Metagenome Family F035575

Basic Information
Family ID	F035575
Family Type	Metagenome
Number of Sequences	171
Average Sequence Length	46 residues
Representative Sequence	VPETTAQQDETIRGIAATEEEQLDAQQEGMVESDPSDSSDDDYQDIP
Number of Associated Samples	65
Number of Associated Scaffolds	171

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	12.50 %
% of genes near scaffold ends (potentially truncated)	35.67 %
% of genes from short scaffolds (< 2000 bps)	93.57 %
Associated GOLD sequencing projects	65
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.41

Most Common Taxonomy
Group	Unclassified (52.632 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (95.322 % of family members)
Environment Ontology (ENVO)	Unclassified (95.322 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (95.322 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 44.00% β-sheet: 0.00% Coil/Unstructured: 56.00%
Feature Viewer

Powered by Feature Viewer

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.63 %
All Organisms	root	All Organisms	47.37 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.63 %
cellular organisms	root	All Organisms → cellular organisms	46.78 %
Viruses	superkingdom	All Organisms → Viruses	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.63 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	46.78 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.63 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	46.78 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.63 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	46.78 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.63 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	46.78 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.63 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	46.78 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.63 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	46.78 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.63 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	46.78 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.63 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	46.78 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.63 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	46.78 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.63 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	46.78 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.63 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	46.78 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.63 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	46.78 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.63 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	46.78 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.63 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	46.78 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.63 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	46.78 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.63 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	46.78 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.63 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	46.78 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.63 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	46.78 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.63 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	46.78 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.63 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	18.71 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.63 %
Saccharum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum	18.71 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.63 %
Saccharum officinarum complex	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex	18.71 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.63 %
Saccharum hybrid cultivar	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	18.71 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.58 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300013296\|Ga0157374_12117609	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	589	Open in IMG/M
3300013297\|Ga0157378_11431802	Not Available	734	Open in IMG/M
3300013297\|Ga0157378_12211259	Not Available	601	Open in IMG/M
3300013297\|Ga0157378_12490946	Not Available	569	Open in IMG/M
3300013297\|Ga0157378_12836418	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	537	Open in IMG/M
