| Basic Information | |
|---|---|
| Family ID | F035725 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 171 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MANGTIAFDTLSTSGQITGTAKSVDTDYVVNGSAKVW |
| Number of Associated Samples | 121 |
| Number of Associated Scaffolds | 171 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 99.40 % |
| % of genes near scaffold ends (potentially truncated) | 97.08 % |
| % of genes from short scaffolds (< 2000 bps) | 94.74 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | environmental samples (70.760 % of family members) |
| NCBI Taxonomy ID | 186616 |
| Taxonomy | All Organisms → Viruses → environmental samples |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater (32.164 % of family members) |
| Environment Ontology (ENVO) | Unclassified (91.813 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (97.076 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.38% β-sheet: 0.00% Coil/Unstructured: 84.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 171 Family Scaffolds |
|---|---|---|
| PF03906 | Phage_T7_tail | 3.51 |
| PF00386 | C1q | 1.75 |
| PF13884 | Peptidase_S74 | 1.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.96 % |
| Unclassified | root | N/A | 14.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10240550 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 556 | Open in IMG/M |
| 3300001472|JGI24004J15324_10004614 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 5339 | Open in IMG/M |
| 3300004448|Ga0065861_1134786 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 650 | Open in IMG/M |
| 3300006735|Ga0098038_1234115 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 584 | Open in IMG/M |
| 3300006735|Ga0098038_1252421 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 557 | Open in IMG/M |
| 3300006735|Ga0098038_1258521 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 548 | Open in IMG/M |
| 3300006737|Ga0098037_1275504 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 535 | Open in IMG/M |
| 3300006749|Ga0098042_1045921 | All Organisms → Viruses → Predicted Viral | 1197 | Open in IMG/M |
| 3300006752|Ga0098048_1251446 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 516 | Open in IMG/M |
| 3300006789|Ga0098054_1330503 | Not Available | 543 | Open in IMG/M |
| 3300006803|Ga0075467_10053152 | All Organisms → Viruses → Predicted Viral | 2515 | Open in IMG/M |
| 3300006810|Ga0070754_10474065 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 541 | Open in IMG/M |
| 3300006810|Ga0070754_10538046 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 500 | Open in IMG/M |
| 3300006919|Ga0070746_10498234 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 535 | Open in IMG/M |
| 3300006919|Ga0070746_10498757 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 535 | Open in IMG/M |
| 3300006919|Ga0070746_10536327 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 509 | Open in IMG/M |
| 3300006920|Ga0070748_1348013 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 523 | Open in IMG/M |
| 3300006922|Ga0098045_1025962 | Not Available | 1534 | Open in IMG/M |
| 3300006928|Ga0098041_1072798 | All Organisms → Viruses → Predicted Viral | 1109 | Open in IMG/M |
| 3300006929|Ga0098036_1046332 | All Organisms → Viruses → Predicted Viral | 1354 | Open in IMG/M |
| 3300006929|Ga0098036_1222339 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 572 | Open in IMG/M |
| 3300006990|Ga0098046_1136019 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 531 | Open in IMG/M |
| 3300007231|Ga0075469_10038016 | All Organisms → Viruses → Predicted Viral | 1503 | Open in IMG/M |
| 3300007276|Ga0070747_1317228 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 534 | Open in IMG/M |
| 3300007276|Ga0070747_1324481 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 527 | Open in IMG/M |
| 3300007540|Ga0099847_1230155 | Not Available | 536 | Open in IMG/M |
| 3300007963|Ga0110931_1229964 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 552 | Open in IMG/M |
| 3300007963|Ga0110931_1234071 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 547 | Open in IMG/M |
| 3300008221|Ga0114916_1148593 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 525 | Open in IMG/M |
| 3300009001|Ga0102963_1333000 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 596 | Open in IMG/M |
| 3300009071|Ga0115566_10756586 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 536 | Open in IMG/M |
