| Basic Information | |
|---|---|
| Family ID | F035751 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 171 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MNETVIEAQARYLIEDRIHPTHRSQPTGVRRRHRRLRKLSWL |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 171 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 80.70 % |
| % of genes near scaffold ends (potentially truncated) | 21.64 % |
| % of genes from short scaffolds (< 2000 bps) | 89.47 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.532 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.696 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.596 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.029 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.43% β-sheet: 0.00% Coil/Unstructured: 78.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 171 Family Scaffolds |
|---|---|---|
| PF13349 | DUF4097 | 21.05 |
| PF03807 | F420_oxidored | 14.04 |
| PF13345 | Obsolete Pfam Family | 7.60 |
| PF05534 | HicB | 4.68 |
| PF00472 | RF-1 | 4.09 |
| PF13472 | Lipase_GDSL_2 | 2.92 |
| PF00692 | dUTPase | 2.34 |
| PF01872 | RibD_C | 1.17 |
| PF05887 | Trypan_PARP | 0.58 |
| PF13365 | Trypsin_2 | 0.58 |
| PF00326 | Peptidase_S9 | 0.58 |
| PF00384 | Molybdopterin | 0.58 |
| PF02687 | FtsX | 0.58 |
| PF06559 | DCD | 0.58 |
| PF13673 | Acetyltransf_10 | 0.58 |
| PF00930 | DPPIV_N | 0.58 |
| PF13529 | Peptidase_C39_2 | 0.58 |
| PF13474 | SnoaL_3 | 0.58 |
| PF14907 | NTP_transf_5 | 0.58 |
| PF01384 | PHO4 | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 171 Family Scaffolds |
|---|---|---|---|
| COG1598 | Antitoxin component HicB of the HicAB toxin-antitoxin system | Defense mechanisms [V] | 4.68 |
| COG4226 | Predicted nuclease of the RNAse H fold, HicB family | General function prediction only [R] | 4.68 |
| COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 4.09 |
| COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 4.09 |
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 2.92 |
| COG0756 | dUTP pyrophosphatase (dUTPase) | Defense mechanisms [V] | 2.34 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.17 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.17 |
| COG0306 | Phosphate/sulfate permease | Inorganic ion transport and metabolism [P] | 0.58 |
| COG0823 | Periplasmic component TolB of the Tol biopolymer transport system | Intracellular trafficking, secretion, and vesicular transport [U] | 0.58 |
| COG1506 | Dipeptidyl aminopeptidase/acylaminoacyl peptidase | Amino acid transport and metabolism [E] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.53 % |
| Unclassified | root | N/A | 20.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_110440929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 1920 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_100622575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1902 | Open in IMG/M |
| 3300001536|A1565W1_11342948 | Not Available | 682 | Open in IMG/M |
| 3300001537|A2065W1_11271748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 541 | Open in IMG/M |
| 3300002568|C688J35102_117754326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 503 | Open in IMG/M |
| 3300002568|C688J35102_119265667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 664 | Open in IMG/M |
| 3300002568|C688J35102_119598683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 728 | Open in IMG/M |
| 3300002568|C688J35102_119949729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 824 | Open in IMG/M |
| 3300002568|C688J35102_120470258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1095 | Open in IMG/M |
| 3300002568|C688J35102_120826430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1711 | Open in IMG/M |
| 3300003992|Ga0055470_10146692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 617 | Open in IMG/M |
| 3300004081|Ga0063454_100270814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1036 | Open in IMG/M |
| 3300004081|Ga0063454_100931968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 690 | Open in IMG/M |
| 3300004081|Ga0063454_101816826 | Not Available | 534 | Open in IMG/M |
| 3300004114|Ga0062593_100092193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2100 | Open in IMG/M |
| 3300004114|Ga0062593_101941974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 652 | Open in IMG/M |
| 3300004153|Ga0063455_101343462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 547 | Open in IMG/M |
| 3300004157|Ga0062590_102886295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 514 | Open in IMG/M |
| 3300005093|Ga0062594_100277611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1253 | Open in IMG/M |
| 3300005093|Ga0062594_100760885 | Not Available | 887 | Open in IMG/M |
| 3300005159|Ga0066808_1027831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 579 | Open in IMG/M |
| 3300005163|Ga0066823_10109716 | Not Available | 575 | Open in IMG/M |