3300014969\|Ga0157376_12255982	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	583	Open in IMG/M
3300015267\|Ga0182122_1051451	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	555	Open in IMG/M
3300015267\|Ga0182122_1052597	Not Available	551	Open in IMG/M
3300015267\|Ga0182122_1058515	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	534	Open in IMG/M
3300015268\|Ga0182154_1038377	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	605	Open in IMG/M
3300015274\|Ga0182188_1029579	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	611	Open in IMG/M
3300015274\|Ga0182188_1032731	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	596	Open in IMG/M
3300015274\|Ga0182188_1033878	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	591	Open in IMG/M
3300015274\|Ga0182188_1048980	Not Available	537	Open in IMG/M
3300015275\|Ga0182172_1064756	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	529	Open in IMG/M
3300015276\|Ga0182170_1011528	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	852	Open in IMG/M
3300015276\|Ga0182170_1031172	Not Available	653	Open in IMG/M
3300015276\|Ga0182170_1060901	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	541	Open in IMG/M
3300015277\|Ga0182128_1053463	Not Available	565	Open in IMG/M
3300015277\|Ga0182128_1057781	Not Available	553	Open in IMG/M
3300015277\|Ga0182128_1065085	Not Available	534	Open in IMG/M
3300015279\|Ga0182174_1021492	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	747	Open in IMG/M
3300015279\|Ga0182174_1061815	Not Available	556	Open in IMG/M
3300015282\|Ga0182124_1025060	Not Available	703	Open in IMG/M
3300015282\|Ga0182124_1041987	Not Available	612	Open in IMG/M
3300015283\|Ga0182156_1087377	Not Available	503	Open in IMG/M
3300015285\|Ga0182186_1072412	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	524	Open in IMG/M
3300015285\|Ga0182186_1074531	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	520	Open in IMG/M
3300015286\|Ga0182176_1014781	Not Available	877	Open in IMG/M
3300015286\|Ga0182176_1032008	Not Available	685	Open in IMG/M
3300015286\|Ga0182176_1037603	Not Available	651	Open in IMG/M
3300015286\|Ga0182176_1063306	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	554	Open in IMG/M
3300015286\|Ga0182176_1071872	Not Available	532	Open in IMG/M
3300015287\|Ga0182171_1025367	Not Available	718	Open in IMG/M
3300015287\|Ga0182171_1043807	Not Available	619	Open in IMG/M
3300015287\|Ga0182171_1063300	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	556	Open in IMG/M
3300015288\|Ga0182173_1007959	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	969	Open in IMG/M
3300015288\|Ga0182173_1035827	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	648	Open in IMG/M
3300015288\|Ga0182173_1053040	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	581	Open in IMG/M
3300015288\|Ga0182173_1067219	Not Available	542	Open in IMG/M
3300015289\|Ga0182138_1011533	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	892	Open in IMG/M
3300015289\|Ga0182138_1065316	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	552	Open in IMG/M
3300015289\|Ga0182138_1079602	Not Available	521	Open in IMG/M
3300015289\|Ga0182138_1080932	Not Available	518	Open in IMG/M
3300015291\|Ga0182125_1018601	Not Available	801	Open in IMG/M
3300015291\|Ga0182125_1074259	Not Available	542	Open in IMG/M
3300015291\|Ga0182125_1093940	Not Available	503	Open in IMG/M
3300015292\|Ga0182141_1020113	Not Available	782	Open in IMG/M
3300015292\|Ga0182141_1059056	Not Available	579	Open in IMG/M
3300015295\|Ga0182175_1070407	Not Available	558	Open in IMG/M
3300015296\|Ga0182157_1034996	Not Available	693	Open in IMG/M
3300015296\|Ga0182157_1045901	Not Available	642	Open in IMG/M
3300015296\|Ga0182157_1066650	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	576	Open in IMG/M
3300015296\|Ga0182157_1072288	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	561	Open in IMG/M
3300015296\|Ga0182157_1083987	Not Available	536	Open in IMG/M
3300015299\|Ga0182107_1069977	Not Available	570	Open in IMG/M
3300015299\|Ga0182107_1098539	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	512	Open in IMG/M
3300015299\|Ga0182107_1100646	Not Available	508	Open in IMG/M
3300015300\|Ga0182108_1016663	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	868	Open in IMG/M
3300015300\|Ga0182108_1048039	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	642	Open in IMG/M
3300015300\|Ga0182108_1093275	Not Available	524	Open in IMG/M