| 3300009071|Ga0115566_10787605 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 524 | Open in IMG/M |
| 3300009074|Ga0115549_1211872 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 617 | Open in IMG/M |
| 3300009422|Ga0114998_10550933 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 542 | Open in IMG/M |
| 3300009422|Ga0114998_10602815 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 517 | Open in IMG/M |
| 3300009428|Ga0114915_1204155 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 543 | Open in IMG/M |
| 3300009435|Ga0115546_1338582 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 512 | Open in IMG/M |
| 3300009447|Ga0115560_1376898 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 537 | Open in IMG/M |
| 3300009495|Ga0115571_1376328 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 557 | Open in IMG/M |
| 3300009605|Ga0114906_1297598 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 512 | Open in IMG/M |
| 3300009785|Ga0115001_10646352 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 644 | Open in IMG/M |
| 3300009786|Ga0114999_11337735 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 506 | Open in IMG/M |
| 3300010148|Ga0098043_1198432 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 556 | Open in IMG/M |
| 3300010148|Ga0098043_1205539 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 544 | Open in IMG/M |
| 3300010148|Ga0098043_1207343 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 541 | Open in IMG/M |
| 3300010153|Ga0098059_1423634 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 502 | Open in IMG/M |
| 3300010300|Ga0129351_1340586 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 563 | Open in IMG/M |
| 3300010368|Ga0129324_10392131 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 537 | Open in IMG/M |
| 3300010883|Ga0133547_11501590 | All Organisms → Viruses → Predicted Viral | 1265 | Open in IMG/M |
| 3300016766|Ga0182091_1475068 | All Organisms → Viruses → Predicted Viral | 1139 | Open in IMG/M |
| 3300017706|Ga0181377_1081424 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 576 | Open in IMG/M |
| 3300017706|Ga0181377_1093581 | Not Available | 524 | Open in IMG/M |
| 3300017713|Ga0181391_1028933 | All Organisms → Viruses → Predicted Viral | 1356 | Open in IMG/M |
| 3300017714|Ga0181412_1142728 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 542 | Open in IMG/M |
| 3300017720|Ga0181383_1176423 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 570 | Open in IMG/M |
| 3300017724|Ga0181388_1038127 | All Organisms → Viruses → Predicted Viral | 1174 | Open in IMG/M |
| 3300017728|Ga0181419_1119858 | Not Available | 641 | Open in IMG/M |
| 3300017728|Ga0181419_1143449 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 574 | Open in IMG/M |
| 3300017730|Ga0181417_1000144 | Not Available | 22594 | Open in IMG/M |
| 3300017730|Ga0181417_1157314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 548 | Open in IMG/M |
| 3300017732|Ga0181415_1152280 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 516 | Open in IMG/M |
| 3300017734|Ga0187222_1032528 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 1242 | Open in IMG/M |
| 3300017737|Ga0187218_1138238 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 578 | Open in IMG/M |
| 3300017737|Ga0187218_1154077 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 542 | Open in IMG/M |
| 3300017738|Ga0181428_1115466 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 629 | Open in IMG/M |
| 3300017744|Ga0181397_1198634 | Not Available | 502 | Open in IMG/M |
| 3300017745|Ga0181427_1093830 | Not Available | 734 | Open in IMG/M |
| 3300017745|Ga0181427_1131117 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 610 | Open in IMG/M |
| 3300017745|Ga0181427_1146869 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 571 | Open in IMG/M |
| 3300017745|Ga0181427_1152346 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 560 | Open in IMG/M |
| 3300017748|Ga0181393_1190292 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 500 | Open in IMG/M |
| 3300017749|Ga0181392_1143125 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 702 | Open in IMG/M |
| 3300017749|Ga0181392_1152246 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 677 | Open in IMG/M |
| 3300017749|Ga0181392_1190990 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 591 | Open in IMG/M |