| 3300005329|Ga0070683_100074073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 3180 | Open in IMG/M |
| 3300005329|Ga0070683_100177166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2024 | Open in IMG/M |
| 3300005329|Ga0070683_100242459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1714 | Open in IMG/M |
| 3300005329|Ga0070683_100493318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1170 | Open in IMG/M |
| 3300005329|Ga0070683_100646315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 1013 | Open in IMG/M |
| 3300005332|Ga0066388_103282756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 826 | Open in IMG/M |
| 3300005337|Ga0070682_100281741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1212 | Open in IMG/M |
| 3300005337|Ga0070682_101469554 | Not Available | 585 | Open in IMG/M |
| 3300005338|Ga0068868_100472602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1094 | Open in IMG/M |
| 3300005344|Ga0070661_101784844 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300005353|Ga0070669_101761828 | Not Available | 540 | Open in IMG/M |
| 3300005438|Ga0070701_10933241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 601 | Open in IMG/M |
| 3300005458|Ga0070681_10192595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1958 | Open in IMG/M |
| 3300005526|Ga0073909_10274104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 758 | Open in IMG/M |
| 3300005535|Ga0070684_100070755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 3070 | Open in IMG/M |
| 3300005535|Ga0070684_100651051 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300005535|Ga0070684_102125888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 530 | Open in IMG/M |
| 3300005539|Ga0068853_102141594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 542 | Open in IMG/M |
| 3300005547|Ga0070693_100333738 | Not Available | 1033 | Open in IMG/M |
| 3300005548|Ga0070665_100001670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 25571 | Open in IMG/M |
| 3300005564|Ga0070664_102138544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 531 | Open in IMG/M |
| 3300005614|Ga0068856_100826016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 946 | Open in IMG/M |
| 3300005713|Ga0066905_101589215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 598 | Open in IMG/M |
| 3300005764|Ga0066903_101204262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 1406 | Open in IMG/M |
| 3300005764|Ga0066903_102121872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 1082 | Open in IMG/M |
| 3300005764|Ga0066903_105559340 | Not Available | 664 | Open in IMG/M |
| 3300005764|Ga0066903_105587686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 662 | Open in IMG/M |
| 3300005937|Ga0081455_10335312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 1072 | Open in IMG/M |
| 3300006576|Ga0074047_12068701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 635 | Open in IMG/M |
| 3300006581|Ga0074048_10444905 | Not Available | 1635 | Open in IMG/M |
| 3300006606|Ga0074062_12351465 | Not Available | 571 | Open in IMG/M |
| 3300006953|Ga0074063_14258089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 2218 | Open in IMG/M |
| 3300009101|Ga0105247_10831771 | Not Available | 707 | Open in IMG/M |
| 3300009101|Ga0105247_11029896 | Not Available | 645 | Open in IMG/M |
| 3300009148|Ga0105243_11585940 | Not Available | 681 | Open in IMG/M |
| 3300009148|Ga0105243_12570760 | Not Available | 549 | Open in IMG/M |
| 3300009176|Ga0105242_11218139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 773 | Open in IMG/M |
| 3300009792|Ga0126374_10821679 | Not Available | 712 | Open in IMG/M |
| 3300009870|Ga0131092_10079622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 4036 | Open in IMG/M |
| 3300010042|Ga0126314_10544937 | Not Available | 844 | Open in IMG/M |
| 3300010044|Ga0126310_10004836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 5784 | Open in IMG/M |
| 3300010045|Ga0126311_10619299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 859 | Open in IMG/M |
| 3300010360|Ga0126372_11822332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 652 | Open in IMG/M |
| 3300010360|Ga0126372_12287861 | Not Available | 590 | Open in IMG/M |
| 3300010362|Ga0126377_11408739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 770 | Open in IMG/M |
| 3300010362|Ga0126377_13135599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 534 | Open in IMG/M |
| 3300010362|Ga0126377_13273366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 524 | Open in IMG/M |
| 3300010400|Ga0134122_12233013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 591 | Open in IMG/M |
| 3300010401|Ga0134121_12419565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 566 | Open in IMG/M |
| 3300011119|Ga0105246_12407636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 516 | Open in IMG/M |
| 3300011119|Ga0105246_12460587 | Not Available | 512 | Open in IMG/M |
| 3300012201|Ga0137365_11084924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 577 | Open in IMG/M |
| 3300012212|Ga0150985_118481340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1476 | Open in IMG/M |
| 3300012943|Ga0164241_10035627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 3737 | Open in IMG/M |
| 3300012943|Ga0164241_10352770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 1053 | Open in IMG/M |
| 3300012943|Ga0164241_10884567 | Not Available | 653 | Open in IMG/M |
| 3300012960|Ga0164301_10432784 | Not Available | 930 | Open in IMG/M |
| 3300012961|Ga0164302_10171991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1301 | Open in IMG/M |
| 3300012985|Ga0164308_10905857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 777 | Open in IMG/M |
| 3300012988|Ga0164306_10091337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1962 | Open in IMG/M |
| 3300012988|Ga0164306_10995617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 690 | Open in IMG/M |
| 3300012988|Ga0164306_11222514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 631 | Open in IMG/M |
| 3300012989|Ga0164305_11815812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 551 | Open in IMG/M |
| 3300013102|Ga0157371_10617505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 807 | Open in IMG/M |
| 3300013105|Ga0157369_10535471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1211 | Open in IMG/M |
| 3300013105|Ga0157369_10713000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1033 | Open in IMG/M |
| 3300013105|Ga0157369_10732883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1017 | Open in IMG/M |
| 3300013307|Ga0157372_12783663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 561 | Open in IMG/M |
| 3300013307|Ga0157372_13389781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 507 | Open in IMG/M |
| 3300013308|Ga0157375_12780401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 585 | Open in IMG/M |
| 3300014157|Ga0134078_10370551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 635 | Open in IMG/M |
| 3300014497|Ga0182008_10471223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 686 | Open in IMG/M |
| 3300015052|Ga0137411_1352673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3467 | Open in IMG/M |
| 3300015089|Ga0167643_1056776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 587 | Open in IMG/M |
| 3300017792|Ga0163161_10414914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1082 | Open in IMG/M |
| 3300017792|Ga0163161_11315863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 629 | Open in IMG/M |
| 3300020070|Ga0206356_10413020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 555 | Open in IMG/M |
| 3300020070|Ga0206356_10638130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 655 | Open in IMG/M |
| 3300020070|Ga0206356_11477008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 852 | Open in IMG/M |
| 3300020081|Ga0206354_11238817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1843 | Open in IMG/M |
| 3300020082|Ga0206353_10553062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 665 | Open in IMG/M |
| 3300021445|Ga0182009_10229680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 914 | Open in IMG/M |
| 3300021445|Ga0182009_10681791 | Not Available | 555 | Open in IMG/M |
| 3300021445|Ga0182009_10757699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 529 | Open in IMG/M |
| 3300025899|Ga0207642_10246515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1011 | Open in IMG/M |
| 3300025899|Ga0207642_10327869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 896 | Open in IMG/M |
| 3300025900|Ga0207710_10420993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 687 | Open in IMG/M |
| 3300025901|Ga0207688_10179522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1262 | Open in IMG/M |
| 3300025908|Ga0207643_10629883 | Not Available | 691 | Open in IMG/M |
| 3300025911|Ga0207654_10715439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 720 | Open in IMG/M |
| 3300025919|Ga0207657_10986277 | Not Available | 647 | Open in IMG/M |
| 3300025920|Ga0207649_10206753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1390 | Open in IMG/M |
| 3300025923|Ga0207681_11448274 | Not Available | 576 | Open in IMG/M |
| 3300025934|Ga0207686_10113476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1832 | Open in IMG/M |
| 3300025938|Ga0207704_10149891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1644 | Open in IMG/M |
| 3300025939|Ga0207665_10699561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 797 | Open in IMG/M |
| 3300025939|Ga0207665_11230148 | Not Available | 597 | Open in IMG/M |
| 3300025944|Ga0207661_10059630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 3076 | Open in IMG/M |
