEAGWTFFFMAGEIKATVFGFDRQKTLRAALKRLIKNVKSQNCNSIEITQVTGRSFLKLPYVRVSAHPRHLQKGLIFDQAFYNSI*
Ga0182017_1016525633300014494FenLGGWAAVQSARSAFEKEVREAGWTFFFMAGEIKATVFGFDRQKTLRTALKRLIANVKSQNCNSIEITQVTGKSFLRLPYVSVSAHPRQLQKGLVFDQAFYNSV*
Ga0182017_1074227613300014494FenKEVRAAGWTFFFMAGEIKTTVFGFDRQKTLRAALQRLIRNVKSQNCNSIEITQVTGKSFLKLPYVSVSAHPRHLQKGMVFHQAFYNSI*
Ga0182015_1038016513300014495PalsaAVFGFDKHQTLRTALKRLIANAKSQNCNGIEITQVTEKTFLKVPYVRVSAHARHLQKGLIFSGQPITDSI*
Ga0182027_1002815943300014839FenLGGWAAVQSARQAFEKEVREAGWTFFFMAGEIQATVFGFDRQKTLRTALKRLIANVKSQNCNSIEITQVTGKSFLKLPYVSVSAHPRHLQKGLVFDQAIYNSV*
Ga0182027_1015611613300014839FenALKRLIANVKSQNCNSIEITQVTGKSFLKLPYVSVSAHPRHLQKGMVFHQAFYNSI*
Ga0182027_1047433723300014839FenMAGEIKTTVFGFDRQKTLRAALQRLIANVKSQNCNSIEITQVTGKSFLKLPYVSVSAHPRHLQKG
Ga0157379_1070871713300014968Switchgrass RhizosphereRAGEIKTTVFGFDREKALHAALKRLMADAKSQHCNSIEITQILDKSLWRVPYVSVSAHARHLQKGMCFSG*
Ga0132255_10105222033300015374Arabidopsis RhizosphereATAFGFDRPKSLRRALSRLIANVKSQDCNGIEITGITRKSFLKLPYVTVYAHPRHLQRGLVFSGRR*
Ga0182035_1026840213300016341SoilNGWAVVKDNPSTFEKTVEEAGWTFFFMAGEIKTTVFGFDKQKALRAALKRLITDVKSRDCNSIEITRVVGKSSLRIPYVTLSAHARHLQKGRLFSGSNPALPSLAHLNRG
Ga0182035_1210917223300016341SoilFFFMAGEIKTTVFGFDKQKALRAALKRLITDVKSRDCNSIEITRVVDKSFLRIPYLTVSAHARHLQKGRFFSGPNPALPSLGDLNGG
Ga0182032_1024858033300016357SoilEWMGSEVKDNPSAFEKTVEEAGWTFFFMAGEIKTTVFGFDKQKALRAALKRLITDVKSRDCNSIEITRVVVKSFLRIPYLTVSAHARHLQKGRFFSGPNPALPSLGDLNGG
Ga0182032_1036373723300016357SoilMGSEVKDNPSAFEKTVEEAGWTFFFMAGEIKTTVFGFDKQKALRAALKRLITDVKSRDCNSIEITRVVDKSFLRIPYLSVSAHARYLQKGRFFSGSNPALPSLGHLNGG
Ga0182034_1203533923300016371SoilFEKTVEEAGWTFFFMAGEIKTTVFGFDKQKALRAALKRLITDVKSRNCNSIEITRVVDKSFLRIPYLSVSAHARHLQKGRLFSGSNPALPSLGHLNGG
Ga0182038_1142083313300016445SoilEIKTTVFGFDKQKALRAALKRLITDVKSRDCNSIEITRVVDKSFLRIPYLSVSAHARHLQKGRFFSGSNPALPSLGHLNGG
Ga0181505_1093017923300016750PeatlandGWTFFFMAGEIKATAFGFDRQKTLRAALKRLIGKVQSQNCNSIEITQVTGESFLKLPYVSVSAHPRHLQKGLVFDQAFYNAI