| 3300017750|Ga0181405_1030862 | All Organisms → Viruses → Predicted Viral | 1458 | Open in IMG/M |
| 3300017750|Ga0181405_1183664 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 510 | Open in IMG/M |
| 3300017751|Ga0187219_1084227 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 988 | Open in IMG/M |
| 3300017751|Ga0187219_1091765 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 934 | Open in IMG/M |
| 3300017752|Ga0181400_1197895 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 555 | Open in IMG/M |
| 3300017755|Ga0181411_1145632 | Not Available | 683 | Open in IMG/M |
| 3300017755|Ga0181411_1147039 | Not Available | 679 | Open in IMG/M |
| 3300017756|Ga0181382_1168853 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 563 | Open in IMG/M |
| 3300017757|Ga0181420_1247445 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 507 | Open in IMG/M |
| 3300017759|Ga0181414_1185953 | Not Available | 539 | Open in IMG/M |
| 3300017760|Ga0181408_1178186 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 543 | Open in IMG/M |
| 3300017762|Ga0181422_1239098 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 539 | Open in IMG/M |
| 3300017762|Ga0181422_1252146 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 522 | Open in IMG/M |
| 3300017764|Ga0181385_1272315 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 506 | Open in IMG/M |
| 3300017765|Ga0181413_1205986 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 587 | Open in IMG/M |
| 3300017765|Ga0181413_1229129 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 550 | Open in IMG/M |
| 3300017767|Ga0181406_1048401 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 1316 | Open in IMG/M |
| 3300017767|Ga0181406_1177891 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 635 | Open in IMG/M |
| 3300017767|Ga0181406_1183969 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 623 | Open in IMG/M |
| 3300017769|Ga0187221_1229099 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 530 | Open in IMG/M |
| 3300017770|Ga0187217_1289210 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 529 | Open in IMG/M |
| 3300017771|Ga0181425_1197374 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 632 | Open in IMG/M |
| 3300017772|Ga0181430_1159606 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 654 | Open in IMG/M |
| 3300017773|Ga0181386_1263038 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 508 | Open in IMG/M |
| 3300017779|Ga0181395_1220868 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 584 | Open in IMG/M |
| 3300017781|Ga0181423_1358124 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 530 | Open in IMG/M |
| 3300017781|Ga0181423_1387851 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 505 | Open in IMG/M |
| 3300017782|Ga0181380_1280212 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 548 | Open in IMG/M |
| 3300017783|Ga0181379_1118024 | Not Available | 961 | Open in IMG/M |
| 3300018416|Ga0181553_10092345 | All Organisms → Viruses → Predicted Viral | 1887 | Open in IMG/M |
| 3300018420|Ga0181563_10588479 | Not Available | 619 | Open in IMG/M |
| 3300018426|Ga0181566_10421414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 947 | Open in IMG/M |
| 3300020450|Ga0211641_10602682 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 516 | Open in IMG/M |
| 3300021335|Ga0213867_1255502 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 565 | Open in IMG/M |
| 3300021389|Ga0213868_10144576 | All Organisms → Viruses → Predicted Viral | 1478 | Open in IMG/M |
| 3300021964|Ga0222719_10241136 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 1207 | Open in IMG/M |
| 3300021964|Ga0222719_10260368 | All Organisms → Viruses → Predicted Viral | 1147 | Open in IMG/M |
| 3300022074|Ga0224906_1185314 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 573 | Open in IMG/M |
| 3300022074|Ga0224906_1223190 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 508 | Open in IMG/M |
| 3300022167|Ga0212020_1035130 | Not Available | 844 | Open in IMG/M |
| 3300022178|Ga0196887_1117989 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 573 | Open in IMG/M |
| 3300022183|Ga0196891_1031137 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 1001 | Open in IMG/M |
| 3300022187|Ga0196899_1162154 | Not Available | 614 | Open in IMG/M |