3300015300\|Ga0182108_1093523	Not Available	524	Open in IMG/M
3300015300\|Ga0182108_1102074	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	509	Open in IMG/M
3300015303\|Ga0182123_1048218	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	620	Open in IMG/M
3300015303\|Ga0182123_1053294	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	603	Open in IMG/M
3300015304\|Ga0182112_1052872	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	620	Open in IMG/M
3300015304\|Ga0182112_1094678	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	521	Open in IMG/M
3300015304\|Ga0182112_1098533	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	514	Open in IMG/M
3300015305\|Ga0182158_1030824	Not Available	720	Open in IMG/M
3300015305\|Ga0182158_1035365	Not Available	693	Open in IMG/M
3300015305\|Ga0182158_1045503	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	645	Open in IMG/M
3300015305\|Ga0182158_1079632	Not Available	547	Open in IMG/M
3300015308\|Ga0182142_1024353	Not Available	799	Open in IMG/M
3300015308\|Ga0182142_1046780	Not Available	662	Open in IMG/M
3300015308\|Ga0182142_1078103	Not Available	568	Open in IMG/M
3300015308\|Ga0182142_1090072	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	543	Open in IMG/M
3300015308\|Ga0182142_1090771	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	542	Open in IMG/M
3300015314\|Ga0182140_1028099	Not Available	768	Open in IMG/M
3300015314\|Ga0182140_1042633	Not Available	682	Open in IMG/M
3300015314\|Ga0182140_1097615	Not Available	531	Open in IMG/M
3300015321\|Ga0182127_1039789	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	716	Open in IMG/M
3300015322\|Ga0182110_1012131	All Organisms → Viruses → Predicted Viral	1001	Open in IMG/M
3300015341\|Ga0182187_1032057	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	945	Open in IMG/M
3300015341\|Ga0182187_1046150	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	839	Open in IMG/M
3300015341\|Ga0182187_1156473	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	551	Open in IMG/M
3300015341\|Ga0182187_1159851	Not Available	546	Open in IMG/M
3300015342\|Ga0182109_1074086	Not Available	757	Open in IMG/M
3300015342\|Ga0182109_1132342	Not Available	614	Open in IMG/M
3300015342\|Ga0182109_1159864	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	572	Open in IMG/M
3300015342\|Ga0182109_1211211	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	513	Open in IMG/M
3300015343\|Ga0182155_1110709	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	653	Open in IMG/M
3300015343\|Ga0182155_1129077	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	618	Open in IMG/M
3300015343\|Ga0182155_1185301	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	541	Open in IMG/M
3300015343\|Ga0182155_1225227	Not Available	502	Open in IMG/M
3300015344\|Ga0182189_1075462	Not Available	758	Open in IMG/M
3300015344\|Ga0182189_1200693	Not Available	529	Open in IMG/M
3300015344\|Ga0182189_1226802	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	504	Open in IMG/M
3300015345\|Ga0182111_1203666	Not Available	540	Open in IMG/M
3300015346\|Ga0182139_1124646	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	653	Open in IMG/M
3300015346\|Ga0182139_1130959	Not Available	641	Open in IMG/M
3300015346\|Ga0182139_1197896	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	547	Open in IMG/M
3300015347\|Ga0182177_1113718	Not Available	678	Open in IMG/M
3300015347\|Ga0182177_1122242	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	660	Open in IMG/M
3300015347\|Ga0182177_1145173	Not Available	619	Open in IMG/M
3300015347\|Ga0182177_1180921	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	569	Open in IMG/M
3300015347\|Ga0182177_1195791	Not Available	552	Open in IMG/M
3300015351\|Ga0182161_1050303	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	958	Open in IMG/M
3300015351\|Ga0182161_1095671	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	753	Open in IMG/M
3300015351\|Ga0182161_1155383	Not Available	625	Open in IMG/M
3300015351\|Ga0182161_1157987	Not Available	621	Open in IMG/M
3300015351\|Ga0182161_1168990	Not Available	605	Open in IMG/M
3300015351\|Ga0182161_1262487	Not Available	506	Open in IMG/M
3300015355\|Ga0182159_1109207	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	828	Open in IMG/M
3300015355\|Ga0182159_1275323	Not Available	559	Open in IMG/M
3300015355\|Ga0182159_1349078	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	503	Open in IMG/M