Ga0187818_1023591933300017823Freshwater SedimentFFLAGKIKSTVFGFDRQRALRTALKRLIANVKSHHCNGIEIAQVTEKTFLKVPYVSVSAHARHLQKGLTFSGQAITDSF
Ga0187820_125477213300017924Freshwater SedimentGWTFFFMAGEIQATVFGFDKQAALRTALKRLIADVKSQHCNSIEITGVVGKSFWRIPYVCVSAHARHLQKDGLFSGSSLALPSLIHPNGG
Ga0187849_138639013300017929PeatlandMAGEIKTTVFAFDKQKALRAALRRLIANAKSQHCNSIEITGVAGKSFLKTPYMTVSAHPRHLQKGLVFSVNGSLP
Ga0187877_123008333300017931PeatlandFGFDRQKTLRAALKRLIGKVESQNCNSIEITQVTGKSFLKLPYVSVSAHPRHLQKGLVFDQAFYNAI
Ga0181520_1032421233300017988BogAGEIKATVFGFDRQKTLRTALKRLIANVKSQNCNSIEITQVTGESFLKLPYVSVSAHPRHLQKGLVFQQAFYNSI
Ga0187891_100938713300017996PeatlandVPEAGWTFFFMAGEIKATVFGFDKQKTRGAALERLIKSVKSQKCNSIEITQVKDNSFLKVPYVSVSAHPRHLQKGLVFSGQG
Ga0187868_107471313300018002PeatlandAGWTFFFMAGEIKTTVFAFDKQKALRAALRRLIANAKSQHCNSIEITGVAGKSFLKTPYMTVSAHPRHLQKGLVFSVNGSLP
Ga0187865_128233523300018004PeatlandTWFFLAGEIKTTVFGFDRRKTLRTALRRLIAKVTSQHCNSIEIAQVTSNSFLKVPYVSVSAHPRHLQKGLTFSGQR
Ga0187888_115172133300018008PeatlandSTVFGFDKQKARRTAPKRLIANVKTHHCNGIEIAQVTEKTFLKVPYVSVSAHPRHLQQGLCFRPGVV
Ga0187882_138848813300018021PeatlandAIRSALKRLIADVKSQHCNSIEITQVIGKTFLSLPYVSVFAHPRHLQKALVFCGQS
Ga0187881_1048576723300018024PeatlandDRRKTLRTALRRLIAKVTSQHCNSIEIAQVTSNSFLKVPYVSVSAHPRHLQKGLTFSGQR
Ga0187857_1012976733300018026PeatlandMVTNPRSAFDIGIQAAGWTLFFMAGEVRATVFGFDRQKTLGTALTRLIANAKAQNCNGIEITQVTDKSFLKIPYVSVSAHARHFQEGLVFTGRR
Ga0187867_1016078413300018033PeatlandLSLGKPDSNGWTALNGARSAFETEIREAGWTFFFLAGAIKSTVFGFDKHKALRTALKRLIANVKTHNCNGIEIAQVTENTFLKVPYVSVSAHARHLQKGLTFSGRSLTDSF
Ga0187863_1087914523300018034PeatlandAGWTLFFMAGEIKATVFGSDKQKNLRAALKRLVGMVKSQGCNSIEITDVTEESFLTLPYVRVSAHARHLQSSLIFSRRP
Ga0187855_1037936633300018038PeatlandRETGWTFFFMAGEIKATAFGFDKQKSLRGALKRLIGNVKSQHCNSIEITQVTSKSFLSVPYVSVTAHPRHLQKGVVFSPK
Ga0187862_1082545013300018040PeatlandWATLNGARSKFEKEVRQAGWTFFFMAGEMHATVFGFDRQKTLRAALQRLTANAKSHNCNAIEITQVAVKSFLKVPYLSVSAHARHLQKGLIFSGQPFTDSI