| 3300022187|Ga0196899_1214024 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 505 | Open in IMG/M |
| 3300024420|Ga0228632_1148978 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 544 | Open in IMG/M |
| 3300025070|Ga0208667_1072355 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 518 | Open in IMG/M |
| 3300025079|Ga0207890_1063229 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 604 | Open in IMG/M |
| 3300025083|Ga0208791_1084682 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 510 | Open in IMG/M |
| 3300025085|Ga0208792_1100280 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 504 | Open in IMG/M |
| 3300025086|Ga0208157_1025093 | All Organisms → Viruses → Predicted Viral | 1771 | Open in IMG/M |
| 3300025086|Ga0208157_1145305 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 526 | Open in IMG/M |
| 3300025098|Ga0208434_1113201 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 518 | Open in IMG/M |
| 3300025099|Ga0208669_1042060 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 1071 | Open in IMG/M |
| 3300025120|Ga0209535_1223121 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 504 | Open in IMG/M |
| 3300025127|Ga0209348_1217380 | Not Available | 524 | Open in IMG/M |
| 3300025128|Ga0208919_1004651 | Not Available | 6354 | Open in IMG/M |
| 3300025128|Ga0208919_1151170 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 719 | Open in IMG/M |
| 3300025128|Ga0208919_1173502 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 658 | Open in IMG/M |
| 3300025128|Ga0208919_1251389 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 513 | Open in IMG/M |
| 3300025132|Ga0209232_1106229 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 942 | Open in IMG/M |
| 3300025132|Ga0209232_1214682 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 579 | Open in IMG/M |
| 3300025138|Ga0209634_1106180 | All Organisms → Viruses → Predicted Viral | 1231 | Open in IMG/M |
| 3300025138|Ga0209634_1223720 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 700 | Open in IMG/M |
| 3300025138|Ga0209634_1319343 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 525 | Open in IMG/M |
| 3300025138|Ga0209634_1330048 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 511 | Open in IMG/M |
| 3300025138|Ga0209634_1333396 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 507 | Open in IMG/M |
| 3300025151|Ga0209645_1169571 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 662 | Open in IMG/M |
| 3300025151|Ga0209645_1211183 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 565 | Open in IMG/M |
| 3300025168|Ga0209337_1121559 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 1177 | Open in IMG/M |
| 3300025276|Ga0208814_1142320 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 548 | Open in IMG/M |
| 3300025276|Ga0208814_1156977 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 505 | Open in IMG/M |
| 3300025508|Ga0208148_1126332 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 522 | Open in IMG/M |
| 3300025645|Ga0208643_1051109 | All Organisms → Viruses → Predicted Viral | 1267 | Open in IMG/M |
| 3300025645|Ga0208643_1176887 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 520 | Open in IMG/M |
| 3300025652|Ga0208134_1168439 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 536 | Open in IMG/M |
| 3300025655|Ga0208795_1178649 | Not Available | 511 | Open in IMG/M |
| 3300025674|Ga0208162_1026582 | All Organisms → Viruses → Predicted Viral | 2160 | Open in IMG/M |
| 3300025674|Ga0208162_1070459 | All Organisms → Viruses → Predicted Viral | 1107 | Open in IMG/M |
| 3300025759|Ga0208899_1079912 | All Organisms → Viruses → Predicted Viral | 1279 | Open in IMG/M |
| 3300025769|Ga0208767_1005980 | All Organisms → Viruses | 8204 | Open in IMG/M |
| 3300025769|Ga0208767_1070389 | All Organisms → Viruses → Predicted Viral | 1518 | Open in IMG/M |
| 3300025806|Ga0208545_1169717 | Not Available | 506 | Open in IMG/M |
| 3300025815|Ga0208785_1125200 | Not Available | 611 | Open in IMG/M |
| 3300025853|Ga0208645_1247868 | Not Available | 595 | Open in IMG/M |
| 3300025881|Ga0209309_10319946 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 693 | Open in IMG/M |
| 3300025889|Ga0208644_1135503 | All Organisms → Viruses → Predicted Viral | 1152 | Open in IMG/M |
| 3300027672|Ga0209383_1072844 | All Organisms → Viruses → Predicted Viral | 1213 | Open in IMG/M |
| 3300027687|Ga0209710_1249618 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 575 | Open in IMG/M |
| 3300027779|Ga0209709_10277318 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 727 | Open in IMG/M |
| 3300029319|Ga0183748_1129221 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 532 | Open in IMG/M |
| 3300031519|Ga0307488_10315267 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 1001 | Open in IMG/M |
| 3300031598|Ga0308019_10079242 | All Organisms → Viruses → Predicted Viral | 1361 | Open in IMG/M |
| 3300031598|Ga0308019_10329299 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 562 | Open in IMG/M |
| 3300031659|Ga0307986_10264393 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 736 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 32.16% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 30.41% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 17.54% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 4.09% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.34% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.34% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 2.92% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.75% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.75% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.17% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.17% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.58% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.58% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.58% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007231 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009447 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300016766 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300024420 | Seawater microbial communities from Monterey Bay, California, United States - 40D | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025079 | Marine viral communities from the Pacific Ocean - LP-48 (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025881 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027672 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031598 | Marine microbial communities from water near the shore, Antarctic Ocean - #284 | Environmental | Open in IMG/M |
| 3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_102405502 | 3300000116 | Marine | MANGTIAFDTLQTSGQISGTAVSVDADYLAYGSAKMWVNFDGT |
| JGI24004J15324_100046141 | 3300001472 | Marine | MANGTIAFDTLSTSGQISGTAKSVDTDYLASGSAKMVINYDHRQASIMSSL |
| Ga0065861_11347862 | 3300004448 | Marine | MANGTIAFDTLSTSGQISGTAKSVDTDYLVSGSAKAWINFDGKGS |
| Ga0098038_12341151 | 3300006735 | Marine | MANGTIAFDTLQTSGQIDGTARSIDTDYLLNGSAK |
| Ga0098038_12524212 | 3300006735 | Marine | MANGTIAFDTLSTSGQITGTAKSVDTDYVVNGSAKLWIELR |
| Ga0098038_12585211 | 3300006735 | Marine | MANGTIAFDTLSTSGQISGTAKSLDTDYVVNGSLKAWGN |
| Ga0098037_12755042 | 3300006737 | Marine | MANGTIAFDTLQTSGQIDGTARSIDTDYLLNGSAKCWI |
| Ga0098042_10459213 | 3300006749 | Marine | MANGTIAFDTLQTSGQITGTAKSVDTDFVVNGVSKVWINF |
| Ga0098048_12514462 | 3300006752 | Marine | MANGTIAFDTLQTSGQISGTARSLDTDFVVSGSAKAWM |
| Ga0098054_13305032 | 3300006789 | Marine | MANGTIAFDTLQTSGQIDGTARSIDTDYLAMGSNKAWIS |
| Ga0075467_100531526 | 3300006803 | Aqueous | MANGTIAFDTLSTSGQITGTAKSVDTDYVVSGSAKCWMSF |
| Ga0070754_104740652 | 3300006810 | Aqueous | MANGTIAFDTLSTSGQITGTAKSVDTDYVVNGSAKMWVNF |
| Ga0070754_105380462 | 3300006810 | Aqueous | MANGTIAFDTLQTSGQITGTAKSLDTDFVVNGSAKTW |
| Ga0070746_104982341 | 3300006919 | Aqueous | MANGTIAFDTLSTSGQITGTAKSVDTDYVVNGSAKA |
| Ga0070746_104987571 | 3300006919 | Aqueous | MANGTIAFDTLQTSGQITGTAKSVDTDYVVNGSAKAWVH |
| Ga0070746_105363272 | 3300006919 | Aqueous | MANGTIAFDTLSTSGQISGTAKSVDTDYIVKGSAKTT |
| Ga0070748_13480131 | 3300006920 | Aqueous | MANGTIAFDTLSTSGQITGTAKSVDTDYVVNGSAKAWTH |
| Ga0098045_10259625 | 3300006922 | Marine | MANGTIAFDTLQTSGQITGTAKSLDTDYVVNGSAKS |
| Ga0098041_10727984 | 3300006928 | Marine | MANGTIAFDTLSTSGQITGTAKSVDTDYVVSGSAKMFI |
| Ga0098036_10463321 | 3300006929 | Marine | MANGTIAFDTLQTSGQITGTAKSVDTDYVVNGSAKSWL |
| Ga0098036_12223392 | 3300006929 | Marine | MANGTIAFDTLSTSGQISGTAKSVDTDFVVSGSAKAWSNHNM |
| Ga0098046_11360192 | 3300006990 | Marine | MANGTIAFDTLSTSGQIDGTARSIDTDYLAMGSNK |
| Ga0075469_100380165 | 3300007231 | Aqueous | MANGTIAFDTLQTSGQISGTAVSVDADYLAYGSAKMWVNF |
| Ga0070747_13172282 | 3300007276 | Aqueous | MANGTIAFDTLSTSGQISGTAKSLDTDYVVNGSAK |
| Ga0070747_13244812 | 3300007276 | Aqueous | MANGTIAFDTLSTSGQISGTAKSVDTDYVVNGSLKG |
| Ga0099847_12301552 | 3300007540 | Aqueous | MANGTIAFDTLQTSGQITGTAKSLDTDFVVNGSAKTWCQAPA |
| Ga0110931_12299642 | 3300007963 | Marine | MANGTIAFDTLSTSGQIDGTARSIDTDYLLNGSAK |
| Ga0110931_12340712 | 3300007963 | Marine | MANGTIAFDTLSTSGQISGTAKSVDSDYLASGSARAWI |
| Ga0114916_11485931 | 3300008221 | Deep Ocean | MTNGTIAFDTLSTSGQITGTAKSVDTDFLLNGSAK |
| Ga0102963_13330002 | 3300009001 | Pond Water | MANGTIAFDTLQTSGQITGTAKSLDTDYVVNGSAKAWYKATST |
| Ga0115566_107565862 | 3300009071 | Pelagic Marine | MANGTIAFDTLQTSGQITGTAKSVDTDYVVNGSAKAWAHTDG |
| Ga0115566_107876051 | 3300009071 | Pelagic Marine | MANGTIAFDTLSTSGQISGTAKSVDTDYLAYGSAKSW |
| Ga0115549_12118723 | 3300009074 | Pelagic Marine | MANGTIAFDTLSTSGQITGTAKSLDTDYVVSGSVKAWDHYDQKGDS |
| Ga0114998_105509331 | 3300009422 | Marine | MANGTIAFDTLSTSGQISGTAKSLDTDYLLNGSAKSWANYLTNS |
| Ga0114998_106028152 | 3300009422 | Marine | MANGTIAFDTLSTSGQISGTAKSVDTDYLAYGSNK |
| Ga0114915_12041551 | 3300009428 | Deep Ocean | MANGTIAFDTLSTSGQISGTAVSVDTDYLAYGSAKSW |
| Ga0115546_13385821 | 3300009435 | Pelagic Marine | MANGTIAFDTLSTSGQISGTAKSLDTDYVVSGSAKMVINYDQITD |
| Ga0115560_13768982 | 3300009447 | Pelagic Marine | MANGTIAFDTLSTSGQISGTARSIDTDYVVSGSAKVRYNFE |
| Ga0115571_13763282 | 3300009495 | Pelagic Marine | MANGTIAFDTLSTSGQISGTAKSVDTDYLAYGSAKSWWHCQMY |
| Ga0114906_12975981 | 3300009605 | Deep Ocean | MANGTIAFDTLSTSGQISGTAKSVDTDYLASGIKH |
| Ga0115001_106463522 | 3300009785 | Marine | MANGTIAFDTLSTSGQITGTAKSLDTDYVVNGSAKAWHHANE |
| Ga0114999_113377351 | 3300009786 | Marine | MANGTIAFDTLSTSGQISGTAKSVDTDYVVNGSSKVWAHLDLNTENTIDDS |
| Ga0098043_11984322 | 3300010148 | Marine | MANGTIAFDTLSTSGQITGTAKSVDTDYVVNGSAKVHMR |
| Ga0098043_12055391 | 3300010148 | Marine | MANGTIAFDTLQTSGQISGTAKSVDTDFVVNGSAKHWCS |
| Ga0098043_12073432 | 3300010148 | Marine | MANGTIAFDTLQTSGQIDGTARSIDTDYLLNGSAKCWIN |
| Ga0098059_14236342 | 3300010153 | Marine | MANGTIAFDTLSTSGQISGTAKSVDTDYLAYGSAKSWWHCQMYTP |
| Ga0129351_13405862 | 3300010300 | Freshwater To Marine Saline Gradient | MANGTIAFDTLSTSGQITGTAKSVDTDYVVNGSAKCW |
| Ga0129324_103921311 | 3300010368 | Freshwater To Marine Saline Gradient | MANGTIAFDTLSTSGQIDGTARSIDTDYLLNGSAKV |
| Ga0133547_115015904 | 3300010883 | Marine | MANGTIAFDTLSTSGQIDGTARSIDTDFLLNGCAKS |
| Ga0182091_14750683 | 3300016766 | Salt Marsh | MANGTIAFDTLQTSGQITGTAKSLDTDYVVSGSAKA |
| Ga0181377_10814242 | 3300017706 | Marine | MANGTIAFDTLSTSGQISGTAVSVDTDYLAYGSAKSWAHIALGGASL |
| Ga0181377_10935811 | 3300017706 | Marine | MANGTIAFDTLQTSGQITGTAKSLDTDYVVNGSAK |
| Ga0181391_10289334 | 3300017713 | Seawater | MANGTIAFDTLSTSGQISGTAKSVDTDYVVNGSAKSWAHIALGGA |
| Ga0181412_11427281 | 3300017714 | Seawater | MANGTIAFDTFSTSGQISGTAMSVDTDYVVSGSGKVWVNINH |
| Ga0181383_11764231 | 3300017720 | Seawater | MANGTIAFDTLSTSGQISGTAKSLDTDYVVNGSAKVWVNWK |
| Ga0181388_10381274 | 3300017724 | Seawater | MANGTIAFDTLQTSGQITGTAKSVDTDYVVNGSAKVHMR |
| Ga0181419_11198583 | 3300017728 | Seawater | MANETIAFDTLSTSEQITGTAKSVDTDYVVNGSAKAW |
| Ga0181419_11434491 | 3300017728 | Seawater | MANGTIAFDTLSTSGQITGTAKSLDTDYVVNGSAKVWC |
| Ga0181417_10001441 | 3300017730 | Seawater | MANGTIAFDTLSTSGQIDGTARSIDTDYLLNGSAKVWHQ |
| Ga0181417_11573141 | 3300017730 | Seawater | MANGTIAFDTLSTSGQITGTAKSVDTDYVVNGSAKC |
| Ga0181415_11522802 | 3300017732 | Seawater | MANGTIAFDTLSTSGQISGTAVSVDADYLAYGSAKVWV |
| Ga0187222_10325281 | 3300017734 | Seawater | MANGTIAFDTLSTSGQIDGTARSIDTDYLLNGSAKVWVN |
| Ga0187218_11382381 | 3300017737 | Seawater | MANGTIAFDTLSTSGQISGTAKSVDTDYVVNGSAKS |
| Ga0187218_11540771 | 3300017737 | Seawater | MANGTIAFDTLSTSGQISGTAKSVDTDYLAYGSAKSWWHCQMYT |
| Ga0181428_11154661 | 3300017738 | Seawater | MANGTIAFDTLSTSGQITGTAVSVDTDYLAYGSAKAWLH |
| Ga0181397_11986342 | 3300017744 | Seawater | MANGTIAFDTLSTSGQIDGTARSIVTDFLLNGCEKL |
| Ga0181427_10938301 | 3300017745 | Seawater | MANGTIAFDTLSTSGQITGTAKSVDTDYVVNGSAN |
| Ga0181427_11311171 | 3300017745 | Seawater | MANGTIAFDTLSTSGQITGTAKSLDTDYVVNGSAKCW |
| Ga0181427_11468692 | 3300017745 | Seawater | MANGTIAFDTLSTSGQITGTAKSVDTDYVVNGSAKAWNRFDG |
| Ga0181427_11523461 | 3300017745 | Seawater | MANGTIAFDTLSTSGQITGTAVSVDTDYLAYGSAKA |
| Ga0181393_11902921 | 3300017748 | Seawater | MANGTIAFDTLSTSGQITGTAKSLDTDYVVNGSAKV |
| Ga0181392_11431253 | 3300017749 | Seawater | MWRPSIMANGTIAFDTLQTSGQITGTAKSVDTDYVVNGSAKAW |
| Ga0181392_11522461 | 3300017749 | Seawater | MANGTIAFDTLSTSGQITGTAKSLDTDYVVNGSAKCWWQ |