3300015355\|Ga0182159_1349514	Not Available	503	Open in IMG/M
3300015361\|Ga0182145_1160083	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	537	Open in IMG/M
3300017404\|Ga0182203_1092618	Not Available	607	Open in IMG/M
3300017404\|Ga0182203_1098881	Not Available	594	Open in IMG/M
3300017404\|Ga0182203_1115583	Not Available	565	Open in IMG/M
3300017404\|Ga0182203_1135157	Not Available	536	Open in IMG/M
3300017404\|Ga0182203_1140472	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	529	Open in IMG/M
3300017404\|Ga0182203_1141448	Not Available	528	Open in IMG/M
3300017409\|Ga0182204_1024985	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	801	Open in IMG/M
3300017409\|Ga0182204_1068014	Not Available	598	Open in IMG/M
3300017409\|Ga0182204_1105656	Not Available	522	Open in IMG/M
3300017410\|Ga0182207_1054293	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	743	Open in IMG/M
3300017410\|Ga0182207_1098775	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	613	Open in IMG/M
3300017411\|Ga0182208_1080554	Not Available	584	Open in IMG/M
3300017411\|Ga0182208_1116427	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	520	Open in IMG/M
3300017413\|Ga0182222_1066678	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	571	Open in IMG/M
3300017413\|Ga0182222_1069173	Not Available	566	Open in IMG/M
3300017415\|Ga0182202_1061289	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	654	Open in IMG/M
3300017417\|Ga0182230_1056300	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	694	Open in IMG/M
3300017420\|Ga0182228_1082880	Not Available	591	Open in IMG/M
3300017420\|Ga0182228_1107217	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	538	Open in IMG/M
3300017424\|Ga0182219_1060705	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	652	Open in IMG/M
3300017424\|Ga0182219_1085529	Not Available	587	Open in IMG/M
3300017425\|Ga0182224_1026293	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	888	Open in IMG/M
3300017427\|Ga0182190_1080570	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	643	Open in IMG/M
3300017427\|Ga0182190_1143372	Not Available	528	Open in IMG/M
3300017430\|Ga0182192_1049738	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	772	Open in IMG/M
3300017433\|Ga0182206_1065233	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	668	Open in IMG/M
3300017438\|Ga0182191_1131989	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	562	Open in IMG/M
3300017442\|Ga0182221_1126734	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	552	Open in IMG/M
3300017443\|Ga0182193_1147159	Not Available	557	Open in IMG/M
3300017443\|Ga0182193_1193963	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	505	Open in IMG/M
3300017683\|Ga0182218_1071896	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	636	Open in IMG/M
3300017684\|Ga0182225_1065723	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	642	Open in IMG/M
3300017684\|Ga0182225_1116301	Not Available	538	Open in IMG/M
3300017684\|Ga0182225_1124322	Not Available	527	Open in IMG/M
3300017685\|Ga0182227_1057041	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	703	Open in IMG/M
3300017685\|Ga0182227_1081914	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	609	Open in IMG/M
3300017686\|Ga0182205_1069245	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	681	Open in IMG/M
3300017686\|Ga0182205_1112076	Not Available	581	Open in IMG/M
3300017686\|Ga0182205_1138843	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	540	Open in IMG/M
3300017690\|Ga0182223_1026151	Not Available	769	Open in IMG/M
3300017690\|Ga0182223_1092097	Not Available	547	Open in IMG/M
3300025942\|Ga0207689_11349034	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum hybrid cultivar	599	Open in IMG/M
3300026118\|Ga0207675_102119874	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	578	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	95.32%
Rhizosphere	Host-Associated → Plants → Rhizosphere	3.51%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.17%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	95.32%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	3.51%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.17%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	95.32%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	3.51%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.17%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	95.32%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.51%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.58%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.58%