Ga0187887_1038994633300018043PeatlandDAGPTFEKAIREADWNFFFMAGEIRSTVFGFDGQKALGAALKRLIANVKSQNCNSIEITKVTRNSFLKVPYVSVSAHARHLQKGLVFSSQQ
Ga0187859_1064639923300018047PeatlandQKTLGTALTRLIANAKAQNCNGIEITQVTDKSFLKIPYVSVSAHARHFQEGVVFTGRR
Ga0187859_1083696123300018047PeatlandWTLFFMAGDIKTTVFGFDRQRTLRSALKRLVAMVKSQSCNSIEITHLVEKSFLKVPYISVWAHARHLQRGQGLVFSGSR
Ga0187858_1073544713300018057PeatlandKEVPEAGWTFFFMAGEIKATVFGFDKQKTRRAALKRLIGNVKSQSCNSIEITQVTDSSFLKVPYVSVSAHPRHLQKGLVFSGQRQ
Ga0187858_1095968723300018057PeatlandFFFMAGEIKTTVFAFDKQKALRAALRRLIANAKSQHCNSIEITGVAGKSFLKTPYMTVSAHPRHLQKGLVFSVNGSLP
Ga0184599_13835923300019188SoilAGRVKTAVFGFDKEKALRTALKRLIANVKSHHCNGIEIEQVTEKTFLKLPYMSVSAHARHLQKSSTFSS
Ga0182028_121576933300019788FenVRAAGWTFFFMAGEIKTTVFGFDRQKTLRVALKRLIANVKSQNCNSIEITQVTGKSFLKLPYVSVSAHPRHLQKGHGLPPSFLQLNLTGG
Ga0210401_1060744613300020583SoilEIRSTVFGFDREKAMNTALHRLISNVKSQDYNGIEITQVTGSSFLKMPFVSVSAHPRHLQKGLTLSSQR
Ga0210389_1095501233300021404SoilGEIKTTVFGFDRQKALSTALNRLIANVKAQKCNSIEITQVLGNSFLKVPYVSVTAHPRHLQQGLTFTGQQ
Ga0210389_1119894313300021404SoilEKTIQEAGWTFFFMAGEIKATVFGFDRQKALRTALRRLIVDVKAQHCNSIEITQVTSKSFLNVPYVSVMAHPRHLQMGLLFSDNGNLL
Ga0210387_1138667123300021405SoilLSAAVKQLTTKARVQHCNSIEITRIMRKSFLKVPYVCVTAHTRHLQRGLAFSG
Ga0210392_1083017113300021475SoilVQKAGWTFFFMAGETKATVFGFDRQKTLSAAVKQLTTKARVQHCNSIEITRIMRKSFLKVPYVCVTAHTRHLQRGLAFSG
Ga0210409_1092056233300021559SoilAVKQLTTKARVQHCNSIEITRIMRKSFLKVPYVCVTAHTRHLQRGLAFSG
Ga0208039_103171213300025454PeatlandGRSAFEKEIQGAGWTLFFMAGEIKTTVFGFDKQKTLSTAVKRLIANVKSHNCNGIEITQVTNKTFLKVPYVSVSAHARHLQKGLTFSG
Ga0207699_1079660523300025906Corn, Switchgrass And Miscanthus RhizosphereMAGEIKTTVFGFGSKKALRAALKRIIAEVKSQHCNSFEITRVVGKSFLKVPYVSVFAHPLHLQKGICFPVNGAGSDPVLFHRRNLQRG
Ga0207699_1136960113300025906Corn, Switchgrass And Miscanthus RhizospherePYSGEWLTVTDERTAFEKEVEKAGWTFFFMAGEIKVTVFDFDRQKAVRAAWKRLIANVRSQGCNCIQITRIIGKSFLGVPYLSICAHPRHLQKGLVFSKQG
Ga0207669_1150973113300025937Miscanthus RhizosphereTGTRSTFEKAIQEAGWTFFFMAGELKTTVFGFDRQKALGVALKRLIVDVKSQHCNGIEITQIINQSFCRLPYVSVSAHPRHLQKGMRFSG