| Ga0181392_11909901 | 3300017749 | Seawater | MANGTIAFDTLSTSGQISGTAKSLDTDYVVNGSAKCWWQVDGTGTP |
| Ga0181405_10308624 | 3300017750 | Seawater | MANGTIAFDTLQTSGQISGTAVSVDTDYLAYGSARSWADFTMASTPS |
| Ga0181405_11836641 | 3300017750 | Seawater | MANGTIAFDTLSTSGQITGTAKSLDTDYVVNGSAKAWF |
| Ga0187219_10842271 | 3300017751 | Seawater | MANGTIAFDTLSTSGQITGTAKSLDTDYVVNGSAKC |
| Ga0187219_10917653 | 3300017751 | Seawater | MANGTIAFDTLSTSGQITGTAKSLDTDYVVNGSVKA |
| Ga0181400_11978951 | 3300017752 | Seawater | MANGTIAFDTLSTSGQISGTARSLDTDFVVNGSAKAWVNFNGTGT |
| Ga0181411_10757671 | 3300017755 | Seawater | MANGTIAFDTLSTSGQISGTAKSVDTDYIVNGSAKAWYKATSTV |
| Ga0181411_11456323 | 3300017755 | Seawater | MANGTIAFDTLSTSGQISGTAKSVDTDYLASGSAKVWVSFDGTA |
| Ga0181411_11470391 | 3300017755 | Seawater | MANGTIAFDTLSTSGQIESRTTGLSIDTDYLVHGVN |
| Ga0181382_11688532 | 3300017756 | Seawater | MANGTIAFDTLSTSGQISGTAKSLDTDYVVNGSAKSWI |
| Ga0181382_12034042 | 3300017756 | Seawater | MANGTIAFDTLQTSGQISGTAKSVDTDYLASGSAKAWGMVNMTLSSSYVLDSL |
| Ga0181420_12474452 | 3300017757 | Seawater | MANGTIAFDTLSTSGQIDGTARSIDTDYLLNGCAKLWMNLD |
| Ga0181414_11859532 | 3300017759 | Seawater | MANGTIAFDTLQTSGQISGTAKSVDTDYIVHGSAK |
| Ga0181408_11781862 | 3300017760 | Seawater | MANGTIAFDTLSTSGQITGTAKSVDTDYVVNGSAKCWWQVDGTGT |
| Ga0181422_12390981 | 3300017762 | Seawater | MANGTIAFDTLSTSGQISGTARSLDTDYLAYGSAKSWWHCQMYTPS |
| Ga0181422_12521462 | 3300017762 | Seawater | MANGTIAFDTLSTSGQITGTAKSLDTDYVVNGSAKA |
| Ga0181385_12723152 | 3300017764 | Seawater | MANGTIAFDTLQTSGQITGTAKSVDTDYVVNGSAKGW |
| Ga0181413_12059861 | 3300017765 | Seawater | MANGTIAFDTLSTSGQISGTAKSVDTDYIVSSSAKHFIVYKS |
| Ga0181413_12291292 | 3300017765 | Seawater | MANGTIAFDTLSTSGQISGTAKSVDTDYVVNGSAKAWYK |
| Ga0181406_10484014 | 3300017767 | Seawater | MANGTIAFDTLSTSGQIDGTARSIDTDYLLNGSAKVWV |
| Ga0181406_11778913 | 3300017767 | Seawater | MANGTIAFDTLSTSGQITGTAKSVDTDYVVNGSAKGWINYKS |
| Ga0181406_11839692 | 3300017767 | Seawater | MANGTIAFDTLSTSGQISGTAKSLDTDYLAYGSAKVRYNFELDSS |
| Ga0187221_12290992 | 3300017769 | Seawater | MANGTIAFDTLSTSGQITGTAKSLDTDYVVNGSVKAWV |
| Ga0187217_12892102 | 3300017770 | Seawater | MANGTIAFDTLSTSGQISGTAKSLDTDYVVNGSAKCWWQ |
| Ga0181425_11973743 | 3300017771 | Seawater | MANGTIAFDTLSTSGQITGTAKSLDTDYVVNGSAKVFP |
| Ga0181430_11596061 | 3300017772 | Seawater | MANGTIAFDTLSTSGQITGTAKSVDTDYVVNGSAKVWC |
| Ga0181386_12630381 | 3300017773 | Seawater | MANGTIAFDTLSTSGQITGTAKSVDTDYLASGSVKVWP |
| Ga0181395_12208682 | 3300017779 | Seawater | MANGTIAFDTLSTSGQISGTAKSVDTDYVVNGSAKMV |
| Ga0181423_13581242 | 3300017781 | Seawater | MANGTIAFDTLSTSGQITGTAKSLDTDYLASGSAKAW |
| Ga0181423_13878512 | 3300017781 | Seawater | MANGTIAFDTLSTSGQITGTAKSVDTDYVVNGSAKAWTHLNGS |
| Ga0181380_12802121 | 3300017782 | Seawater | MANGTIAFDTLSTSGQISGTAKSLDTDYVVNGSAKS |
| Ga0181379_11180243 | 3300017783 | Seawater | MANGTIAFDTLSTSGQISGTAKSLDTDYVVNGSAKSW |
| Ga0181553_100923456 | 3300018416 | Salt Marsh | MANGTIAFDTLQTSGQITGTAKSLDTDYVVNGSARMVINYDQI |
| Ga0181563_105884791 | 3300018420 | Salt Marsh | MANGTVAFDTLQTSGQITGTAKSLDTDYVVNGSAKALELHDG |
| Ga0181566_104214143 | 3300018426 | Salt Marsh | MANGTIAFDTLQTSGQITGTAKSVDIDYVVNGSSKH |
| Ga0211641_106026821 | 3300020450 | Marine | MANGTIAFDTLQTSGQITGTAKSVDTDFVVNGSAKMFNAARYSGG |
| Ga0213867_12555022 | 3300021335 | Seawater | MANGTIAFDTLSTSGQITGTAKSVDTDSVVNGSAKAW |
| Ga0213868_101445765 | 3300021389 | Seawater | MANGTIAFDTLSTSGQITGTAKSVDTDYVVNGSAKCWWQVD |
| Ga0222719_102411364 | 3300021964 | Estuarine Water | MANGTIAFDTLSTSGQITGTAKSVDTDYVVNGSAKVW |
| Ga0222719_102603681 | 3300021964 | Estuarine Water | MANGTIAFDTLQTSGQITGTAKSVDTDYVVNGSAK |
| Ga0224906_11853141 | 3300022074 | Seawater | MANGTIAFDTLSTSGQITGTAVSVDTDYLAYGSAK |
| Ga0224906_12231901 | 3300022074 | Seawater | MANGTIAFDTLSTSGQITGTAKSVDTDYVVNGSAKMVINYDQIADVV |
| Ga0212020_10351301 | 3300022167 | Aqueous | MANGTIAFDTLQTSGQITGTAKSVDTDYVVSGGAKTWFVYDQF |
| Ga0196887_11179892 | 3300022178 | Aqueous | MANGTIAFDTLSTSGQISGTAVSVDADYLAYGSVKMW |
| Ga0196891_10311371 | 3300022183 | Aqueous | MANGTIAFDTLSTSGQITGTAKSVDTDYVVNGSAKVLGQKNTAG |
| Ga0196899_11621542 | 3300022187 | Aqueous | MANGTIAFDTLQTSGQITGTAKSLDTDYVVNGSSKHWINFNG |
| Ga0196899_12140241 | 3300022187 | Aqueous | MANGTIAFDTLSTSGQISGTAKSVDTDYLAYGTNKVW |
| Ga0228632_11489782 | 3300024420 | Seawater | MANGTIAFDTLSTSGQISGTAKSIDTDYLLNGVLKAWIHFNQAASS |