| 3300025944|Ga0207661_10084429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 2630 | Open in IMG/M |
| 3300025944|Ga0207661_10229171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1645 | Open in IMG/M |
| 3300025944|Ga0207661_11300063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 668 | Open in IMG/M |
| 3300025944|Ga0207661_12004364 | Not Available | 525 | Open in IMG/M |
| 3300025945|Ga0207679_10145206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 1923 | Open in IMG/M |
| 3300025945|Ga0207679_12088968 | Not Available | 515 | Open in IMG/M |
| 3300025986|Ga0207658_12016953 | Not Available | 525 | Open in IMG/M |
| 3300025986|Ga0207658_12096579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 514 | Open in IMG/M |
| 3300026023|Ga0207677_10792028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 848 | Open in IMG/M |
| 3300026067|Ga0207678_11165481 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300026089|Ga0207648_10778632 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300026118|Ga0207675_101065359 | Not Available | 828 | Open in IMG/M |
| 3300026142|Ga0207698_11090051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 811 | Open in IMG/M |
| 3300027310|Ga0207983_1031251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 669 | Open in IMG/M |
| 3300027496|Ga0208987_1032047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 923 | Open in IMG/M |
| 3300028379|Ga0268266_10084018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2779 | Open in IMG/M |
| 3300028732|Ga0302264_1030436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 1244 | Open in IMG/M |
| 3300028743|Ga0302262_10324933 | Not Available | 522 | Open in IMG/M |
| 3300028755|Ga0307316_10177982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 763 | Open in IMG/M |
| 3300028799|Ga0307284_10360210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 589 | Open in IMG/M |
| 3300028802|Ga0307503_10010157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 2741 | Open in IMG/M |
| 3300028802|Ga0307503_10047218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1622 | Open in IMG/M |
| 3300028802|Ga0307503_10149414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 1059 | Open in IMG/M |
| 3300028802|Ga0307503_10615267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 601 | Open in IMG/M |
| 3300028802|Ga0307503_10673940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 578 | Open in IMG/M |
| 3300028824|Ga0307310_10534065 | Not Available | 593 | Open in IMG/M |
| 3300029987|Ga0311334_10438938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1042 | Open in IMG/M |
| 3300029990|Ga0311336_10425145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 1117 | Open in IMG/M |
| 3300030050|Ga0302255_1111692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 557 | Open in IMG/M |
| 3300031152|Ga0307501_10134086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 659 | Open in IMG/M |
| 3300031366|Ga0307506_10214051 | Not Available | 715 | Open in IMG/M |
| 3300031938|Ga0308175_100030680 | All Organisms → cellular organisms → Bacteria | 4439 | Open in IMG/M |
| 3300031938|Ga0308175_100170347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 2111 | Open in IMG/M |
| 3300031938|Ga0308175_100180889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2056 | Open in IMG/M |
| 3300031938|Ga0308175_100277825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1696 | Open in IMG/M |
| 3300031938|Ga0308175_100304247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1627 | Open in IMG/M |
| 3300031938|Ga0308175_100468407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1333 | Open in IMG/M |
| 3300031938|Ga0308175_100490582 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300031938|Ga0308175_100507988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 1282 | Open in IMG/M |
| 3300031938|Ga0308175_100532014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 1254 | Open in IMG/M |
| 3300031938|Ga0308175_100841392 | Not Available | 1006 | Open in IMG/M |
| 3300031938|Ga0308175_100947930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 949 | Open in IMG/M |
| 3300031938|Ga0308175_101499996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 753 | Open in IMG/M |
| 3300031939|Ga0308174_10064229 | All Organisms → cellular organisms → Bacteria | 2527 | Open in IMG/M |
| 3300031939|Ga0308174_10540814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 958 | Open in IMG/M |
| 3300031939|Ga0308174_10879577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 756 | Open in IMG/M |
| 3300031996|Ga0308176_10681256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Paucibacter → Paucibacter toxinivorans | 1065 | Open in IMG/M |
| 3300031996|Ga0308176_10903797 | Not Available | 928 | Open in IMG/M |
| 3300032074|Ga0308173_11180242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 715 | Open in IMG/M |