Ga0207703_1055760123300026035Switchgrass RhizosphereNGWSAVTDERTAFEKEVEKAGWTFFFMAGEIKVTVFDFDRQKALRAAWNRLIANVKSQHCNCIQITRVTGKSFLRVPYLSIYAHPRHLQKGAVFLRQGYSV
Ga0209648_1005765643300026551Grasslands SoilMAGEIKATVFGFDRQKALRAALERLIADVKSQHCNSIEITRVIGKSFLKVPYVSVSAHPRHLQKGMFFPG
Ga0207726_101339413300027045Tropical Forest SoilWTFFFMAGEIKATVFGFERQKALRAALKQLITDVKSQHCNSIEITRIMGKSFLGVPYVSVSAHPRHLQRGVIFSG
Ga0209580_1055749213300027842Surface SoilIQEAGWTFFFIAGEIKTTVFGIDRQKILRAAMKRLIANAKSQHCNSIEITLVDVKSLLKVPYVSVSAHPRHLQKGLVFSG
Ga0209517_1011801933300027854Peatlands SoilGWAEVTDVHSTFGKEIPDAGWTFFFMAGEIKTTVFGFDREKALGTALGRLIANVKGQNCNCIEITQVTGNSFLKVPYVSVTAHPRHLQQGQTFTGKR
Ga0209166_1023953213300027857Surface SoilGFDQEIQAAGWTLFFMAAELKATVFGFDKQKTRVAACKRLIAGAKTQHCNSIEITGVVDKSFLRMPYLSVSAHARHLQKGRLFSGCNPALASLAHLNGG
Ga0209701_1068719113300027862Vadose Zone SoilSNGWAAVKDVRATFEKAIQQTGWTFFFMAGEIKTTVFGFDRQKALRAALKRLITDVKSQHCNSIEITRVMGKSFLSVPYVSVSAHPRHLQKGMVFSG
Ga0209275_1032043613300027884SoilGWTFFFMAGEVRTTVFGFDPQKNLHAALKRLIANVKSQHCNSIEITQVTRKSFLKVPYVSVSAHARHLQKGLVFAPE
Ga0209380_1057876113300027889SoilVFRKSGYAKPLPWLSIALPNIGALNGARPAFESEIREAGWTFFFMAGEIRSAVFGFDKQKTMRTALSRLIANVKSQNCNGIEITQVADKMFLGVPYVSVSAHARHLQKGLTFSGQQLNGS
Ga0209067_10000102643300027898WatershedsMAGEIEATAFGFDGQKTLGAALSRLTRNAAAQHCNSIEITHVARKSFLKVPYVCVSAHARHFQKGLAFSG
Ga0209488_1085875523300027903Vadose Zone SoilKTIQEAGWTFFFMAGEIKATVFGFDRQKALRAALMRLMADVKSQHCNSIEITRVIGKSFLKVPYVSVSAHPRHLQKGMFFTG
Ga0209698_1064926933300027911WatershedsQKALRAALKRLIGDVRSQRCNSIEITRVMDRSFLRMPYVSVSAHPRHLQRGVLFSG
Ga0268264_1266466013300028381Switchgrass RhizosphereDRQKALGVALKRLIVDVKSQHCNGIEITQIINQSFCRLPYVSVSAHPRHLQKGMRFSG
Ga0302219_1034970423300028747PalsaGWTFFFLAGEIKATVFGFDRQKILRAAFKRLTANVKSHHCNAIEITQVAVKSFLKVPYVSVSAHARHLQKGLTFRGQILADSI
Ga0311352_1135498213300029944PalsaWTFFFMAGEIKATVFGFDKQKTLRAALKRLIANVKSQHCNSIEITQVTGKSFLKVPYVSVSAHPRHLQKGLVFSPK