| Ga0208667_10723551 | 3300025070 | Marine | MANGTIAFDTLSTSGQITGTAKSLDTDYVVNGSAKAWVHAVEDAV |
| Ga0207890_10632292 | 3300025079 | Marine | MANGTIAFDTLSTSGQISGTAVSLDTDYLAYGSAKAWV |
| Ga0208791_10846822 | 3300025083 | Marine | MANGTIAFDTLSTSGQIDGTARSIDTDYLAMGSNKA |
| Ga0208792_11002802 | 3300025085 | Marine | MANGTIAFDTLSTSGQITGTAKSVDTDYVVTGSPKSWIAV |
| Ga0208157_10250931 | 3300025086 | Marine | MANGTIAFDTLSTSGQISGTAKSLDTDYVVNGSLKAWGNLN |
| Ga0208157_11453052 | 3300025086 | Marine | MANGTIAFDTLSTSGQITGTAKSLDTDYVVNGSAKAWVH |
| Ga0208434_11132012 | 3300025098 | Marine | MANGTIAFDTLQTSGQITGTAKSLDTDYVVTGSPRAWIN |
| Ga0208669_10420601 | 3300025099 | Marine | MANGTIAFDTLSTSGQIDGTARSIDTDYLAMGSNKAWI |
| Ga0209535_12231212 | 3300025120 | Marine | MANGTIAFDTLSTSGQISGTAKSVDTDYLAYGSAKAWVNHNQ |
| Ga0209348_12173801 | 3300025127 | Marine | MANGTIAFDTLQTSGQITGTAKSVDTDFVVTGSAKAA |
| Ga0208919_10046511 | 3300025128 | Marine | MANGTIAFDTLSTSGQISGTAKSLDTDYVVTGTNKAWI |
| Ga0208919_11511701 | 3300025128 | Marine | MANGTIAFDTLSTSGQISGTAKSVDTDYVVNGSAKSFETHD |
| Ga0208919_11735022 | 3300025128 | Marine | MANGTIAFDTLSTSGQIDGTARSIDTDYLLNGSNKAWTNI |
| Ga0208919_12513892 | 3300025128 | Marine | MANGTIAFDTLQTSGQIDGTARSIDTDYLLNGSAKCWINY |
| Ga0209232_11062293 | 3300025132 | Marine | MANGTIAFDTLQTSGQISGTAVSVDADYLAYGSAKSWINLNGSSFGLR |
| Ga0209232_12146822 | 3300025132 | Marine | MANGTIAFDTLQTSGQITGTAKSVDTDFVVTGSAKAAYAFNIDS |
| Ga0209634_11061804 | 3300025138 | Marine | MANGTIAFDTLSTSGQISGTAKSVDTDYLAYGSAKCW |
| Ga0209634_12237201 | 3300025138 | Marine | MANGTIAFDTLSTSGQISGTAKSVDTDYLVHGAVKASAM |
| Ga0209634_13193432 | 3300025138 | Marine | MANGTIAFDTLSTSGQISGTAVSVDTDYLAYGSAKAWLE |
| Ga0209634_13300482 | 3300025138 | Marine | MANGTIAFDTLSTSGQISGTAKSVDTDYLASGSAKAWVQLNG |
| Ga0209634_13333961 | 3300025138 | Marine | MANGTIAFDTLSTSGQIDGTARSIDTDFLLNGCAKVW |
| Ga0209645_11695711 | 3300025151 | Marine | MANGTIAFDTLQTSGQITGTAKSVDTDFVVNGSAKATLTF |
| Ga0209645_12111831 | 3300025151 | Marine | MANGTIAFDTLQTSGQITGTAKSVDTDFVVTGSAKAAYAFN |
| Ga0209337_11215591 | 3300025168 | Marine | MANGTIAFDTLSTSGQISGTARSIDADYLLNGANKIWFNL |
| Ga0208814_11423202 | 3300025276 | Deep Ocean | MANGTIAFDTLSTSGQISGTAVSVDADYLAYGSAKMWIN |
| Ga0208814_11569772 | 3300025276 | Deep Ocean | MANGTIAFDTLSTSGQISGTAKSIDTDFLLNGSAKAWCK |
| Ga0208148_11263322 | 3300025508 | Aqueous | MANGTIAFDTLSTSGQISGTAVSVDADYLAYGSAKMWVNF |
| Ga0208643_10511094 | 3300025645 | Aqueous | MANGTIAFDTLQTSGQITGTAKSVDTDYVVNGSAKS |
| Ga0208643_11768872 | 3300025645 | Aqueous | MANGTIAFDTLSTSGQISGTAKSVDTDYVVSGSAK |
| Ga0208134_11684391 | 3300025652 | Aqueous | MANGTIAFDTLSTSGQISGTAKSVDTDYVVNGSAKAWTHLN |
| Ga0208795_11786492 | 3300025655 | Aqueous | MANGTIAFDTLQTSGQITGTAKSLDTDYVVNGSAKC |
| Ga0208162_10265826 | 3300025674 | Aqueous | MANGTIAFDTLSTSGQISGTAKSVDTDYLAYGTNKVWALTNQIT |
| Ga0208162_10704591 | 3300025674 | Aqueous | MANGTIAFDTLQTSGQITGTAKSLDTDYVVNGSAKCWH |
| Ga0208899_10799121 | 3300025759 | Aqueous | MANGTIAFDTLQTSGQITGTAKSVDTDYVVNGSAKVWMQAVGA |
| Ga0208767_100598015 | 3300025769 | Aqueous | MANGTIAFDTLQTSGQITGTAKSVDTDYVVNGSAKAWV |
| Ga0208767_10703893 | 3300025769 | Aqueous | MANGTIAFDTLQTSGQITGTAKSVDTDYVVNGSAKVW |
| Ga0208545_11697171 | 3300025806 | Aqueous | MANGTIAFDTLQTSGQITGTAKSVDTDYVVNGSAKMW |
| Ga0208785_11252001 | 3300025815 | Aqueous | MANGTIAFDTLQTSGQITGTAKSVDTDYVVSGGAKTWFVYDQSNDT |
| Ga0208645_12478682 | 3300025853 | Aqueous | MANGTIAFDTLQTSGQITGTAKSVDTYYVVSGGAKTWF |
| Ga0209309_103199463 | 3300025881 | Pelagic Marine | MANGTIAFDTLSTSGQISGTARSIDTDYVVSGSAKVRYNFEL |
| Ga0208644_11355031 | 3300025889 | Aqueous | MANGTIAFDTLQTSGQITGTAKSVDTDYVVSAIAKVVGG |
| Ga0209383_10728441 | 3300027672 | Marine | MANGTIAFDTLSTSGQISGTAVSVDADYLAYGSAK |
| Ga0209710_12496182 | 3300027687 | Marine | MANGTIAFDTLSTSGQISGTAVSVDTDYLAYGSAKAWAN |
| Ga0209709_102773181 | 3300027779 | Marine | MANGTIAFDTLSTSGQISGTAVSVDADYLAYGSAKAWANVNQTSSQAI |
| Ga0183748_11106191 | 3300029319 | Marine | MANGTIAFDTLQTSGQISGTAKSVDTDYIATGVPKAQLMFDHVDT |
| Ga0183748_11292211 | 3300029319 | Marine | MANGTIAFDTLQTSGQIKGTAKSVDTDFIVSGSARSYLAI |
| Ga0307488_103152671 | 3300031519 | Sackhole Brine | MANGTIAFDTLSTSGQISGTAKSVDTDYLAYGSARAWCHLDLNTENTIDD |
| Ga0308019_100792424 | 3300031598 | Marine | MANGTIAFDTLSTSGQISGTAKSVDTDYLAYGSSK |
| Ga0308019_103292992 | 3300031598 | Marine | MANGTIAFDTLSTSGQISGTAVSVDADYLAYGSAKM |
| Ga0307986_102643931 | 3300031659 | Marine | MANGTIAFDTLSTSGQISGIAVSLDTDYLAYGSAKAWANTSG |
| ⦗Top⦘ |