| 3300034129|Ga0370493_0036595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 1503 | Open in IMG/M |
| 3300034268|Ga0372943_0092661 | Not Available | 1764 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 10.53% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 9.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 5.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.09% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.51% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.34% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.92% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.92% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.75% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.17% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.17% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.17% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.17% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.58% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.58% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.58% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.58% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.58% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.58% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.58% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.58% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.58% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.58% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001537 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003992 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005159 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPB | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015089 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027310 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB (SPAdes) | Environmental | Open in IMG/M |
| 3300027496 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028732 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300028743 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030050 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_4 | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300034129 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_16 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1104409291 | 3300000956 | Soil | MNETVIEAQARYLIEERIHPTHQKQHTGVRRRHRRVRRLSWL* |
| JGIcombinedJ13530_1006225754 | 3300001213 | Wetland | MNETVIEAHARYLIEDRIRATRPEQARHDRRRHRRLRALSWL* |
| A1565W1_113429482 | 3300001536 | Permafrost | MNTTVIEAQARYLIEDRIHPTHRHQPTGVRRRHRKVRRLSWL* |
| A2065W1_112717481 | 3300001537 | Permafrost | MNTTVIEAQARYLIEDRIHPTHRPQPTGVRRRHRKVRRLSWL* |
| C688J35102_1177543262 | 3300002568 | Soil | MNETVIETQARYLIEDRIHPTHGKHATSVRRRHRRIRKLSWL* |
| C688J35102_1192656671 | 3300002568 | Soil | MNETVIEAQARYLIEDRIHPTHQPQPTAVRRRHRRLRKLSWL* |
| C688J35102_1195986831 | 3300002568 | Soil | MNTTLIEAQARYLIEDRIHPTHRQQQPAGVRRRTKKVRRLSWL* |
| C688J35102_1199497292 | 3300002568 | Soil | MNTTVIEAQAHYLIEDRIHPTHRQQQPSGVRRRVRKVRRLSWL* |
| C688J35102_1204702582 | 3300002568 | Soil | MNETVIEAQARYLIEDRIHPTHQSQPTGVRRRHRRLRKLSWL* |
| C688J35102_1208264302 | 3300002568 | Soil | MNETVIEAQARYLIEDRIHPTHQSQPTEVRRRHRRLRKLSWL* |
| Ga0055470_101466921 | 3300003992 | Natural And Restored Wetlands | MNETVIEAQARYLIEDRIHPTHGHQPTSVRRRHRRLRKLSWL* |
| Ga0063454_1002708142 | 3300004081 | Soil | MNETVLEAQARYLIEDRIHPTHGKSATSVRRRHRRIRKLSWL* |
| Ga0063454_1009319681 | 3300004081 | Soil | MNETVIEAQARYLIDDRIHPTHGKSATSVRRRHRRIRRLSWL* |
| Ga0063454_1018168262 | 3300004081 | Soil | MNTTVIEAQAHYLIEDRIHPTHHRQKEPSGVRRRSARKVRKLSWL* |
| Ga0062593_1000921931 | 3300004114 | Soil | AMNETVIEAQARYLIEDRIHPTHRQQPTAVRRRHRRIRRLSWL* |
| Ga0062593_1019419742 | 3300004114 | Soil | MNETVIEAQARYLIEDRIHPTHQHRPTSVRRRHRRLRKLSWL* |
| Ga0063455_1013434622 | 3300004153 | Soil | MNTTVIEAQARYLIEDRIHPTHREQLPTGVRRRARKVRKLSWL* |
| Ga0062590_1028862952 | 3300004157 | Soil | MNETVIEAQARYLIEDRIHPTHRQQPTAVRRRHRRIRRLSWL* |
| Ga0062594_1002776111 | 3300005093 | Soil | MNETVIEAQARYLIEDRIHPTHGKSATTVRRRHRRIRKLSWL* |
| Ga0062594_1007608852 | 3300005093 | Soil | TMNYTVIEAQARYLIEDRIHPDHHRQQQPTGVRRRARKVRRLSWL* |
| Ga0066808_10278311 | 3300005159 | Soil | MNTTVIEAQARYLIEDRIHQTHRQEPSSGVRRRTRKVRKLSWL* |
| Ga0066823_101097161 | 3300005163 | Soil | TTEGSTTMNTTVIEAQARYLIEDRIHPTHREHEPTGVRRRARKVRKLSWL* |
| Ga0070683_1000740733 | 3300005329 | Corn Rhizosphere | MNETVIEAQARYLIEDRIHPTHQPRPTSVRRRHRRLRKLSWL* |
| Ga0070683_1001771664 | 3300005329 | Corn Rhizosphere | MNETMIETQARYLIEDRIHATHRVRSTGGRRRHHRLRRLGWL* |
| Ga0070683_1002424592 | 3300005329 | Corn Rhizosphere | MNETVIEAQARYLIEDRTHTTHHRPRATSPSRRAPKLRRLSWL* |
| Ga0070683_1004933182 | 3300005329 | Corn Rhizosphere | MNYTVIEAQARYLIEDRIHPDHHRQQQPTGVRRRARKVRRLSWL* |
| Ga0070683_1006463151 | 3300005329 | Corn Rhizosphere | MNTTVIEAQAHYLIEDRIHQTHRQQKASGVRRRTRKVRKLSWL* |
| Ga0066388_1032827562 | 3300005332 | Tropical Forest Soil | MNETVIEAQARYLIEDRIHPTHRQQPTGVRRRHRRLRQLSWL* |
| Ga0070682_1002817413 | 3300005337 | Corn Rhizosphere | TVIEAQARYLIEDRTHTTHHRPRATSPSRRAPKLRRLSWL* |
| Ga0070682_1014695542 | 3300005337 | Corn Rhizosphere | IEGSTTMNTTVIEAQAHYLIEDRIHQTHRQQKASGVRRRTRKVRKLSWL* |
| Ga0068868_1004726022 | 3300005338 | Miscanthus Rhizosphere | MNETMIETQARYLIEDRIHATHRVRSTGGRRRHHRLCRLSWL* |
| Ga0070661_1017848441 | 3300005344 | Corn Rhizosphere | TTMNETVIEAQARYLIEDRIRATRPRQSAHARRRHRRLRTLSWL* |
| Ga0070669_1017618281 | 3300005353 | Switchgrass Rhizosphere | MNETMIETQARYLIEDRIHPTHRQQPTAVRRRHRRIRRLSWL* |
| Ga0070701_109332412 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MNETVIEAQARYLIEDRIHPTHRAPNTGVRRRHRRLRQLSWL* |
| Ga0070681_101925953 | 3300005458 | Corn Rhizosphere | MNETVIEAQARYLIEDRIHPTHAARPTGVRRHHRKLRRLSWL* |
| Ga0073909_102741041 | 3300005526 | Surface Soil | MNTTVIEAQARYLIEDRIHPTHREHEPTGVRRRARKVRKLSWL* |
| Ga0070684_1000707551 | 3300005535 | Corn Rhizosphere | MNETVIEAQAKYLIEDRIHPTHQHKPTSVRRRHRRLRKLSWL* |
| Ga0070684_1006510512 | 3300005535 | Corn Rhizosphere | AMNETVIEAQARYLIEDRIHPTHRAPNTGVRRRHRRLRQLSWL* |
| Ga0070684_1021258882 | 3300005535 | Corn Rhizosphere | MNETMIETQARYLIEDRIHATHRVRSTGGRRRHHRLRRLSWL* |
| Ga0068853_1021415942 | 3300005539 | Corn Rhizosphere | MNTTVIEAQARYLIEDRIHPTHREQEPTGVRRRARKVRKLSWL* |
| Ga0070693_1003337382 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTTVIEAQAHYLIEDRIHPTHHRERQPSGVRRRARKVRRLSWL* |
| Ga0070665_1000016704 | 3300005548 | Switchgrass Rhizosphere | MNETVIEAQARYLIEDRIHPTHAARPTGVRRHHRKIRRLSWL* |
| Ga0070664_1021385441 | 3300005564 | Corn Rhizosphere | QARYLIEDRIHATHRVRSTGGRRRHHRLRRLGWL* |
| Ga0068856_1008260161 | 3300005614 | Corn Rhizosphere | MNETMIETQARYLIEDRIHATHRVRSTGGRRRHHRLCRLS |
| Ga0066905_1015892152 | 3300005713 | Tropical Forest Soil | MNETVIEAQARYLIEDRIHPTHGKNATSVRRRHRRIRKLSWL* |
| Ga0066903_1012042623 | 3300005764 | Tropical Forest Soil | MNVNENMIEAQAHYLIEDRIHPTHRVKPGNVRRRHRRVRRLSWL* |
| Ga0066903_1021218722 | 3300005764 | Tropical Forest Soil | MNETVIESQARYLIEDRIHPTHGKQATGVRRRHRRVRKLSWL* |
| Ga0066903_1055593402 | 3300005764 | Tropical Forest Soil | VIEAQARYLIEERIHPTHQKQSTGVRRRHRRIRRLSWL* |
| Ga0066903_1055876862 | 3300005764 | Tropical Forest Soil | MNETVIEAQARYLIEDRIHPTHQAKPTAVRRRHRRLRKLSWL* |
| Ga0081455_103353121 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MNETVIEAQAKYLIEDRIHPTHQQQPTSVRRRHRRLRKLSWL* |
| Ga0074047_120687011 | 3300006576 | Soil | MNTTVIEAQARYLIEDRIHPTHRQQQPSGVRRRTRKVRKLSWL* |
| Ga0074048_104449051 | 3300006581 | Soil | MNQAVIETQARYLIQERIRRAHRTQSAHVRRHHRRLRALSWL* |
| Ga0074062_123514651 | 3300006606 | Soil | TTERSTAMNPTVIEEQARYLIEDRIHPTHRPQPTGVRRRHRKVRKLSWL* |
| Ga0074063_142580892 | 3300006953 | Soil | MNPTVIEEQARYLIEDRIHPTHRPQPTGVRRRHRKVRKLSWL* |
| Ga0105247_108317711 | 3300009101 | Switchgrass Rhizosphere | MNTTVIEAQARYLIEDRIHPTHRDQEPTGVRRRARKVRKLSWL* |
| Ga0105247_110298961 | 3300009101 | Switchgrass Rhizosphere | TTMNTTVIEAQARYLIEDRIHQTHRQEPSSGVRRRTRKVRKLSWL* |
| Ga0105243_115859401 | 3300009148 | Miscanthus Rhizosphere | MNETVIEAQGRYLIEDRIRATRPKQSIPYRRRHRQLRKLSWL* |
| Ga0105243_125707601 | 3300009148 | Miscanthus Rhizosphere | MNTTVIEAQAHYLIEDRIHPTHRAPNTGVRRRHRRLRQLSWL* |
| Ga0105242_112181392 | 3300009176 | Miscanthus Rhizosphere | MNETVIEAQARYLIEDRIHPTRQHQPTGVRRRHRRIRRLSWL* |
| Ga0126374_108216791 | 3300009792 | Tropical Forest Soil | HRPTSEKGSSTMNETVIESQARYLIEDRIHPTHGKQATGVRRRHRRLRKLSWL* |
| Ga0131092_100796222 | 3300009870 | Activated Sludge | MNETVIEAQARYLIEDRIHPTHQKQPTGVRRRHRRIRRLSWL* |
| Ga0126314_105449372 | 3300010042 | Serpentine Soil | MNETVIEAQARYLIEDRIHPTHRSQPTGVRRRHRRLRKLSWL* |
| Ga0126310_100048364 | 3300010044 | Serpentine Soil | MNETVIEAQARFLIEDRIHPTYRSQPTGVRRRHRRLRKLSWL* |
| Ga0126311_106192992 | 3300010045 | Serpentine Soil | MNYTVIEAQARYLIEDRIHPDHHRQLQPTGVRRRARKVRRLSWL* |
| Ga0126372_118223322 | 3300010360 | Tropical Forest Soil | MNETVIEAQARYLIEDRIHPTHGKTATGVRRRHRRIRRLSWL* |
| Ga0126372_122878612 | 3300010360 | Tropical Forest Soil | MNETVIEAQARYLIEERIHPTHQKQSTGVRRRHRRIRRLSWL* |
| Ga0126377_114087392 | 3300010362 | Tropical Forest Soil | MNETVIEAQARYLIEDRIRQTRRAQSTGVRRRHRRLLTLSWL* |
| Ga0126377_131355991 | 3300010362 | Tropical Forest Soil | MNETVIEAQARYLIEDRIHPTHRRHSTGVRRSHRRLRGLSWL* |
| Ga0126377_132733662 | 3300010362 | Tropical Forest Soil | MNETVIEAQARYLIEDRIHPTHRVRLTGVRRRHRRVRSLGWL* |
| Ga0134122_122330132 | 3300010400 | Terrestrial Soil | MNETVTEAQARYLIEDRIHPTHRQQPTAVRRRHRRIRRLSWL* |
| Ga0134121_124195652 | 3300010401 | Terrestrial Soil | MNETVIEAQARYLIENRNHPTHRQQPTAVHRRHRRIRRLSWL* |
| Ga0105246_124076361 | 3300011119 | Miscanthus Rhizosphere | MNETVIEAQARYLIEDRIRATRPRQSAHARRRHRRLRTLSWL* |