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0157374_121176091	3300013296	Miscanthus Rhizosphere	MLETAAQQYEIIRGIAATEEEELTQQEGVVVSDPNDSSNDDYQPVPQMPPQ
Ga0157378_114318022	3300013297	Miscanthus Rhizosphere	VAQQDDTIRGITAIEEEQLDAQQEGMVESDPSDSSDEHYLDIPQMPPQ*
Ga0157378_122112591	3300013297	Miscanthus Rhizosphere	AAQQDKIIRGIAATEEEQLEAQQGMTESSDSSDDDYLPIP*
Ga0157378_124909461	3300013297	Miscanthus Rhizosphere	VLEIVAQQDEIIRGIAAIEEEELDAQQEGMVESDPSDSSDDDY*
Ga0157378_128364181	3300013297	Miscanthus Rhizosphere	VPETVAQQDDIIRGIVATEKEELAQQEGLVTSEPSDSSDNDYQPIPQM
Ga0157376_122559821	3300014969	Miscanthus Rhizosphere	VPETAAQQDETIRGIAATEKEQLDAQQEGMVESDPSDSSDDDYQDISQMPPR*
Ga0182122_10514511	3300015267	Miscanthus Phyllosphere	VPETTAQQDEIIRGVAATNKKQLDAQQEGMDETDPSDSSDDDYQAIPQM
Ga0182122_10525971	3300015267	Miscanthus Phyllosphere	EVPETAAQQDETIRGIAATKEEQLDAQQEGMVESDPSDSSDDDYQAIP*
Ga0182122_10585152	3300015267	Miscanthus Phyllosphere	VPESIAQQDDIIRGIAATEEEELAQQEGVVVSDPSDSSDD
Ga0182154_10383772	3300015268	Miscanthus Phyllosphere	VLETAAQQDETIRGIAATEEEQLDAQQEGMVESDPSDSSDDDY*
Ga0182113_10689291	3300015269	Miscanthus Phyllosphere	VPETAAQQDDIIRGIATTEEELAQQEGLVTSEPSDSSDDDYQPIPQMPP*
Ga0182188_10295792	3300015274	Miscanthus Phyllosphere	VPETAAQQDATIRSIAAIEEEQLDAQQEGMVASDPSDSSNKDYYEIP*
Ga0182188_10327312	3300015274	Miscanthus Phyllosphere	VPETIAQQDDIIRGIVATEEEELAQQEGLVTSEPSDSSNDDY*
Ga0182188_10338781	3300015274	Miscanthus Phyllosphere	VPESVAQQDEIIRGIAATKEEQLEAQQEGSDPSDSSDDDY*
Ga0182188_10489801	3300015274	Miscanthus Phyllosphere	VPETVTQQDDIIRGIAAIKEEELAQQEGMVESDPSDSSDEDYREIP*
Ga0182172_10295681	3300015275	Miscanthus Phyllosphere	AAQQDATIRDVAATKEEQLDAQQEGMVESDPSDSSDEDYQDIP*
Ga0182172_10647561	3300015275	Miscanthus Phyllosphere	VQETVAQQDDIIRGIAAIEEEQLAQQEGMVESDPSDSSDKDYRDIP*
Ga0182170_10115282	3300015276	Miscanthus Phyllosphere	VPESVAQRNEIIRDIAAIEEEQLDAQQEGMVESDPSDSSDDDYQAIPKMPP*
Ga0182170_10311721	3300015276	Miscanthus Phyllosphere	VPKSIAQQDETIRGIAATEEEELDAQQEGMVESDPSDISDDDYQAIPQMPP*
Ga0182170_10609012	3300015276	Miscanthus Phyllosphere	VPETAAQQDDIIKGIAAIEEEQLSQQEGMVMSEPSDSSNDDY
Ga0182128_10534631	3300015277	Miscanthus Phyllosphere	AAQQDETIKGIAATEEEQLDAQQEGMEESDPNDSSDDDYRDIP*
Ga0182128_10577811	3300015277	Miscanthus Phyllosphere	VPESAAQHDETIRGIAMTEEEELDAQQEGMVESDPSDSTDDDYQDIPRMPPQ*
Ga0182128_10650851	3300015277	Miscanthus Phyllosphere	VPETVAQQDETIRGIAAIGEEQLDAQQDGMVESDPSDSSDDDYQAIPQMPP*
Ga0182174_10214921	3300015279	Miscanthus Phyllosphere	VPESVAQQDEIIRGIAATEEEELAQQEGMVVSDPSDSSDEDYQPIP*
Ga0182174_10618151	3300015279	Miscanthus Phyllosphere	VPETATQQDEIIRGVAATEEEQLDAQQEGMVESDPSDSSDDDYQAISSNASSTT*
Ga0182124_10250601	3300015282	Miscanthus Phyllosphere	DCSQADETIRGIVATEEEQLDAQQEGMVMSDPSDSSDDDYQPIPQMPP*
Ga0182124_10419871	3300015282	Miscanthus Phyllosphere	VPESAAQQDEIIRGIAAIEEEQLDAQQEGMVESDHDY*
Ga0182156_10873771	3300015283	Miscanthus Phyllosphere	VPETTAQQDETIRGIAAKEEEQLDAQQEGMVESDPCDSLD
Ga0182186_10724121	3300015285	Miscanthus Phyllosphere	VLETVAQQDEIIRGIAAIEEEQLDAQQEGVVESDPSDSSDNDY*
Ga0182186_10745311	3300015285	Miscanthus Phyllosphere	VPETAAQRDEIIRGVAATEEEQLDAQQEGMVESDPNDSSDDND
Ga0182176_10147812	3300015286	Miscanthus Phyllosphere	VPKTAAQQDATIRDIAATKKEQLDAQQEGMVESDPSDNSDEDYRGIPQMPP*
Ga0182176_10320081	3300015286	Miscanthus Phyllosphere	TIRGIAATEKEQLDAQQEGMVENDPSDSSDDDYRDISQMPPR*
Ga0182176_10376031	3300015286	Miscanthus Phyllosphere	MLESAAQQDDIIRGIVATEEEELAQQEGMVMSDPSDSSDDDY*
Ga0182176_10633061	3300015286	Miscanthus Phyllosphere	VPETIGQQDDTIKGIAAIEEEQLDAQQEGMVKSEPSDSLDEDYQDIP*
Ga0182176_10718721	3300015286	Miscanthus Phyllosphere	RPDVPESAAQQDEIIRGIAATEEEQLQAQEERTESNDSSDDDYLPIP*
Ga0182171_10253671	3300015287	Miscanthus Phyllosphere	VPESVAQQDETIRGIVAIEEEQLDAQQEGMVESDPSDSSDDDY*
Ga0182171_10438072	3300015287	Miscanthus Phyllosphere	TAAQQDDTIRGIAAIEEEQLDAQQEGMVESDPSDSLDDDYRDIPQMPP*
Ga0182171_10633001	3300015287	Miscanthus Phyllosphere	VPETVAQQDETIRGIAAIEKEQLDAQQEGMVESDPSDSSDEDYRDIPQMPPCRPD
Ga0182171_10634371	3300015287	Miscanthus Phyllosphere	VPETAAQQDDIIRGIAATEEEELAQQEGLVTSEPSDSSDDDYQPIPHMPP*
Ga0182173_10079592	3300015288	Miscanthus Phyllosphere	VLETIAQQDDIIRDIAATEEEELAQQEGLVTSEPNDSSDDDY*
Ga0182173_10358272	3300015288	Miscanthus Phyllosphere	VPKTTTQQDDTIRGIAATEEEQLDAQQEGMVESDPSDNSDEDYRDIP*
Ga0182173_10530401	3300015288	Miscanthus Phyllosphere	VPETVAQQDDTIRGIAAIEEEQLDAQQEGMAESNPSDSSD