Ga0302304_1031361413300029993PalsaFFFMAKTIETAVFGFDKHQTLRTALKRLIANAKSQNCNGIEITQVTEKTFLKVPYVRVSAHARHLQKGLIFSGQPITDSI
Ga0311339_1116372413300029999PalsaGWTALNGTRSAFETEVREAGWTFFFMAGKTRTAVFGFDKQKTLRTALKRLIANVKSQNCNGIEITQVIDKTFLKVPYVSVSAHARHLQKGLTFSG
Ga0302182_1038149223300030054PalsaTAFGFDKQKSLRGALKRLIGNVKSQHCNSIEITQVTSKSFLSVPYVSVTAHPRHLQKGVVFSPK
Ga0302176_1021899713300030057PalsaIKGWTFFFMAGEIKSTVFGFDRQKTLGAALKRLATSVKLTKCNSFEITQVTRKSFLKVPYVSITAHRRHLQKGLVFSCL
Ga0311355_1067468033300030580PalsaKEIRETGWTFFFMAGEIKATAFGFDKQKSLRGALKRLIGNVKSQHCNSIEITQVTSKSFLSVPYVSVTAHPRHLQKGVVFSPK
Ga0311356_1194422113300030617PalsaFFFMAGEIKSTVFGFDRQKTLGYALKRLITRVKLTKCNSFEISQVTSKSFLRVPYVSITAHRRHLQKGLVFSCS
Ga0307482_104989413300030730Hardwood Forest SoilNGWSAAKDNRSAFEKTVETAGWTFFFMAGEMKTSVFGFDRQKALHAALNRLTTNAKSQRCNSIEITQVMDKSFLRIPYVSVSAHPRHLQRGISFSG
Ga0265759_10868523300030913SoilAEIKGWTFFFMAGEIKSTVFGFDRQKTLGHALKRLIASVKLTKCNSFEITQVTRKSFLKVPYVSITAHRRHLQKGLVFSCS
Ga0302180_1005852033300031028PalsaTALNGTRSAFETEIREAGWTFFFLAGEIKSTVFGFDKQRALRTALKRLIANVKTHNCNGIDIAQVTEKTFLKVPYVSVTAHARHLQKGLTFSGQAITDSI
Ga0308181_110406913300031099SoilMAGQRLKAPSPQFVQAIQEAGWSFFFMAGEIKTTVFGFDREKALHAALKRLMADAKSQHCNSIEITQILDKSLWRVPYVSVSAHARHLQKGMCFSG
Ga0265325_1030629913300031241RhizosphereFGFDRQKTLRAALRRLTVNAESQRCNSIEILRVASKSFLGVPYVSVSAHPRHLQKGRTFQGHQ
Ga0302326_1130337613300031525PalsaEIKSTVFGFDRQKNLRNALRRLATQAKSHNCNGIEITQVTGKSFLKVPYVSVSAHARHLQKGLVFSGQPLNLNGG
Ga0318541_1009046113300031545SoilVEEAGWTFFFMAGEIKTTVFGFDKQKALRAALKRLITDVKSRDCNSIEITRVVVKSFLRIPYLTVSAHARHLQKGRFFSGPNPALPSLGDLNGG
Ga0318538_1025229713300031546SoilMGSEVKDNPSAFEKTVEEAGWTFFFMAGEIKTTVFGFDKQKALRAALKRLITDVKSRDCNSIEITRVVVKSFLRIPYLTVSAHARHLQKGRFFSGPNPALPSLGDLNGG
Ga0318538_1028464533300031546SoilFFMAGEIKTTVFGFDKQKALRAALKRLITDVKSRGCNSIEITRVVDKSFLRIPYLSVSAHARHLQKGRFFSGSNPALPSLGHLNGG
Ga0310915_1093979223300031573SoilGCTFFFMAGEIKTTVFGFDKQKALRAALKRLITDVKSRDCNSIEITRVVDKSFLRIPYLSVSAHARHLQKGRLFSGSNPALPSLGHLNGG
Ga0318574_1024097413300031680SoilEEAGWTFFFMAGEIKATVFGFDKQKALRAALKRLITDVKSRDCNSIEITRVVDKSFLRIPYLSVSAHARHLQKGRLFSGSNPALPSLGHLNGG
Ga0318560_1048904633300031682SoilRQKALRAALKQLITEVKSQHCNSIEITRIMGKSCLGVPYVSVSAHPRHLQRGVIFSG
Ga0318502_1034930533300031747SoilKDNPSAFEKTVEEAGWTFFFMAGEIKTTVFGFDKQKALRAALKRLITDVKSRDCNSIEITRVVVKSFLRIPYLTVSAHARHLQKGRFFSGPNPALPSLGDLNGG
Ga0307477_1001695253300031753Hardwood Forest SoilMAGEIKATGCGFDQHKALRAALKRLTADVKSQHCNSIEITRVIGKSFLRVPDVSVSAHLRHLQKGMLFPG
Ga0318546_1045979133300031771SoilMGSEVKDNPSAFEKTVEEAGWTFFFMAGEIKTTVFGFDKQKALRAALKRLITDVKSRDCNSIEITRVVDKSFLRIPYLSVSAHARHLQKARLFSGSNPALPSLGHLNGG
Ga0318547_1046726133300031781SoilFFMAGEIKTTVFGFDEQKALRAALKRLITDVKSRDCNSIEITRVVDKSFLRIPYLSVSAHARHLQKARLFSGSNPALPSLGHLNGG
Ga0318576_1031921933300031796SoilMGSEVKDNPSAFEKTVEEAGWTFFFMAGEIKTTVFGFDKQKALRAALKRLITDVKSRDCNSIEITRVVVKSFLRIPYLTVSAHARHLQKGRFFSGPNPALPSLG
Ga0310917_1062721113300031833SoilIKTTVFGFDKQKALRAALKRLITDVKSRDCNSIEITRVVVKSFLRIPYLTVSAHARHLQKGRFFSGPNPALPSLGDLNGG
Ga0306921_1229277023300031912SoilFDKQKALRAALKRLITDVKSRDCNSIEITRVVDKSFLRIPYLSVSAHARHLQKGRLFSGSNPALPSLGHLNGG
Ga0310912_1151584913300031941SoilMGSEVKDNPSAFEKTVEEAGWTFFFMAGEIKTTVFGFDKQKALRAALKRLITDVKSRDCNSIEITRVVVKSFLRIPYLTVSAHARHLQK
Ga0310910_1009332413300031946SoilKTTVFGFDKQKALRAALKRLITDVKSRDCNSIEITRVVDKSFLRIPYLSVSAHARHLQKARLFSGSNPALPSLGHLNGG
Ga0310911_1018233323300032035SoilMGSEVKDNPSAFEKTVEEAGWTFFFMAGEIKTTVFGFDKQKALRAALKRLITDVKSRDCNSIEITRVVDKSFLRIPYLSVSAHARHLQKGRFFSGSNPALPSLGHLNGG
Ga0318559_1050486313300032039SoilFEKAIHEEGWTFFFMAGEIKATVFGFDRQKALRAALKQLITDVKSQHCNSIEITRIMGKSFLGVPYVSVSAHPRHLQRGVIFSG
Ga0318556_1056984213300032043SoilFFFMAGEIKTTVFGFDKQKALRAALKRLITDVKSRDCNSIEITRVVVKSFLRIPYLTVSAHARHLQKGRFFSGPNPALPSLGDLNGG
Ga0318533_1053474633300032059SoilGFDKQKALRAALKRLITDVKSRDCNSIEITRVVDKSFLRIPYLSVSAHARHLQKGRLFSGSNPALPSLGHLNGG
Ga0318553_1012905533300032068SoilANGWAVVKEARSTFEKAIHEEGWTFFFMAGEIKATVFGFDRQKALRAALKQLITDVKSQHCNSIEITRIMGKSFLGVPYVSVSAHPRHLQRGVIFSG