| Ga0105246_124605871 | 3300011119 | Miscanthus Rhizosphere | MNYTVIEAQARYLIEDRIHPDHHRQQQPTGLRRRARKIRKLSWL* |
| Ga0137365_110849242 | 3300012201 | Vadose Zone Soil | MNETVIEAQARYLIEDRIHPTHRPQPTAVRRRHRKIRRLSWL* |
| Ga0150985_1184813401 | 3300012212 | Avena Fatua Rhizosphere | MNETVIEAHAKYLIEDRIHPTHGHQPTAVRRRHRRLRKLSWL* |
| Ga0164241_100356272 | 3300012943 | Soil | MNETVIEAQAKYLIEDRIHPTHGHQPTSVRRRHRRLRKLSWL* |
| Ga0164241_103527702 | 3300012943 | Soil | MNETVIEAQARYLIEDRIHPTHAPHPTGVRRRHRRLRKLSWL* |
| Ga0164241_108845671 | 3300012943 | Soil | RTVMNETVIEAQARYLIEDRIHPTHAPHPTGVRRRHRRLRKLSWL* |
| Ga0164301_104327842 | 3300012960 | Soil | MNTTVLEAQARYLIEDRIHQTHRQEPSSGVRRRTRKVRKLSWL* |
| Ga0164302_101719913 | 3300012961 | Soil | MNTTVIEAQAHYLIEDRIHQTHRQQKASGVRRRTRKVRRLSWL* |
| Ga0164308_109058572 | 3300012985 | Soil | MNETVIEAQARYLIEDRIHPTRQQQTTGVRRRHRRLRRLSWL* |
| Ga0164306_100913373 | 3300012988 | Soil | MNTTVIEAQAHYLIEDRIHPTHHRQQQPSGVRRRSARKVRKLSWL* |
| Ga0164306_109956172 | 3300012988 | Soil | MNPTVIEEQARYLIEDRIHPTHRTKPTGVRRRHRKIRKLSWL* |
| Ga0164306_112225142 | 3300012988 | Soil | MNQAVIETQARYLIQERIRRAHRTQSAHVRRHHRRLRAL |
| Ga0164305_118158122 | 3300012989 | Soil | MNETVIEAQARYLIEDRIHATHPRQSLHDRRRRRPLRTLSWL* |
| Ga0157371_106175052 | 3300013102 | Corn Rhizosphere | MNTTVIEAQAHYLIEDRIHPTHRHHEPTGVRRRPRKVRKLSWL* |
| Ga0157369_105354712 | 3300013105 | Corn Rhizosphere | MNETVIEAQARYLIEDRIHPTRAHQPTGVRRRHRRVRRLSWL* |
| Ga0157369_107130003 | 3300013105 | Corn Rhizosphere | VIEAQARYLIEDRIHPTHRQQPSDMRRRHRRMRRLSWL* |
| Ga0157369_107328831 | 3300013105 | Corn Rhizosphere | HHHTIEGRTTMNTTVIEAQARYLIEDRIHQTHRQEPSSGVRRRTRKVRKLSWL* |
| Ga0157372_127836631 | 3300013307 | Corn Rhizosphere | MNQTVIEAQARYLIEDRIHPTHRQQPSDVRRRHRRMRRLSWL* |
| Ga0157372_133897812 | 3300013307 | Corn Rhizosphere | MNETVIEAQARYLIEDRIHPTRAQQPTGVRRRHRRVRRLSWL* |
| Ga0157375_127804011 | 3300013308 | Miscanthus Rhizosphere | HTTTTEGSTTMNTTVIEAQARYLIEDRIHPTHREQEPTGVRRRARKVRKLSWL* |
| Ga0134078_103705512 | 3300014157 | Grasslands Soil | MNETVIEAQARYLIEDRIHPTRRPQPTAVRRRHRKIRRLSWL* |
| Ga0182008_104712232 | 3300014497 | Rhizosphere | MNTTVIEAQARYLIEDRIQPTHKHQPTGVRRRHRKVRRLSWL* |
| Ga0137411_13526733 | 3300015052 | Vadose Zone Soil | VIEAQARYLIEDRIHPTHRQQLPSGVRRRARKTRKLSWL* |
| Ga0167643_10567762 | 3300015089 | Glacier Forefield Soil | MNTTVIEQQARYLIEDRIHPTHRPQPTGVRRRHRKVRKLSWL* |
| Ga0163161_104149142 | 3300017792 | Switchgrass Rhizosphere | MNYTVIEAQARYLIEDRIHPDHHRQQQPTGVRRRARKVRRLSWL |
| Ga0163161_113158631 | 3300017792 | Switchgrass Rhizosphere | MNTTVIEAQARYLIEDRIHPTHREQEPTGVRRRARKVRKLSWL |
| Ga0206356_104130202 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTTVIEAQARYLIEDRIHPTHQPRPTSVRRRHRRLRKLSWL |
| Ga0206356_106381302 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTTVIEAQARYLIEDRIHPDHHRQQQPTGVRRRARKVRRLSWL |
| Ga0206356_114770081 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MNETVIEAQARYLIEDRTHTTHHRPRATSPSRRAPKLRRLSW |
| Ga0206354_112388171 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MNETVIEAQARYLIEDRTHTTHHRPRATSPSRRAPKLRRLSWL |
| Ga0206353_105530622 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MNETVIEAQARYLIEDRIHPTHRQQPTAVRRRHRRIRRLSWL |
| Ga0182009_102296802 | 3300021445 | Soil | MNETVIEAQARYLIEDRIQPNHRPQVTADVRRRHRKVRRLSWL |
| Ga0182009_106817911 | 3300021445 | Soil | RPGRSTTMNQTVIEAQARYLIEDRIHPTHRQQPSDVRRRHRRMRRLSWL |
| Ga0182009_107576991 | 3300021445 | Soil | MNETVIEAQARYLIEDRIHPTHRQQPTSVRRRHRRLRKLSWL |
| Ga0207642_102465152 | 3300025899 | Miscanthus Rhizosphere | MNETVIEAQARYLIEDRIHPTHGKSAPTVRPRHRRIRKLSWL |
| Ga0207642_103278692 | 3300025899 | Miscanthus Rhizosphere | MNETVIEAQARYLIEDRIHPTHQSQPTEVRRRHRRLRKLSWL |
| Ga0207710_104209931 | 3300025900 | Switchgrass Rhizosphere | MNETVIEAQARYLIEDRIHPTHRAPNTGVRRRHRRLRQLSWL |
| Ga0207688_101795223 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | TGRSTAMNETVIEAQARYLIEDRIHPTHRAPNTGVRRRHRRLRQLSWL |
| Ga0207643_106298832 | 3300025908 | Miscanthus Rhizosphere | SAMNETVIEAQARYLIEDRIHPTHRQQPTAVRRRHRRIRRLSWL |
| Ga0207654_107154392 | 3300025911 | Corn Rhizosphere | MNETVIEAQARYLIEDRIHPTHGKSATAVRRRHRRIRKLSWL |
| Ga0207657_109862772 | 3300025919 | Corn Rhizosphere | MNYTVIEAQARYLIEDRIHPDHHRQQQPTGLRRRARKIRKLSWL |
| Ga0207649_102067531 | 3300025920 | Corn Rhizosphere | MNETVIEAQAGYLIGDRIHPTHRAPNTGVRRRHRRLRQLSWL |
| Ga0207681_114482742 | 3300025923 | Switchgrass Rhizosphere | MNETMIETQARYLIEDRIHPTHRQQPTAVRRRHRRIRRLSWL |
| Ga0207686_101134762 | 3300025934 | Miscanthus Rhizosphere | MNETVIEAQARYLIEDRIHPTHGKSATTVRRRHRRIRKLSWL |
| Ga0207704_101498912 | 3300025938 | Miscanthus Rhizosphere | MNETMIETQARYLIEDRIHATHRVRSTGGRRRHHRLCRLSWL |
| Ga0207665_106995614 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTTVIEAQAHYLIEDRIHPTHHRERQPSGVRRRARKVRRLS |
| Ga0207665_112301482 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MNETVIEAQARYLIEDRIHPTRQQQTTGVRRRHRRLRRLSWL |
| Ga0207661_100596304 | 3300025944 | Corn Rhizosphere | MNETVIEAQAKYLIEDRIHPTHQHKPTSVRRRHRRLRKLSWL |
| Ga0207661_100844293 | 3300025944 | Corn Rhizosphere | MNETVIEAQARYLIEDRIHPTHQPRPTSVRRRHRRLRKLSWL |
| Ga0207661_102291711 | 3300025944 | Corn Rhizosphere | MNETMIETQARYLIEDRIHATHRVRSTGGRRRHHRLRRLGWL |
| Ga0207661_113000631 | 3300025944 | Corn Rhizosphere | MNTTVIEAQAHYLIEDRIHQTHRQQKASGVRRRTRKVRKLSWL |
| Ga0207661_120043642 | 3300025944 | Corn Rhizosphere | MNETVIEAQARYLIEDRIHPTRQHQPTGVRRRHRRIRRLSWL |
| Ga0207679_101452061 | 3300025945 | Corn Rhizosphere | MNETVIEAQARYLIEDRIHPTHRQQPTAVRRRHRRIRR |
| Ga0207679_120889681 | 3300025945 | Corn Rhizosphere | AHARYLIEDRIHPDHHRQELPTGVRRRARKVRRLSWL |
| Ga0207658_120169531 | 3300025986 | Switchgrass Rhizosphere | PHFPARSTAMNETVIEAQARYLIEDRIHPTHRAPNTGVRRRHRRLRQLSWL |
| Ga0207658_120965792 | 3300025986 | Switchgrass Rhizosphere | MNTTVIEAQARYLIEDRIHPTHRDQEPTGVRRRAR |
| Ga0207677_107920281 | 3300026023 | Miscanthus Rhizosphere | ETQARYLIEDRIHATHRVRSTGGRRRHHRLCRLSWL |
| Ga0207678_111654811 | 3300026067 | Corn Rhizosphere | MNTTVIEEQARYLIEDRIHPTRQHQPTGVRRRHRRLRRLSWL |
| Ga0207648_107786323 | 3300026089 | Miscanthus Rhizosphere | MNYTVIEAQARYLIEDRIHPDHHRQRQPTGLRRRARKIRKLSWL |
| Ga0207675_1010653592 | 3300026118 | Switchgrass Rhizosphere | ETVIEAQARYLIEDRIHPTHGKSATTVRRRHRRIRKLSWL |
| Ga0207698_110900512 | 3300026142 | Corn Rhizosphere | MNETVIEAQARYLIEDRIHPTHRQQPTAVRRRHRRIRRLS |
| Ga0207983_10312512 | 3300027310 | Soil | MNTTVIEAQARYLIEDRIHPTHREHEPTGVRRRARKVRKLSWL |
| Ga0208987_10320472 | 3300027496 | Forest Soil | MNTTVIEAQARYLIEDRIHQTHRQQQPSGVRRRARKVRRLSWL |
| Ga0268266_100840182 | 3300028379 | Switchgrass Rhizosphere | MNETVIEAQARYLIEDRIHPTHAARPTGVRRHHRKIRRLSWL |
| Ga0302264_10304362 | 3300028732 | Fen | MNTTVIEAQARYLIEDRIHPTHRQQQPSGVRRRTRKVRKLSWL |
| Ga0302262_103249332 | 3300028743 | Fen | MNTTVIEAQARYLIEDRIHPTRRQQAPSGVRRRARKVRTLSWL |
| Ga0307316_101779821 | 3300028755 | Soil | MNETVIEAQARYLIEDRIHPTHRAQSTGVRRHHRRLRKLSWL |
| Ga0307284_103602102 | 3300028799 | Soil | MNHTVIEEQARYLIEDRIRPTRRPQPTGVHRRHRKVRKLSWL |
| Ga0307503_100101572 | 3300028802 | Soil | MNETVIEAQARYLIQDRIHPTHGKSATSVRRRHRRIRKLSWL |
| Ga0307503_100472183 | 3300028802 | Soil | MNETVIEAQARYLIEDRIHPTHGKSATSVRRRHRRIRKLSWL |
| Ga0307503_101494141 | 3300028802 | Soil | MNTTMIEAQARYLIEDRIHPTHREHQPTGVRRRARKVRKLSWL |
| Ga0307503_106152672 | 3300028802 | Soil | MNTTVIEAQARYLIEDRIHPTHRDQEPTGVRRRARKVRKLSWL |
| Ga0307503_106739401 | 3300028802 | Soil | TMKETVIEAQAGYLIEDRIRATRPRQSAHARRRHRRLRTSSWL |
| Ga0307310_105340652 | 3300028824 | Soil | MNTTVIEAQARYLIEDRIHPTHRHEPTGVRRRHRKVRRLSWL |
| Ga0311334_104389383 | 3300029987 | Fen | RSDHTTEGSTTMNTTVIEAQARYLIEDRIHPTRRQQAPSGVRRRARKVRTLSWL |
| Ga0311336_104251451 | 3300029990 | Fen | MNTTVIEAQARYLIQDRIHPTHRQQQPSGVRRRTRKVRTLSWL |
| Ga0302255_11116922 | 3300030050 | Fen | MNTTVIEAQARYLIEDRIHPQHHRQPQPSGVRRRARKVRKLSWL |
| Ga0307501_101340862 | 3300031152 | Soil | MNTTVIEAHARYLIEDRIHPTHREQEPTGVRRRTRKV |
| Ga0307506_102140512 | 3300031366 | Soil | AQASYLIEDRIHPTHREHEPTGVRRRARKVRKLSWL |
| Ga0308175_1000306802 | 3300031938 | Soil | MNETVIEIQARYLIEDRIHATHPRAVRRDSRRHRRLRKPSWL |
| Ga0308175_1001703473 | 3300031938 | Soil | MNTTVIEAQARYLIEDRIHPTTRHQPTGVRRRHRKVRRLSWL |
| Ga0308175_1001808893 | 3300031938 | Soil | MNETVLEAQARYLIEDRIHPTHQQRPTGVRRRHRRIRRLSWL |
| Ga0308175_1002778253 | 3300031938 | Soil | MNETVIEAQARYLIEDRIHPTRAHQPTGVRRRHRRIRRLSWL |
| Ga0308175_1003042473 | 3300031938 | Soil | MNETVIEAQARYLIEDRIHPTHAARPTGVRRHHRKLRRLSWL |
| Ga0308175_1004684072 | 3300031938 | Soil | MNYSVIEAQARYLIEDRIHPDHHRQQQPSGVRRRARKVRRLSWL |
| Ga0308175_1004905822 | 3300031938 | Soil | MNETVIEAQARYLIEDRIRATRPRGTVRDHRRHRRLRTLSWL |
| Ga0308175_1005079881 | 3300031938 | Soil | MNTTVIEAQARYLIEDRIHPRTKQQPTGVRRRHRKVRRLSWL |
| Ga0308175_1005320143 | 3300031938 | Soil | RSTTMNETVIEAQARYLIEDRIHPTHQPRPTGVRRRHRKLRRLSWL |
| Ga0308175_1008413922 | 3300031938 | Soil | MNRMVIEAQARYLIEDRVHATHRMQSVRDSRRYRRLRPLSWL |
| Ga0308175_1009479301 | 3300031938 | Soil | MNETVIEAQAKYLIEDRIHPTHGHQHTSVRRRHRRLRKLSWL |
| Ga0308175_1014999962 | 3300031938 | Soil | MNETVIEAQARYLIEDRIHPTHRHRPTAVRRRHRRLRKLSWL |
| Ga0308174_100642293 | 3300031939 | Soil | MNETVIEAQARYLIEDRIRATRPRGSVRDHRRHRRLRTLSWL |
| Ga0308174_105408142 | 3300031939 | Soil | MNETVIEAQARYLIEDRIHPTHQPRPTGVRRRHRKLRRLSWL |
| Ga0308174_108795772 | 3300031939 | Soil | MNTTVIEAQARYLIEDRIHPTHRHQPTGARRRHRKVRRLSWL |
| Ga0308176_106812561 | 3300031996 | Soil | MNETVIETQARYLIEDRIHATHPRAVRRDGRRHRRLRKPSWL |
| Ga0308176_109037972 | 3300031996 | Soil | EHRRNAMNETVIEAQARYLIEDRIHPTHAARPTGVRRHHRKLRRLSWL |
| Ga0308173_111802422 | 3300032074 | Soil | MNETVIEAQARYLIEERIHPTHQKQSTGVRRRHRRIRRLSWL |
| Ga0370493_0036595_1320_1448 | 3300034129 | Untreated Peat Soil | MNETVIEAQARYLIEDRIHPTRQHQPIGVRRRHRRVRRLSWL |
| Ga0372943_0092661_56_184 | 3300034268 | Soil | MNTTVIEAQARYLIEDRIHPTHRHQPMGPRRRHRKVRRLSWL |
| ⦗Top⦘ |