Ga0182173_10672191	3300015288	Miscanthus Phyllosphere	VPEIVAQQDKIIRGVAATEEEQLDAQQEGMVESDPSDRSDDDYQAIPHMPP
Ga0182138_10115331	3300015289	Miscanthus Phyllosphere	VPETAAQQDDIIRGIVAIEEEQLAQQEGLVTSEPSDSSDDDY*
Ga0182138_10653161	3300015289	Miscanthus Phyllosphere	VPETVAQQDATIRGIAAIEEEQLDAQQEGMVESNPSDSSGEDYHEIPQMPPR*
Ga0182138_10796021	3300015289	Miscanthus Phyllosphere	VPESIAQQDEIIRGIAAIEEEQLDAQQEGMVESDPSDSSDDDYQAIP*
Ga0182138_10809321	3300015289	Miscanthus Phyllosphere	VPESAAQQDETIKGIAATEEEELDAQQEGMVESGPSDSSDDDY*
Ga0182125_10186012	3300015291	Miscanthus Phyllosphere	VPETTAQQDETIRGIAAIEEEPLDAQQEGMVKSDPSDSSDDDYHAIP*
Ga0182125_10742591	3300015291	Miscanthus Phyllosphere	DAIIRGIAATKEEQLAQQEGMVESDPSDSSNEDYRGIPYMPVC*
Ga0182125_10939401	3300015291	Miscanthus Phyllosphere	VPESVAQQDEIIRGIAATKEEELAQQEGMVMSDPSDSSNDDYQAIPQMPP*
Ga0182141_10201132	3300015292	Miscanthus Phyllosphere	VSETTAQQDETIRGIAATEEEELDAQQEGMVESDPSDSSNDDYRDIPQVPAR*
Ga0182141_10590561	3300015292	Miscanthus Phyllosphere	HRGCYTQQDETIRGIAATEEEQIDAQQEGMVESDPSDSSDDDYRDIPQMPPQ*
Ga0182175_10704071	3300015295	Miscanthus Phyllosphere	LDDTIRGIAAIEEERLDAQQEGMVESDPSDSSDEDYRDIPQMSAL*
Ga0182157_10349963	3300015296	Miscanthus Phyllosphere	DKIIRGIVATEEEQLEAQQGMIESSDSSDDDYLSIP*
Ga0182157_10459011	3300015296	Miscanthus Phyllosphere	VQETAAQQDEIIRGVAAIEEEQLDAQQEGMIESDPSDSLDDDYQDISQMPPR*
Ga0182157_10666501	3300015296	Miscanthus Phyllosphere	VPESVAQQDEIIRGIAATEEEELAQQEGMVVSDPSDSSDDDYQPIPQM
Ga0182157_10722881	3300015296	Miscanthus Phyllosphere	VPETIGQQDDTIRGIAAIEEEQLDAQQDGMVESDPIDSSDEDYRDIP*
Ga0182157_10839871	3300015296	Miscanthus Phyllosphere	VPETAAQQDETIRGITAIEEEQLDAQQEGMVESDPSDSSDDDYQPIP*
Ga0182107_10699771	3300015299	Miscanthus Phyllosphere	VPETAAQQDDITKGIAATEEEQLAQQEGMVESDPSDSSDNDYRAIPQMPP*
Ga0182107_10985391	3300015299	Miscanthus Phyllosphere	VPETVAQQDDTIRGIAAIEEEQLDAQQEGMVESDPSDSSN
Ga0182107_11006461	3300015299	Miscanthus Phyllosphere	MPESVAQQDEIIRGIAATEEEELAQQEGVVMSDPSDSSDDDYQPIP*
Ga0182108_10166632	3300015300	Miscanthus Phyllosphere	VLETVAQQDETIRGIAATEEEELDAQQEGMVESDPSDISDDDYQAIPQMPPR*
Ga0182108_10480391	3300015300	Miscanthus Phyllosphere	VPETIAQQDEVIRGIAAIEEEQLDAQQEGMVESDPSDS
Ga0182108_10932751	3300015300	Miscanthus Phyllosphere	VPKTVAQHDDTIRGIAAIEEEELDAQQEGMVESDPSDSSDEDYHDIP*
Ga0182108_10935232	3300015300	Miscanthus Phyllosphere	VPETVAQQDATIRDIAATEEEQLDAQQEGMVESNSSDSSDDDY*
Ga0182108_11020741	3300015300	Miscanthus Phyllosphere	VLEATAQQDDIIRGIAAIEEEHLAQQEGLVTSEPNDSSDDDYQPIPQMPP*
Ga0182123_10482181	3300015303	Miscanthus Phyllosphere	VPETTAQQDETIRGIVAIEEEQLDAQQEGMVESDPSDSSDDDYQ
Ga0182123_10532941	3300015303	Miscanthus Phyllosphere	MLETTAQHDDTIRGIAAIEEEQLDAQHEGMVESDPSDSSDED
Ga0182112_10528721	3300015304	Miscanthus Phyllosphere	VLETTAQQDETIKGIAATEEEQLDAQQEGMVESDPSDSSDNDYQDISRMPPR*
Ga0182112_10946781	3300015304	Miscanthus Phyllosphere	VLESVAQQDDIIRGIIAIEEEQLAQQEGLVVSDPSDSSDDDYQSIPQMPP*
Ga0182112_10985332	3300015304	Miscanthus Phyllosphere	VPESVAQQDETIRGIAVIDEEQLDAQQEDMVESNPSDSTDDDYQEIPWMPPQ*
Ga0182158_10308242	3300015305	Miscanthus Phyllosphere	VPETVAQQDETIRGIAAIEEEELDAQQEGMFASDPSDSSDDDYQDIPQMHA*
Ga0182158_10353651	3300015305	Miscanthus Phyllosphere	VPETTAQQDATIRDIAATEEEQLDAPQEGMVESDPSDNSDEDYNDIP*
Ga0182158_10455031	3300015305	Miscanthus Phyllosphere	VPETVAQQDDTIRGIAAIEEEQLDAQQKGMVKSDPSDNSDEDYRDIP*
Ga0182158_10796322	3300015305	Miscanthus Phyllosphere	VLESAAQQDDTIRGIAAIEEEQLDAQQEGMVDSDPSDSSDEDYRDIPQMPP*
Ga0182142_10243531	3300015308	Miscanthus Phyllosphere	VPETTTQQDEIIRGVAMIEGEELDAQQEGMVESDPSDSSDDEYQAIP*
Ga0182142_10467801	3300015308	Miscanthus Phyllosphere	PDVPESTTQQDDIIRGIAATEEEELAQQEGMVVSDPSDSSDDDYQAIP*
Ga0182142_10781031	3300015308	Miscanthus Phyllosphere	VPETIAQQDNIIRGITTIEEEQLAQQEGMVESNPSDSSDEDNRDIP*
Ga0182142_10900722	3300015308	Miscanthus Phyllosphere	VPESAAQHDEIIRGIAVIEEEELDAQQEGMVENGPSDSSDDDYQAIP*
Ga0182142_10907711	3300015308	Miscanthus Phyllosphere	VPETTAQQDETIRGIAAIEEEQLDAQQEGMVESNPSDNSDDDYQDIPQM
Ga0182140_10280992	3300015314	Miscanthus Phyllosphere	HRPEVPETTAQQDEIIRGVSAIEEEQLDAQQEGMVKSDPSDSSDDDY*
Ga0182140_10426332	3300015314	Miscanthus Phyllosphere	VPETVAQQDDIIRGIVAIEEEQLAQQEGLVTSEPSDSSDDDYQPIP*
Ga0182140_10976152	3300015314	Miscanthus Phyllosphere	VPETTAQLDDIIRGIAPIEEEEELDAQQEGMVESDPSDSTYDDC*
Ga0182127_10247862	3300015321	Miscanthus Phyllosphere	VPETVAQQDDIIRGIAATEEEELAQQEGLVTSEPSDSSDDDYQPIPQMPPR*
Ga0182127_10397891	3300015321	Miscanthus Phyllosphere	VPETASQQDETIRGIAATEEEQLDAQQEGMVESDPSDSSDEDYQDIPQMPPY*