Ga0306924_1034807513300032076SoilFFFMAGEIKTTVFGFDKQKALRAALKRLITDVKSRDCNSIEITRVVDKSFLRIPYLSVSAHARHLQKGRLFSGSNPALPSLGHLNGG
Ga0316051_100268433300032119SoilGFDRQKALSTALNRLIENVKTQKCNCIEITQVTGSSFLKVPYVSVTAHPRHLQQGLTFTGQQ
Ga0316051_102583523300032119SoilGKPDSNGWTALNGARSAFETEIREAGWTFFFMAGRVKTAVFGFDKEKALRTALKRLIANVKSHHCNGIEIEQVTEKTFLKLPYMSVSAHARHLQKSSTFSS
Ga0311301_1005460413300032160Peatlands SoilKEIPDAGWTFFFMAGEIKTTVFGFDREKALGTALGRLIANVKGQNCNCIEITQVTGNSFLKVPYVSVTAHPRHLQQGQTFTGKR
Ga0311301_1031324913300032160Peatlands SoilMAGYIKATVFWFDKPKALRAAVKRLITDVKSQHCNSIEITRVVGKSFLRVPYVSVSAHARHLQKGMFFPG
Ga0310812_1037171323300032421SoilTDERSAFAKEVEKAGLTLFYMAGEIKATVFGFDRPKSLRRALSRLIANVKSQDCNGIEITGITRKSFLKLPYVTVYAHPRHLQRGLVFSGRR
Ga0335079_1040913433300032783SoilTVFGFDRKKALSAALKRLIANAKSQHYNSIEITRVLGKSFLKIPYVSVSAYLRHLQKGVRFSG
Ga0335079_1212792423300032783SoilAGWTFFFMAGVIRATVFGFDRQKALRIALKRLIADVKSQHCNSIEITQVTNNSFLHVPYVTVVAHPRHLQKGSFFSRQ
Ga0335080_1013495633300032828SoilGAAVKGSRSTFQETVRDEGWIFFFMAGEIKTTVFGFDRKKALGAALKRLIANAKSQHCNSIEITRVLGKSFLKIPYLSVSAYLRHLQKGVRFSG
Ga0335080_1141826023300032828SoilDERSALEEELQKAGLTLFFMAGQIKATVFGFDVPKSLRRALSRLIANVKSQDFNAIEITRIASSSFLRLPYVTVYAHPRHLQKGLLFSARR
Ga0318519_1077550023300033290SoilVFGFDRQKALRAALKQLITDVKSQHCNSIEITRIMGKSFLGVPYVSVSAHPRHLQRGVIFSG
Ga0316628_10353155723300033513SoilGSLSTGWAAVQDARSTFEKEIREAGWTFFFMAGEIKSTVFGWDRQRTLRVALNRLITNARSQRCNSLEIARVMRKSFLRVPFVSVSAHPRHLQRGMLFSG
Ga0334837_047689_3_1943300033823SoilQEILRTALQRLIAKVKSRECNSIEITRVSGKSFLGVPYVTVSAHPRHLQKGLVFAAASSHPLE
Ga0334810_186813_1_1713300033890SoilALQRLIRNVKSQNCNSIEITQVTGRSFLKLPYVSVSAHPRHLQKGMVFHQAFYNSI
Ga0370515_0017603_3006_33083300034163Untreated Peat SoilPGSNGWAALNGARAVFEKEIRETGWTFFFMAGEIKATAFGFDKQKSLRGALKRLIGNVKSQHCNSIEITQVTSKSFLSVPYVSVTAHPRHLQKGVVFSPK
Ga0370546_005338_1156_13443300034681SoilVFGFDKQKALCAALKRLITDVKSQHCNSIEITRVMGKSFLRVPYVSVSAHPRHLQKGMCFSG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.