Ga0182110_10121313	3300015322	Miscanthus Phyllosphere	VPKTTAQQDETIRGIAAIEEQQLDAQQEGMVESDPSDSSDDGYHDIP*
Ga0182187_10320571	3300015341	Miscanthus Phyllosphere	VPETVAQQDEIIRGVAAIEEEELDAQHEGMVESDPSDSLDDDYQDIPQMPRRRHDSEAS
Ga0182187_10461502	3300015341	Miscanthus Phyllosphere	VLETVAQQDETIRGIAATEEEQLDAQQEGMVQSDLSDSSVDDY*
Ga0182187_11564731	3300015341	Miscanthus Phyllosphere	VPESAAQQDEIIRGIAATEEEELEAQQEVSEYSDSSDDD
Ga0182187_11598511	3300015341	Miscanthus Phyllosphere	VPETAAQQDETIRGIAATKEEQLDARWEGMVDSDPSDSSDDDYRDIP*
Ga0182109_10740861	3300015342	Miscanthus Phyllosphere	VPESAAQQDDIIRGIAATEEEELAQQEGMVESDPSDSSDEDY*
Ga0182109_11323421	3300015342	Miscanthus Phyllosphere	ETIAQQNETIRGIVATEEEQLDAQQEGMVESNPSDSSDDDY*
Ga0182109_11598641	3300015342	Miscanthus Phyllosphere	VPETVAQQDKIIRGVAATEEEELDAQPEGMVESDPSDSSDDDY*
Ga0182109_12112111	3300015342	Miscanthus Phyllosphere	VLETAAQQDETIRGIAATEEEQLDAQQEGMVESDPSDSTDDDYQDIPQMPPRQHDHE
Ga0182155_11107091	3300015343	Miscanthus Phyllosphere	VLETAAQQDEIIRGVAATEEEQLDAQQEGMVESDPSDSSDDDYQAIPQMPPRQHDSEA
Ga0182155_11290771	3300015343	Miscanthus Phyllosphere	MLESAAQQDEIIRGVAATEEHLDAQQEGVVESDPSDSS
Ga0182155_11737112	3300015343	Miscanthus Phyllosphere	VPETAAQQDEIIRGIATIEEEQLDAQQEGMVESYPSDSSDDDYQAIPQMPPR*
Ga0182155_11853012	3300015343	Miscanthus Phyllosphere	VPKTIAQQDETIRGIAAIEEEQLDAQQEGMVESKPSDSSDDDY*
Ga0182155_12252271	3300015343	Miscanthus Phyllosphere	VLETVAQQDDIIRDIAAIEEEELTEQEGLVTSEPCDSSDDDYQPIP*
Ga0182189_10754621	3300015344	Miscanthus Phyllosphere	HRRPEVLESTAQQDEIIRGVAAIEVEQLDAQQEGMVKSDPSDSSDDDY*
Ga0182189_12006931	3300015344	Miscanthus Phyllosphere	QQDETIRVIVAIEEEELDAQQEGMVESDPSDSSDDDYQAIPHIPPR*
Ga0182189_12268021	3300015344	Miscanthus Phyllosphere	VPETTAQQDETIRGISAIEEEQLDAQQEGMFESEPSDSSDEDYQDIPQMPPY*
Ga0182111_12036661	3300015345	Miscanthus Phyllosphere	VPETVAQQDETIKGIAAIEEEQLDAQQEGMVESDPSDSSNNDYQGIPQMPPR*
Ga0182139_11246462	3300015346	Miscanthus Phyllosphere	VPESIAQQDEIIRGITAIEEEQLDAQQEGMVESNPSDSSDDDYQAIP*
Ga0182139_11309592	3300015346	Miscanthus Phyllosphere	VPKTVAQQDDTIRGIAAIEEEEIDAQQEGMVESDPSDISDDDY*
Ga0182139_11978961	3300015346	Miscanthus Phyllosphere	VLEIAAQQDEIIRGVAATEEEELDAQQEGMVESDLSDSSD
Ga0182177_10676291	3300015347	Miscanthus Phyllosphere	VPEIAAQQDEIIRGIATTEEEELDVQQADVIESDSSDSSDDDYQPIPQMA
Ga0182177_11137181	3300015347	Miscanthus Phyllosphere	QDEIIRGIAATEEEQLDAQQEGVVESDPSDSSDDDY*
Ga0182177_11222421	3300015347	Miscanthus Phyllosphere	VPETVAQQDDIIRGIVAIEEEQLAQQEGLVTSEPNDSSDDDYQPIP*
Ga0182177_11451731	3300015347	Miscanthus Phyllosphere	AAQQDEIIRGIAAIEEEELEAQQGMTESSDSSDDDYLLIP*
Ga0182177_11809211	3300015347	Miscanthus Phyllosphere	VLESATQQDDIIRGIAATEEEELAQQEGMVESDPSDSSDEDYRD
Ga0182177_11957911	3300015347	Miscanthus Phyllosphere	TIRGIVATKEEQLDAQQEGMVESDPSDSSDDDYQDIPQMSPQ*
Ga0182161_10503031	3300015351	Miscanthus Phyllosphere	VPESVAQQDEIIRGVVAIEEEQLDAQQEGMVDSNPSDCSNDDYQDIP*
Ga0182161_10956712	3300015351	Miscanthus Phyllosphere	VPESAAQQDDIIRGIVAIEEEQLAQQEGVVTSEPSDSSDDDYQPVP*
Ga0182161_10964491	3300015351	Miscanthus Phyllosphere	IRGVAATEEEQLDAQREGMVESDPSDSSDDDYQAIPQLPP*
Ga0182161_11553831	3300015351	Miscanthus Phyllosphere	VPETAAQQDETIRGIAATEEEQLDAQQEGMVESDPSDSSDDDY*
Ga0182161_11579873	3300015351	Miscanthus Phyllosphere	CLEVPESAAQQDETIRGISATEEEQLDAQQEGMVESDPSDSSDDDYQAIP*
Ga0182161_11689901	3300015351	Miscanthus Phyllosphere	VPETIAQHDETIRSIAAIVEEQLDAQQEGMIESDPSDNSDEDYHEIP*
Ga0182161_12624871	3300015351	Miscanthus Phyllosphere	VPETASQQDETIRSIAAIEEEQLDAQQEGIITSDPIDSSDDNYQPIP*
Ga0182159_11092071	3300015355	Miscanthus Phyllosphere	VTETAAQQDETIRGIVATEEEQLDAQQEGMVESDPSDS
Ga0182159_12753231	3300015355	Miscanthus Phyllosphere	EEIIKGIAAIEEQQLDAQQEGMVESDPSDSSDDDYQAIPHIPPR*
Ga0182159_13490782	3300015355	Miscanthus Phyllosphere	VPETTSQQDKTIRGIAATEEEQLDAQQEGMVESDPSDSSDDDYRDIPQMPP
Ga0182159_13495141	3300015355	Miscanthus Phyllosphere	VPESVAQQDDIIRGIAATEKEELAQQEGMVTSEPSDSSDDDYQLIPQMPP*
Ga0182145_10585442	3300015361	Miscanthus Phyllosphere	DIIRGITTIEEEELAQQEGLVASEPSDSSDYDYQPIPQMPP*
Ga0182145_11600832	3300015361	Miscanthus Phyllosphere	VLETAAQQDETIRGIAAIEEEELDSQQEGMVESDPSDSTDDDYQDIPQMPPR*
Ga0182203_10926181	3300017404	Miscanthus Phyllosphere	CLDIPESVAQQDEIIRGIAATEEEQLEAQQGMTESSDSSDDDYLLIP
Ga0182203_10988812	3300017404	Miscanthus Phyllosphere	VLEFAAQQDDIIRGIAAIEEEEHAQQEGMVESDPSDSSDDDYQAIPHMPPR
Ga0182203_11155831	3300017404	Miscanthus Phyllosphere	VPETTAQQDEIIRGVAAIEEEELDAQQEGMVESDPSDSSDDDYQDIPQMPK
Ga0182203_11351571	3300017404	Miscanthus Phyllosphere	VPESVAQQDDIIRGIAATEKEELAQQEGMVMSDPSDSSDDDY
Ga0182203_11404721	3300017404	Miscanthus Phyllosphere	VPESVAQQDEIIRGIAATEEEQLEAQQEASDPSNSSDEDY
Ga0182203_11414481	3300017404	Miscanthus Phyllosphere	RRPEILETAAQHDEIIRGIVAIEEEQLDAQQEGVVESDPSDSSDNDY
Ga0182220_10400772	3300017407	Miscanthus Phyllosphere	VPESTAQQDEIIRGITATEEEELEAQQEVSEYSDSSDDD
Ga0182204_10249852	3300017409	Miscanthus Phyllosphere	VPETVAQQDETIRGIAATEEEQLDAQQAGMVESDPSDSSDDDYWDIPQMPPR
Ga0182204_10680141	3300017409	Miscanthus Phyllosphere	EVLESIAHQDEIIRGIAVTEEQQLDAQQEGMVESDPSDSSNYDYQAIPKMPP
Ga0182204_11056561	3300017409	Miscanthus Phyllosphere	ESAAQQDEIIRGIAATEEEELEAQQEVSEYSDSSDDDYQPIP
Ga0182207_10542932	3300017410	Miscanthus Phyllosphere	VPESVAQQDDIIRGIAATEEEELAQQEGMVVSDPSDSSDDDYQPIPRMPPQ
Ga0182207_10987752	3300017410	Miscanthus Phyllosphere	VPETAAQQDETIRGIAAIEKEQLDAQQEGMVESDPSDSSDEDYRDIPQMPP
Ga0182207_11375411	3300017410	Miscanthus Phyllosphere	QQDDTFRGIAATEEEQLDAQWEGMVKSDPSDSLDDDYQDIPQMPP
Ga0182208_10805541	3300017411	Miscanthus Phyllosphere	AAQQDEIIRGIVAIEEELLDAQHADVIESDLSDSYDDDYQPIP
Ga0182208_11164272	3300017411	Miscanthus Phyllosphere	VPETTAQQDETIRGIAATEEEQLDAQQEGMVESDPSDSSDDDYQDIP
Ga0182222_10666782	3300017413	Miscanthus Phyllosphere	VPESVAQQDETIRGIAVIDEEQLDAQQEDMVESNPSDSTDDDY
Ga0182222_10691731	3300017413	Miscanthus Phyllosphere	LRRRPEVPETAAQQDETIRGITAIEEEQLDAQQEGMVESDPSDSTDDDYQDIPQMPP
Ga0182202_10612892	3300017415	Miscanthus Phyllosphere	VPESIAQQDDIIRGITAIEEEELAQQEGMVVSDPSDSSDDDYQS
Ga0182230_10563002	3300017417	Miscanthus Phyllosphere	VLESVAQQDETIRGIAAIEEEQLDAQQEGMVESDPSDSSDDEYQDIPRMPP
Ga0182228_10828801	3300017420	Miscanthus Phyllosphere	VPETVAQQDDTIRGIAAIEEEELDAQLEGMVDSDPSDSSDDDYQDIPQMPPQ
Ga0182228_11072171	3300017420	Miscanthus Phyllosphere	VLESVAQQDETIRGIAAIEEEQQDAQQEGMVESDPSDSSDDDY
Ga0182219_10607051	3300017424	Miscanthus Phyllosphere	VPESAAQQDDIIRGIVATEEEELAQQEGMVMSDPSDSSDDDYQAIP
Ga0182219_10855292	3300017424	Miscanthus Phyllosphere	VPETVAQQDAFIRGIAATKEEQLAQQEGMVESDPSDSSDEDYRDIP
Ga0182224_10262932	3300017425	Miscanthus Phyllosphere	VPESIAQQDDIIRGIAATEEEELAQQEGMVVSDPSDSSDDDY
Ga0182190_10805702	3300017427	Miscanthus Phyllosphere	VPETVAQQDETIRGITATEEEQLDAQQEGMVESDPSDSSDDDY
Ga0182190_11433721	3300017427	Miscanthus Phyllosphere	TVAQQDDIIRGIAAIEEEQLAQQEGLVTSEPSDSSDDDYQPIP
Ga0182192_10497382	3300017430	Miscanthus Phyllosphere	VPETAAQQDDIIRGIVAIEEEQLAQQEGLVTSEPSASSD
Ga0182206_10652332	3300017433	Miscanthus Phyllosphere	MPETVAQQDDIIRGIAAIEEEQLAQHEGMVESDPSDSSNEDYRDIP
Ga0182191_11319891	3300017438	Miscanthus Phyllosphere	VLETIAQQDDIIRSITAIEEEQLAQQEGLVTSEPSDSSDDDYQPIPQMPPR
Ga0182221_11267341	3300017442	Miscanthus Phyllosphere	VPESVAQQDDIIRGIAATEEEQLAQQEGMVMSDLSDSSDDDYQPIPQMSP
Ga0182193_11471591	3300017443	Miscanthus Phyllosphere	VPETIAQQDDIIRGIAATEEELAQQEGMVVSDPSDSSDDDYQPIP
Ga0182193_11939632	3300017443	Miscanthus Phyllosphere	VPEFAAQQDEIIRGIAATEEEELEAQQEVSEYSDSSDDDY
Ga0182218_10718961	3300017683	Miscanthus Phyllosphere	VPETAAQQDDTIRGIAATEKEQLDAQQEGMVESDPSDSSDDDYRDIPQMPPR
Ga0182225_10657232	3300017684	Miscanthus Phyllosphere	VVPETAVQQNETIRGIAAIEEEQLDAQQEGMVESNPSDSTDEDYQDIPQMPPR
Ga0182225_11163011	3300017684	Miscanthus Phyllosphere	AQLDEITRGVAAIEEERLDAQPEGMVESDPSDSSDDDY
Ga0182225_11243221	3300017684	Miscanthus Phyllosphere	VPETVAQQDEIIRGVAGIEEEQLDAQQEGMVESDPIDSTDDDYQDIPWMPPR
Ga0182227_10570411	3300017685	Miscanthus Phyllosphere	VPETTAQQDETIRDIAAIEEEELDAQQEGMVESDPSDSSDDDY
Ga0182227_10819141	3300017685	Miscanthus Phyllosphere	VPESAAQQDEIIRGIAAIEEEQLDAQQEGMVESNPSDSSDDDYQAIPHMSP
Ga0182205_10692451	3300017686	Miscanthus Phyllosphere	VPETIAQQDDIIRGIVATEKEELAQQEGLVTSEPSDSSDDDY
Ga0182205_11120761	3300017686	Miscanthus Phyllosphere	VPESAAQQNDIIRGIAATEEEELAQQEGMVVSDPSDSSDDDYQPIP
Ga0182205_11388432	3300017686	Miscanthus Phyllosphere	VLETVTPQDEIIRGVAATEEEQLDAQQEGMVESDPSDSLDDDYQDIP
Ga0182223_10131592	3300017690	Miscanthus Phyllosphere	VPKTIAQQDNIIRGIVAIEEEELAQQEGLVTREPSDSSDDDY
Ga0182223_10261512	3300017690	Miscanthus Phyllosphere	DETIRGITATEEEQLHARQEGMVESDPSDSSDDDYQAISQMPPR
Ga0182223_10920972	3300017690	Miscanthus Phyllosphere	VPETAAQQDETIRDIAATEEEQLDAQQEGLVESDPNDSSDDDY
Ga0207689_113490343	3300025942	Miscanthus Rhizosphere	VPETAAQQDEIIRGVAATEEEELDAQQEGMVESDPSYSLDDDY
Ga0207675_1021198742	3300026118	Switchgrass Rhizosphere	VPETVAQQDEIIRGVAATEEEQLDAQQEGMVESDPNDSSDDDY

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.41
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.41
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F035575

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign