NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F035572

Metagenome Family F035572

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F035572
Family Type Metagenome
Number of Sequences 171
Average Sequence Length 92 residues
Representative Sequence MWNRYLVRRRSRRSRPEYRFERAITFDPTVGSPSKFYRSFRKLFSVEYMWNRYSVRRRSRRSRLEYRFERAITFDPTVGSPLNFYRSCRKPFSL
Number of Associated Samples 19
Number of Associated Scaffolds 144

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 57.04 %
% of genes near scaffold ends (potentially truncated) 28.65 %
% of genes from short scaffolds (< 2000 bps) 48.54 %
Associated GOLD sequencing projects 19
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (81.871 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Wood → Unclassified → Unclassified → Xylem
(78.947 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(99.415 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.44%    β-sheet: 0.00%    Coil/Unstructured: 56.56%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.87 %
UnclassifiedrootN/A18.13 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300028794|Ga0307515_10653651All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa664Open in IMG/M
3300031456|Ga0307513_10012092All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa10677Open in IMG/M
3300031507|Ga0307509_10161101All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2141Open in IMG/M
3300031507|Ga0307509_10179380All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1985Open in IMG/M
3300031649|Ga0307514_10146289All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1596Open in IMG/M
3300031730|Ga0307516_10215136All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1634Open in IMG/M
3300032354|Ga0325403_1011171All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa8516Open in IMG/M
3300032354|Ga0325403_1011766All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa8296Open in IMG/M
3300032354|Ga0325403_1026253All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5042Open in IMG/M
3300032354|Ga0325403_1031289All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4432Open in IMG/M
3300032354|Ga0325403_1034495All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4098Open in IMG/M
3300032354|Ga0325403_1034495All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4098Open in IMG/M
3300032354|Ga0325403_1034495All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4098Open in IMG/M
3300032354|Ga0325403_1035920All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3961Open in IMG/M
3300032354|Ga0325403_1035920All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3961Open in IMG/M
3300032354|Ga0325403_1050243All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2914Open in IMG/M
3300032354|Ga0325403_1053219All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2741Open in IMG/M
3300032354|Ga0325403_1059672All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2417Open in IMG/M
3300032354|Ga0325403_1061006All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2358Open in IMG/M
3300032354|Ga0325403_1061006All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2358Open in IMG/M
3300032354|Ga0325403_1061006All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2358Open in IMG/M
3300032354|Ga0325403_1072064All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1917Open in IMG/M
3300032354|Ga0325403_1072983All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1886Open in IMG/M
3300032354|Ga0325403_1076959All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1757Open in IMG/M
3300032354|Ga0325403_1085531All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1510Open in IMG/M
3300032354|Ga0325403_1089307All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1416Open in IMG/M
3300032354|Ga0325403_1094203All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1304Open in IMG/M
3300032354|Ga0325403_1094356All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1300Open in IMG/M
3300032354|Ga0325403_1094356All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1300Open in IMG/M
3300032354|Ga0325403_1098241All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1219Open in IMG/M
3300032354|Ga0325403_1099914All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1187Open in IMG/M
3300032354|Ga0325403_1101231All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1162Open in IMG/M
3300032354|Ga0325403_1115958All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa938Open in IMG/M
3300032354|Ga0325403_1121195All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa879Open in IMG/M
3300032354|Ga0325403_1125833All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa832Open in IMG/M
3300032354|Ga0325403_1127058All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa821Open in IMG/M
3300032354|Ga0325403_1128217All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa810Open in IMG/M
3300032354|Ga0325403_1134567All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa760Open in IMG/M
3300032354|Ga0325403_1139355All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa714Open in IMG/M
3300032354|Ga0325403_1155064All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa595Open in IMG/M
3300032354|Ga0325403_1157392All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa581Open in IMG/M
3300032354|Ga0325403_1158613All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa574Open in IMG/M
3300032354|Ga0325403_1169132All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa519Open in IMG/M
3300032355|Ga0325401_1001782All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa18564Open in IMG/M
3300032355|Ga0325401_1002414All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa16598Open in IMG/M
3300032355|Ga0325401_1015804All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa7181Open in IMG/M
3300032355|Ga0325401_1015804All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa7181Open in IMG/M
3300032355|Ga0325401_1069492Not Available2353Open in IMG/M
3300032355|Ga0325401_1078289All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2080Open in IMG/M
3300032355|Ga0325401_1084512All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1914Open in IMG/M
3300032355|Ga0325401_1102919All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1514Open in IMG/M
3300032355|Ga0325401_1119843All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1248Open in IMG/M
3300032355|Ga0325401_1119843All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1248Open in IMG/M
3300032355|Ga0325401_1129845All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1125Open in IMG/M
3300032355|Ga0325401_1166079All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa830Open in IMG/M
3300032355|Ga0325401_1171714All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa798Open in IMG/M
3300032355|Ga0325401_1177754All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa768Open in IMG/M
3300032355|Ga0325401_1187849All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa715Open in IMG/M
3300032355|Ga0325401_1192543All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa693Open in IMG/M
3300032355|Ga0325401_1194810All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa683Open in IMG/M
3300032355|Ga0325401_1197346All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa672Open in IMG/M
3300032355|Ga0325401_1206419All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa635Open in IMG/M
3300032355|Ga0325401_1226742All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa567Open in IMG/M
3300032355|Ga0325401_1244846All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa519Open in IMG/M
3300032355|Ga0325401_1244846All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa519Open in IMG/M
3300032374|Ga0325400_1089270All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2105Open in IMG/M
3300032374|Ga0325400_1139198All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1337Open in IMG/M
3300032374|Ga0325400_1174221All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1043Open in IMG/M
3300032374|Ga0325400_1192238All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa936Open in IMG/M
3300032374|Ga0325400_1204414All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa875Open in IMG/M
3300032374|Ga0325400_1208799All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa855Open in IMG/M
3300032374|Ga0325400_1212311All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa840Open in IMG/M
3300032374|Ga0325400_1230575Not Available771Open in IMG/M
3300032374|Ga0325400_1272101All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa639Open in IMG/M
3300032389|Ga0325405_1017908All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa6361Open in IMG/M
3300032389|Ga0325405_1017908All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa6361Open in IMG/M
3300032389|Ga0325405_1017908All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa6361Open in IMG/M
3300032389|Ga0325405_1017908All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa6361Open in IMG/M
3300032389|Ga0325405_1017908All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa6361Open in IMG/M
3300032389|Ga0325405_1017908All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa6361Open in IMG/M
3300032389|Ga0325405_1024788All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4979Open in IMG/M
3300032389|Ga0325405_1029295All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4322Open in IMG/M
3300032389|Ga0325405_1029295All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4322Open in IMG/M
3300032389|Ga0325405_1031951All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4012Open in IMG/M
3300032389|Ga0325405_1044524All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2882Open in IMG/M
3300032389|Ga0325405_1064232All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1807Open in IMG/M
3300032389|Ga0325405_1078112All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1308Open in IMG/M
3300032389|Ga0325405_1081527All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1213Open in IMG/M
3300032389|Ga0325405_1112328All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa695Open in IMG/M
3300032389|Ga0325405_1119414All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa615Open in IMG/M
3300032389|Ga0325405_1129537All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa526Open in IMG/M
3300032390|Ga0325404_1007179All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa11633Open in IMG/M
3300032390|Ga0325404_1007179All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa11633Open in IMG/M
3300032390|Ga0325404_1007179All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa11633Open in IMG/M
3300032390|Ga0325404_1033565All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3845Open in IMG/M
3300032390|Ga0325404_1046493All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2693Open in IMG/M
3300032390|Ga0325404_1046493All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2693Open in IMG/M
3300032390|Ga0325404_1049049All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2520Open in IMG/M
3300032390|Ga0325404_1053838All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2238Open in IMG/M
3300032390|Ga0325404_1065116All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1685Open in IMG/M
3300032390|Ga0325404_1070327All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1476Open in IMG/M
3300032390|Ga0325404_1124664All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa505Open in IMG/M
3300032735|Ga0325410_1040297All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3245Open in IMG/M
3300032735|Ga0325410_1089617All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa911Open in IMG/M
3300032735|Ga0325410_1115904All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa599Open in IMG/M
3300032735|Ga0325410_1117638All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa585Open in IMG/M
3300032740|Ga0325411_1045277All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2749Open in IMG/M
3300032740|Ga0325411_1094109All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa790Open in IMG/M
3300032741|Ga0325414_1013805All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa8184Open in IMG/M
3300032741|Ga0325414_1042478All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3337Open in IMG/M
3300032741|Ga0325414_1069650All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1757Open in IMG/M
3300032741|Ga0325414_1084321All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1279Open in IMG/M
3300032741|Ga0325414_1084321All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1279Open in IMG/M
3300032741|Ga0325414_1136177All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa572Open in IMG/M
3300032741|Ga0325414_1138995All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa553Open in IMG/M
3300032741|Ga0325414_1145213All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa513Open in IMG/M
3300033160|Ga0325402_1001394All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa19645Open in IMG/M
3300033160|Ga0325402_1001394All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa19645Open in IMG/M
3300033160|Ga0325402_1001394All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa19645Open in IMG/M
3300033160|Ga0325402_1027361All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4856Open in IMG/M
3300033160|Ga0325402_1047994All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3015Open in IMG/M
3300033160|Ga0325402_1053243All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2708Open in IMG/M
3300033160|Ga0325402_1058576All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2435Open in IMG/M
3300033160|Ga0325402_1072292All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1876Open in IMG/M
3300033160|Ga0325402_1135407All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa701Open in IMG/M
3300033160|Ga0325402_1145990All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa609Open in IMG/M
3300033160|Ga0325402_1148938All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa587Open in IMG/M
3300033160|Ga0325402_1150775All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa574Open in IMG/M
3300033160|Ga0325402_1158821All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa524Open in IMG/M
3300034389|Ga0325419_018024All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa6641Open in IMG/M
3300034389|Ga0325419_018024All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa6641Open in IMG/M
3300034389|Ga0325419_055452All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2113Open in IMG/M
3300034389|Ga0325419_075167All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1303Open in IMG/M
3300034688|Ga0325420_091651All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1212Open in IMG/M
3300034688|Ga0325420_092834All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1189Open in IMG/M
3300034688|Ga0325420_109771All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa930Open in IMG/M
3300034688|Ga0325420_147044All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa589Open in IMG/M
3300034689|Ga0325421_009733All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa9007Open in IMG/M
3300034689|Ga0325421_035093All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3497Open in IMG/M
3300034689|Ga0325421_061940All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1876Open in IMG/M
3300034689|Ga0325421_061940All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1876Open in IMG/M
3300034901|Ga0325409_099179All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus824Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
XylemHost-Associated → Plants → Wood → Unclassified → Unclassified → Xylem78.95%
LeafHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf17.54%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza3.51%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300028794Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EMHost-AssociatedOpen in IMG/M
3300031456Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EMHost-AssociatedOpen in IMG/M
3300031507Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EMHost-AssociatedOpen in IMG/M
3300031649Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EMHost-AssociatedOpen in IMG/M
3300031730Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EMHost-AssociatedOpen in IMG/M
3300032354Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4Host-AssociatedOpen in IMG/M
3300032355Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2Host-AssociatedOpen in IMG/M
3300032374Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1Host-AssociatedOpen in IMG/M
3300032389Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2Host-AssociatedOpen in IMG/M
3300032390Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1Host-AssociatedOpen in IMG/M
3300032735Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R3Host-AssociatedOpen in IMG/M
3300032740Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R4Host-AssociatedOpen in IMG/M
3300032741Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdKOR-R3Host-AssociatedOpen in IMG/M
3300033160Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R3Host-AssociatedOpen in IMG/M
3300034389Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4Host-AssociatedOpen in IMG/M
3300034688Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R1Host-AssociatedOpen in IMG/M
3300034689Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R2Host-AssociatedOpen in IMG/M
3300034778Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R4Host-AssociatedOpen in IMG/M
3300034901Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0307515_1065365113300028794EctomycorrhizaFEMAITFDPTVGSPSKFYRSFRTLFSLELMLNCNSVRRRSRRSRPLYRFEKAITFDPTVGSPSNIYRSFRTVFYLE
Ga0307513_1001209233300031456EctomycorrhizaMRKRYLVRQRARHVGLEYRFKRAITFDPTVESAINFYRSFRMLFFVEYMWNRYSVRRRSRRARPEYRFVRAITFYPTVGSPSNFRRVYGRCFPWI
Ga0307509_1016110113300031507EctomycorrhizaVELLFGEARARRAGLEYRFERAITFDPNVGTTTNIYTSFWTMFSLELMWNRYSVKRRARRAGRGYRFERAITFDPTVGSPPNFNRSFRTMFSLQ
Ga0307509_1017938013300031507EctomycorrhizaMEWMWNRHLVRLRPGRARLEYRFERAITFNQTVQSRTKFYRSFLRPFSMEWMWNRNSVRRRSGRSRLE
Ga0307514_1014628933300031649EctomycorrhizaMWNRYSVRRRSRGAGLEYWFEKAITFDLTVESPLKNLKSFRTLFSLEYMWNRYSVRRRSRRSRLEYRFERAIIFDPTVG
Ga0307516_1021513633300031730EctomycorrhizaMNRHSVRRRCRRSRLDYRFERAITFDPTVGSLSNFYRSFRTLFSLEYKLNRHSVRRRSSRSRLVYLFERAITFDPTVGCPSNVYRSFRTLFSLE
Ga0325403_101117123300032354XylemMWNSYSVYRRYRRSIIKYRFKRAITFEPTVGSPLNFYRSFQKLFFLEYMWNRYSMRRRSRYSRPEYGFERAITVDPTVGSPSNIYRSFRKPFLLK
Ga0325403_101176623300032354XylemMWNRYSMRRRARRSRPEYRFERAITFDSTVRSPSNSYWSFRKPLSLEYMWNRYSMRRRSRRSRQEYQFERAITFDPTIGSPSNF
Ga0325403_101699743300032354XylemLELMWNPYLVRRRSLRSRPAYRFERAVTFDPTFGSPSNFYRSFQRPFPLEEMWNPYSVRGRSLRSRPVYRFERDLTFDSTVVSPSNFYRSF
Ga0325403_102625313300032354XylemMWNRYSMRRRPRRSRQEYRFERAISFDPTVVSPTNFYWSFQKPFLLEYMWNRYSMRQRSRRSRPEYRFERAITFDPTVGSPSMFYRSFGKLFFLE
Ga0325403_102933343300032354XylemMFNRYSVRLRSRRSGPGSQFERAITFDPTVGSHSNFYRSFRKLFFRRRSRCSRLEFQFEREITFDPTVGSPSNFYRSFRKLFFLE
Ga0325403_102933353300032354XylemMLNRYLVRLRSRCSGPGYRFERAITFDPTVGSPSNFYRSFRKLFFRRRSCCSRPEFRFEREITFDPTVGSPSNFYRSFRKLFFLE
Ga0325403_103128953300032354XylemMWNRYSVRRRSRRFKLEYRFERAITFDPTVGSPSNFYRSFRKLFFLKYMWNRYSVRRRSLRSRPDYRFKMSITFDPTVGSPSNFYSSFRKQFSL
Ga0325403_103449513300032354XylemMWNRHSVRRMSRRSRPDYRFERAITFDPTVGSPSNFYRSFGKLFSLEYMWNRYSVRRRARRFRLEYRFERAITVDPTVGSPSNVYRIFRKMFSLD
Ga0325403_103449543300032354XylemMWNRYSVRRRSPRSRPQYRFERAITFDPTVGSPSNFYRSFGKLFSLEYMWNRYSVRRRARRFRLEYRFERAITVDPTVGSPSNVYRIFRKMFSLD
Ga0325403_103449553300032354XylemMWNRYSVRWRSCRFKLEYRFERAITVDATVGSPSNIYRSFRKLFFLEYMWNCYSVSWRYRRSRPEYRFERAITFDPTVGSPSNFYMSFRMLFCLE
Ga0325403_103592023300032354XylemMWNRYSVRGRSRRSRPDYRFERAITFDPTIRSPSNFYRKPFSLEYMWNRYSVSRRCRLSRPEYRFERAITFDPNVGSPSNFYRSFRKLFFLEYMWNRYSVRWKIVARDQSTDSKGP
Ga0325403_103592043300032354XylemMWNRYSVRGRSRRSRPEYRFERAITFDQTVGSPSNFYRSFRKLFFSEYKWNRYLVRWRSRRSRPEFRFGKAITFDATVGSPLNFYMSFQELFFLEYMWNRYSVRRRSRRYRVEYVSKRP
Ga0325403_105024343300032354XylemVRRRSRRLRPEYPFERAISCDATVGSPLNFNKTFRKLFSLEYMWNLYSVRRRFHRSRPEYQFERAITFDQTVGSPSKFYRSIGTPFPL
Ga0325403_105321923300032354XylemMWNRYLVRRRSRRSRPEYRFERAITFDPTVRSPSNFYRSFRKLCCLEYMWNRYSVRRRSRRSRPEYRFERAITFDPTFGSPSNFYRRFRKLFFLE
Ga0325403_105967223300032354XylemMWNRYSVRRRSRRSRLEYRFERAITFDPTVGSPSNFYRKPFSLDYMWNRYSVRRRSRRYRLEYRFDRAITFDPTVGSPSNFYRSFQKLFFLE
Ga0325403_106100613300032354XylemMCNRYSVSGRSLRSRKEYRFERAITFDPTVGSHSNFYRSFRKTFSLEYFWNRYSVRRRSRRSRQEYRFERAITFDPTVRSSSNFYRTFRKLFSL
Ga0325403_106100623300032354XylemMCNRYSVSGRSLRSRKEYRFERAITFDPTIGSHSNFYRSFRKIFSLEYFWNRYSVRRRSRRSRQEYRFERAITFDPTVRSASNFYRTFRKLFSL
Ga0325403_106100633300032354XylemMLNRYLVRLRSRRSGPGYRFERAITFDPTVGSPLNFYKSFRKLFFRRRSRRSRPDFRFERAITFDLTVGSPSNFYRSFRKLFFLE
Ga0325403_107206423300032354XylemMWNRYSVRWRTRRSRPEYRFERAITFDPTVGSPPNVYRIFRKLFSFKYMWNRYLVRRRSRRRRLEYRFERAITVDPTVGSPSNFYRSFRKPFSLW
Ga0325403_107298323300032354XylemMSLRSRRSRQEYRFERTITLDATVGSPLNFYRSFRKLFSMEYMRNRYSVRWRSRRSRPEYRFERAITLDPTVGSPSNFYRSFEKLFFLE
Ga0325403_107695913300032354XylemMIRRSRRFKLEYRFERAITFEPTVGVPSTFYRSFRKLFFLEYMCNRYSVRRRSRPSRQEYWFEMAITFDPTVGSPSNFYRSFRKLFFLA
Ga0325403_108553113300032354XylemMWNRYSMSRRCRLSRLEYRFERAITFDQTVGSPLNFYRNFRKLFFLEYMWNRYSVRRRSRRSRPEYRFERAITFDPTVGSPSNFYRSFRKLFSLE
Ga0325403_108930723300032354XylemMWNRYSVCRRYRRSRPEYRFERAISFDPTVGSPLIFYRSFRKPFSLEYMWNRYSVCRRYRRSRPEYRFERAITFDPTVGSPIIFYRRFRKLFFLE
Ga0325403_109420323300032354XylemMWNRYLVRRRSRRSRPEYRFERAITFDPTVGSPSNFYRSFRELFFLEYMWHRYTVRRRSRRSRLEYQFERAITFDPTVGSPSNFYRSFWELFFL
Ga0325403_109435613300032354XylemRSRPEYRFERAITFDPTVGSPLIFYRSFRKPFSLEYMWNRYSVCRRYRRSRPEYRFERAITFDPTVGLPIIFYTSLRKLFFLE
Ga0325403_109435633300032354XylemMWKRYSVCRRYRRSRLEYRFERAITFDPTVGSPLIFYRSFRKPFSLEYMWNRYSVCRRYRRSRPEYRFERAITFDPTVGSPLNFYTSFRKPFSF
Ga0325403_109824123300032354XylemMWNRYSVRRRSRRSRPEYRFERAITFDPTVGSPSNFYRCFRKLFLLEDMWNCYSVRRRSRRSRPEYRFERAITFDPTVGSPLNFYRIFRKLCCLEYMWNRYAVRRRSRRYRLEYASKGP
Ga0325403_109991413300032354XylemMRNRYSVRWRCRLSRPEYRFERPITFDPTVGSPLNFYRSFRKLFFFEYMWNRYSVRWRCRRSRSEYPFERAITFDPTVGSPSNFYRSFRKL
Ga0325403_110123123300032354XylemMWNGYLVRWRSRRSRPEYRFESAITFDPTVGSPSKFYRSFRKLFSMEYMWNRYSVRRRSRRSRLEYRFERGITFDPTVGSPSNFYRSFRELFFLE
Ga0325403_110835213300032354XylemMWNRYSVRRKYRRPRPEYPFERAISFDPSVGSPPKFYRSFRTPFSKDLMWNRNSVTRRYRRPRPEYPFERAITFDPTVGSPSKFYR
Ga0325403_111595823300032354XylemMWNRYLVRRRSRRSRPEYQFERAITLDPTVGSPSKFYRSFRKLFSMEYMWDRYSVMWRSRRSRPEYRFERAITFDPTVGSPSNFYRSFR
Ga0325403_112119513300032354XylemMWNRYLVRRRSRRSRPEYRFERAITFNPTVGSPSKFYRSFRKLFSVEYMWNRYSVRRRSRRSRREYRFERAITFDPTVGSPLNFYRSFRKPFSL
Ga0325403_112583313300032354XylemMRNSYSVRWRSLRSRPEYRFERAITFDPTIRSPSNFYRSFRTPFYLDWMWNRYSVRRRSRRSRPEYRFERAITFDPTVGSPSNFYRSFKMPFYLE
Ga0325403_112705813300032354XylemVELLLDEAEARRSRPEYRFERAITFNLTVGSLSNFKWSFRKLFFLEYMWNRYSMRQRSRRSRPEYRFERAITYDPTVGSPLNFYRSFRKSFSL
Ga0325403_112821713300032354XylemMWNRYLVRRRSRRSRPEYLFERAITFDPTVGSPSKFYRSFRKLFSMEYMWNRYSVRLRSRRSRPENRFERAITFDATVRSPSNFYRSFRELFFLE
Ga0325403_113456713300032354XylemMWNGYLVRWRSRRSRPEYRFERAITFDPTVGSPSKVYRSFRKLFSMEYMWNRYSVRRRSRRSRPEYRFKRAITFDPTVGSPSNFYRSFRELFFLE
Ga0325403_113935523300032354XylemMWDRYLVRRRSRRSRPEYRFERAITFDQTIGSPSKFYRSFRKLFSMEYMWNRYSVRLRSRRSRPENRFERAITFDATVRSPSNFYRSFRELFFLE
Ga0325403_115506413300032354XylemMWNRYSVRRRSRRSRPEYRFERAITFDQTVGSPSKFYRSFRKLFSMEYMWNRYSVRLRSRRSRPENQFERDITFDATVRSPSNFYRRFRQLFFLE
Ga0325403_115739223300032354XylemMWNRYSVSRRCRLSRLEYRFERAITFDQIVGSPSNFYRSFRKLFFLEYMWSRYSVRRRSRRSRPEYRFEMAITFDPTVGSPFNFYWSFQKPLS
Ga0325403_115803713300032354XylemPGYRFERAITFDPTVGSPSNFYRSFRKLFFRRRSCCSRPEFRFEREITFDPTVGSPSNFYRSFRKLFFLE
Ga0325403_115861313300032354XylemMWNRYLVRRRSRRSRPEYRFERAITFDPTVGSPSNFYRSFRELFFLEHMWHRYSVRRRSRRSRLEYRFERAITFDPTVGSPSNFYRSFWELFFLEYMWNRYSVRRR
Ga0325403_116913213300032354XylemCRLSRPEYRFERAITFDQTVGSPSNVYRNFWKLFFLEYMWNRYSVRRRSRRSRPEYRFERAITFDQTVGSPSNVYRNFWKLFFLE
Ga0325401_100178273300032355XylemVRRRSRRSRPEYPFERAITCDPTVGSPLNFNKTFWKLFSLEYMWNLYSVRRRFHRSRPEYQFERAITFDRTVGSPSKFYWSFRKLFSLK
Ga0325401_1002414143300032355XylemMWNRYSIKWRSRRSRPEYWFERVITFDPTVGSPSNIYSSFRKLFFLEYMWNRYSMTRRSRRSRLEYRFERPITFDPSVGSLSNFNRSFRKLFFL
Ga0325401_1015804123300032355XylemMWNRYSVRRRSPRSRPQYRFERAITFDPTVGSPSNFYRSFGKLFSLEYMWNRYSVRRRARRFRLEYRFERAITVDPTVGSPSNVYRIFRRMFSLD
Ga0325401_101580493300032355XylemMWNRHSVRRMSRRSRPDYRFERAITFDPTVGSPSNFYRSFGKLFSLEYMWNRYSVRRRARRFRLEYRFERAITVDPTVGSPSNVYRIFRRMFSLD
Ga0325401_102895023300032355XylemMLNRYSVRLRSRRSGLGYRFERAITFDPTVGSPSNFYRRFRKLFFRRRSCCSRLEFRFEREITFDPTVGSPSNFYRSFRKLFFLE
Ga0325401_105615723300032355XylemMLNRYLVRLRSSRSRPGYRFERAITFDPSIGSASNFYRSFRKLFFRRRSRRSRPDFRFERAITFDPIV
Ga0325401_106195213300032355XylemMLNRYLERLRSRRSGPGYRFERAITFDPTVGSPSNFYRSFWKLFFRRRSRRSRPDFRFEREITFDPTVGSPSNFYRSFRKLFLLE
Ga0325401_106195223300032355XylemMLNRYLVRLRSRRSRLGYRFERVITFDPTVGSPSNFYRSFWKLFFRRRSRRSRPDFRFEREITFDPTVGSPSNFYRSFQKLFFLE
Ga0325401_106195233300032355XylemMLNRYLVRLRSRRSGLGYRFERAITFDPTVGSPSNFYRSFRKLFFRRRSRRSRPDFRFEREITFDPTVGSPSNFYRSFQKLFFLE
Ga0325401_106195243300032355XylemMLNRYLVRLRSRRSGPGYRFERAITFDPTVGSPSNFYRSFRKLFFRRRSRRSRPDFWFEREITFDPTVGSPSNFYRSFRKLFLLE
Ga0325401_106949233300032355XylemMWNRYSVRRRSRRFRLEYRFERDITFDPTVGSPIIFYRSFRKLFFLEYMWNRYSMRRRSRRSRPEYRFERAITFNLTVGSLSNFKWSFRKLFFLEYMWNR
Ga0325401_107828913300032355XylemMWNRYLVRRRSRRSRLEYRFERAITFDPTVGSPSKFYRSFRKLFSMEYMWNRYSVRLRSRRSRPEYRFERAITFDATVGSPSNFYRSFWELFFLE
Ga0325401_108451213300032355XylemPEYRFERAITFDPNVGSPSNFYRSFRKLFFLEYMWNRYSVRLRSHRSRPEYRFERAITFDTTIGSPSNFYMSFRKMFCLEYMWNRYSVWRRSRP
Ga0325401_110291913300032355XylemMWIRYWVRRRYRRSRLEYRFERAITFDQTVGSPSNFYRSFRKLFSLWKMWNRYSVSRRCRLSRPEYRFERAITFDPTVGSPLNFYRSFR
Ga0325401_111984323300032355XylemMWNRYSVCRRYRRSRPEYRFERAITFDPTVGSHLIFYRSFRKPFSLEYMWNRYSVCRRYRRSRPEYRFERAITFDQTVGSPIIFYRRFRKLFFLE
Ga0325401_111984333300032355XylemMWNRYSVCRRYRRSRLEYRFERAITFDPTVGSPLIFYRSFRKPFSLEYMWNRYSVCRRYRRSRPEYRFERAITFDPTVGSPLNFYTSFRKPFSF
Ga0325401_112890013300032355XylemMPFSKVVMWNRYSVRRRYRRPRPEYLLERAITFNPTVGSPSKFYRSFRTPFSKVLIWNRYSVTRRYRRPRPEYPIERAITIDPTVGSPSKFYRSFRT
Ga0325401_112984513300032355XylemMWNRYLVRRRSRRSRLEYRFERAITFDPTVGSPSKFYRSFRKLFSMEYMWNRYSVRLRSRRSRPEYRFERAITFDATVRSPSNFYRSFRELFFLE
Ga0325401_116607923300032355XylemMWNGYLVRWRSRRSRPEYRFESAITFDPTVGSPSKFYRSFRKLFSMEYMWNRYSVRRRSRRSRPEYRFKRAITFDPTVGSPSNFYRSFRELFFLE
Ga0325401_117171413300032355XylemPTVGSPSKFYRSFRKLFSMEYMWNRYSVRRRSRRSRPEYRFKTAITFDPTVGSPSKFYRSFRKLFSMEYMWNRYSVTRRSRRSKPEYRFERAITFDPTVGSPSNFYRSFRELFFLE
Ga0325401_117775413300032355XylemMWNRYSVCRRYRHSRPEYRFERARTFDPTVGSPLIFYRSFRKPFSLEYMWNRYSMCRRYRRSRPEYRFERARTFDPTVGSPIIFYRSFRKLFFLE
Ga0325401_118784923300032355XylemMWNRYLVRRRSRRSRPEYQFERAITLDPTVGSPSKFYRSFRKLFSMEYMWDRYSVMWRSRRSRPEYRFERAITFDPTVGSPLNFYRSFRELFFLDYMWHRYSVRRRSRRSRLEYQFERAITFDT
Ga0325401_119034733300032355XylemMWNRYSVMRRNRRFRLEYGFERAITLVPTVGSPSKFYRSFRTLFYKESIWNRYSMMRRYRRARPEYPFERAITFDPSVGSPSKFYRS
Ga0325401_119254313300032355XylemMWNRYSVSRRSRRSRPEYQFERAITFDPTVGSPIIFYRSFWKLFFLEYMWNRYSVCRRYRRSRPEYRFERAITFDPTVGSPLNFYTS
Ga0325401_119481013300032355XylemFRKLFSMEYMWNRYSVRLRSRRSRPENRFERAITFDATVRSPSNFYRSFRKLFSMEYMWNRYSVRRTSRRNRPEYRFERAITFDATFRSPSNFYRSFRELFFLE
Ga0325401_119734623300032355XylemMWNRYSVSRRCRLSRLDYRFERAITFDPNVGSPSNFYRRFRKLFFLEYMWNRYSVSRRCRLSRLEYRFERAITFDPTVGSPSN
Ga0325401_120641913300032355XylemCNRYSVSGRSLRSRQEYRFERAITFDPTVGSHSNFYRSFRKPFSLEYLWNRYSVRQRSRRSRQEYRFERAITFDPTVRSSSNFYRTFWKLFSF
Ga0325401_122674213300032355XylemMWNRYLVRRRSRRSRPEYLFERAITFDPIVGSPSKFYRSFRKLFSMEYMWNRYSVRLRSRRSRPENRFERAITFDATVRSPSNFYRSFRELFFLE
Ga0325401_124484613300032355XylemMWNRYSVSRRCRLSRPEYRFERAITFDQTVGSPSNFYRTFRKLFFLEYMWNRYSVRRRCRRSRPEYRFERAITFDPTVGSPSNFNRSF
Ga0325401_124484623300032355XylemRSRPEYRFERAITFDQTVGSPSNFYRTFRKLFFLEYMWTRYSVRRRSPRSRPEYRFERAITFDPTVGSPSNFYRSLRKLFSLE
Ga0325400_106443813300032374XylemMLNRYLERLRSRRSGPGYRFERAITFDPTVGSPSNFYRSFWKLFFRRRSRRSRPDFRFEREITFD
Ga0325400_108927013300032374XylemMWNRYWVRWRYCRSRPEYRFARAITFDPTGGSPSYSYRSFRKLFFLEYMWNGYSVRRRSCRSRPEYRFERAITFDPTVGSPSNFNRSFRKLFSL
Ga0325400_113919813300032374XylemMWNRYSVRRRSPRSRPEYRFDRAITFDPTVGSPSTFYRSFRKLILLEYMWNCYSVRRRSRRYRQEYRFERAVTFDPPVWIALK
Ga0325400_117422113300032374XylemMWIRYWVRRRYRRSRLEYRFERAITFDQTVGSPSNFYRSFRKLFSLWKMWNRYSVSRRCRLSRPEYRFERAITFDPTVGSPLNFYRS
Ga0325400_119223813300032374XylemYRRSRPEYRFERAISFDPTVGSPLIFYRSFRKPFSLEYMWNRYSVCRRYRRSRPEYRFERAITFDPTVGSPIIFYRRFRKLFFLE
Ga0325400_120441413300032374XylemVRRRSRRYRLEYLSERAITFDPTVGSPSNIYRSFRKLFFLEYMWNCYSVSWRYRRSRPEYRFERAITFDPTVGSPSNFYMSFRKLL
Ga0325400_120879913300032374XylemMWNRYLVRRRSRRSRLEYRFERAITFDPTVGSPSKFYRSFRKLFSMEYMWNRYSVRLRSRRSRPENRFERAITFDATVRSPSNFYRSFRELFFLE
Ga0325400_121231123300032374XylemMWNRYLVRRRSRRSRPEYRFERAITFDPTVGSPSNFYRSFRELFFVEYMWHRYSVRRRSRRSRLEYQFERAITFDPTVGSPSNFYRSFWELFFLEYMWNRYSVRRRSRR
Ga0325400_123057513300032374XylemRPEYRFERAITFDPTVGSPLNVYRIFRMLFSFKYMWNRYLVRRRSRRHRLEYQFESAITVDPTVGSPSNFYRSFGGRFRCGSYGIATW
Ga0325400_127210113300032374XylemMWNRYSVSRRCRLSRPEYRFERAITFDQTVGSPSNVYWNFRKLFFLEYKWNRYSVRRRSRRSRREYRLERAITFDPTVGSPSNIYRNFRKLFFLEYMWNRYSVRRRSR
Ga0325405_101790823300032389XylemMLNRYLVRLRSRRSGPGYLFERAITFDPTVGSPLNFYRSFRKLFFRRRSRRSRPDFQFERAITFDPIVGSPSNFYRSFRKLFFLK
Ga0325405_101790833300032389XylemMLNRYSVRLRSRRSGPGYRFERAIPFDPTVGSPSNFYRSFRKLFFRRRSRRSRPDFRFERAITFDPTVGSHSNFYRSFRKLFFLK
Ga0325405_101790843300032389XylemMCNRYSVSGRSLRSRKEYRFERAITFDPTVGSHSNFYRSFRKPFSLEYFWNRYSVRRRSRRSRQEYRFERAITFDPTVRSSSNFYRTFRKLFSL
Ga0325405_101790853300032389XylemMLNRYLVRLRSRRSGPGYRFERAITFDPTVGSPLNFYRSFRKLFFRRRSRRSRPDFQFERAITFDPIVGSPSNFYRSFRKLFFLE
Ga0325405_101790863300032389XylemMLNRYLVRLRSRRSGPGYRFERAKTFDPAVGSPSNFYRSFRKLFFRRRSCRSRPDFRFERAITFDPTVGSASNFYMSFRTPFFLD
Ga0325405_101790873300032389XylemMLNRYLVRLRSRRSGPGYQFERAITFDPTVGSPSNFYRSFRKRFFRRRSRRSIPDFWFERAITFDPTVGSPSNFYRSFRKLLFLE
Ga0325405_102478813300032389XylemMWNRYLVRRRSRRSRPEYRFERAITFDLTVGSPSKFYRSFRKLFSVEYMWNRYSVRRRSRRSRLEYRFERAITFDPTVGSPLDFYRSCRKPFSL
Ga0325405_102929543300032389XylemMWNRYSVRRRSRRFRLEYRFERDITFDPTVGSPSNFYWSFRKPFFLEYMWNRYSMRRRPRRSRREDRFERAITFDPTVGSPLIFYRSFLKLFFLE
Ga0325405_102929563300032389XylemVESFSVRRRTRRSRPEYRFERAIIFDPTVGSPPNVYRIFRKMFSFKYMWKRYLVRRRSRRFRLEYRFERAITVDPTVGSPSNFYRSFRKPFSLW
Ga0325405_103195133300032389XylemMWKCYLVRRRSRRFRLEYRFERAITFDPTVGWPSNVYRIFRKLFSFKYMWNRYLVRRRSRRFKLEYRFQRAITVDPTIGSLSNFYRSFRKPFLLS
Ga0325405_103604123300032389XylemMWNRYSVRRRSLRSRPTYRFERAVTFDPTVGSPSNFFRSFRTPFPLEQKWNRYSLWRRSLRSRQAYRFERAVTFDPTVGSPSNFYRSF
Ga0325405_104452433300032389XylemMWNCYSVSRRNCRSRPEYRFERAITFDPTVGSPSIFYRSFWKLFFLEYMWNRNSMRRRSRRSRPEYRFERAITVDPTVGLPSNFYRSFRKLFFLE
Ga0325405_106303413300032389XylemMLNRYLVRLRSRRSGPGYRFERAITFDPTVGSHSNFYRSFRKLFFRRRSRRSRPDFRFERAITFDPTVGSHSNFYRSFRKLFFLE
Ga0325405_106423213300032389XylemGSPLIFYRSFRKPFSLEYMWNRYSVCRRYRRSRPEYRFERAISFDPTVGSPLIFYRSFRKPFSLEYMWNRYSVCRRYRRSRPEYRFERAITFDPTVGSPIIFYRRFRKLFFLE
Ga0325405_107184533300032389XylemMWNRYSVTRRYRRPRPEYPFERAITFDPTVGSPSKFYRSFRMLFSKDLMWNRYSVMRRYRRPRPEYPFERAITFDPSVGSPSKFY
Ga0325405_107811213300032389XylemMWNRYSVRRRSRRSRPEYRFERAITFDATVGSPSNFYRIFRKLFSFKYMWNRYLLRRRSRRVRLEYRFERAIPVDPTVGSPSNFYRSFRKPFSLW
Ga0325405_108152723300032389XylemMWNRYLVSRRSRRSRLEYRFERAITFDPTVGSPLNVYRIFRMLFSFKYMWNRYLVRRRSRRRRLEYRFERAITVDPTVGSPSNF
Ga0325405_111232813300032389XylemSRRSRRSRPEYQFERAITFDPTVGSHLIFYRSFRKPFSLEYIWNRYSVCRRYRRSRPEYRFERAITFDQTVGSPIIFYRRFRKLFFLK
Ga0325405_111810513300032389XylemMWNRYSVRRRYRRPRPEYPLERAITFDPTVGSPSEFYRSFRTPFSLDLMWNRYSVRRRYRRPRPEYPFEIAITFDPTVGSPSKFYRSF
Ga0325405_111941413300032389XylemMWNRYSVYRRYRRSRPEYRFERAITFDPTVGSPLIFYRSFRKPFSLEYMWNRYSVCRRYRRSRPEYRFERAITFDPTVGLPIIFYTSFRKLFFLE
Ga0325405_112953723300032389XylemMWNHYSVCWRYRRSRPEYRFERAITFDPTVGSPLIFYRSFRKPFSLEYMWNRYSVCRRYRRSRPEYRFERAITFDPTVGSPIIFYRSFRKPFSLEYMWNRYSVCRRYRRSRPEYRFGRAITFY
Ga0325404_1007179103300032390XylemMWNRYSASRRSRRSRPEYRFERAITFDPTVGSPSNFYRSFRKLCCLEYMWNRYSVRWRSRRYRLEYRFERAITFDSTVGSPLNFYRSFWKPFSL
Ga0325404_1007179143300032390XylemMWNRYLVKRRSRRYRVEYRFERAITFDPTVGSPSNFYRIFRKLFSLEKMWNRYSVSRRCRLWRAEYRFERAITFDPTVGSPSNFYRSFRKPFSL
Ga0325404_100717983300032390XylemMWNRYSVSRRCRLSRPEYRFERAITFDLTVGSPSNFYRSFRKLFFLENMWNRYSMRRRSRRYRLEYRFERAITFDPTVGSPSNFYRSLRKRFP
Ga0325404_103356513300032390XylemVRRRTRRSRPEYRFERAITFDPTVGSPPNVYRIFRKLFSFKYMWNRYLVRRRSHRRRLEYRFERAITIDPTVGSRSNFYRSFRKLFSLW
Ga0325404_104649323300032390XylemMWNRYLVSRRSRRSRLEYRFERAITFDPTVGSPLNVYRIFRMLFSFKYMWNRYLVRRRSRRRRLEYRFERAITVDPTVGSPSNFYRSFRKLFSLW
Ga0325404_104649333300032390XylemMWNRYSMRRRSRRSRSEYRFERAITFDSTVGSPPNVYRIFRKLFSFKYMWNRYLVRRRSRRFRQEYRFERAITVDPTVGSPSNFYRSFRKPFSLW
Ga0325404_104904913300032390XylemRVEYPFERAITFDPTVGSPSIFYRSFRKPFLLEYMWNRYSTRRRSRRSGREYRFERPITFDQTVGSPSNFYRSFQKPFSLK
Ga0325404_105383843300032390XylemMCNRYSVSGRSLRSRKEYRFERAITFDPTVGSHSNFYRSFRKPFSLEYFWNRYSVRRRSRRSRQEYRFERAITFDPTVRSSSNFYRSFRKL
Ga0325404_106511633300032390XylemMWNRYSMRRRARRSRPEYRFERAITFDPTVGSPLNVYRIFRMLFSFKYMWNRYLVRRRSRRFRLEYRFERAITVDPTVGSPSNFYRSFRKSFFLEYMWNRSSVR
Ga0325404_107032713300032390XylemMWNRYSVRRRSRRFRLQFRFERDITFDPTVGSPLNFYRSFRKLFFLEYMWNRYSMRRRSRRSRSEYRFQRAITFDSTVGSPPNVYRIFRKLFSFKYMWNRYLVRRRSRRFRLQ
Ga0325404_112466413300032390XylemMWNRYSVSRSSPSWRLEYRFERAITFDPTVGSPLIFYRSFRKPFSLEYMWNRYSVCRRYRRSRPEYRFERAISFDPTVGSPLIFYRSFRKPFSLEY
Ga0325410_104029733300032735XylemMWNRYLLSRRYRRSRPEYRFERAITFDPTVGSPPNVYRIFRKLFSFKYIWNRYLVRRRSRRFRLEYRFERAILVDPTVGSPSNFYRSFRKPFSLW
Ga0325410_108961713300032735XylemMWNRYSVRRRSRRFRLQFRFERDITFDPTVGSPLNFYRSFRKLFFLEYMWNRYSMRRRSRRSRSEYRFQRAITFDSTVGSPPNVYRIFRKLFSFKYMWNRYLVRRRSRRFRL
Ga0325410_111590413300032735XylemMWNRYSVYRRYRRSRPEYRFERAITFDPTVGSPLIFYRSFRKPFSLEYMWNRYSVCRRYRRSRPEYRFERAITFDPTVGWPIIFYTSFRKLFFLE
Ga0325410_111763813300032735XylemMWNRYSVCRRYRRSRPEYRFERAITFDPTVGSHLIFYRSFRKPFSLEYIWNRYSVCRRYRRSRPEYRFERAITFDQTVGSPIIFYRRFRKLFFL
Ga0325411_104527733300032740XylemMWNHYSVRRWSRRSRPEYQFERAITFDPTVVSPTNFYWSFQKPFLLEYMWNRYSMRQRSRRSRPEYRFERAITFDPTVGSPSNFYRSFGKPFSL
Ga0325411_109410913300032740XylemMWNRYSVRRRSRRFRLQFRFERDITFDPTVGSPLNFYRSFRKLFFLEYMWNRYSMRRRSRRSRSEYRFKRAITFDSTVGSPPNVYRIFRKLFSFKYMWNRYLVRRRSRRFRL
Ga0325414_101380543300032741LeafLVSRRSRRSRPEYRFERAITFDPTVGSPLNVYRIFRMLFSFKYMWNRYSVCWRYRRLRLEYRFERAIIFDPTVGSPSNFTGVSGSRFSWSTCGIASR
Ga0325414_102780283300032741LeafMLNRYLVRLRSRRSGLGYRFERAITFDPTVGSPSNFYRSFRKLFFRRRSRRSRPDFRFEREITFDPTVGSPSNFYRSF
Ga0325414_104247813300032741LeafMWNRYSMRRRARRSRPEYRFERAITFNLTVGSLSNFKWSFRKLFFLEYMWNRYSMRRRSCRSRPEYRFERAITFDPTVGSPSKFYRSFRKPFSL
Ga0325414_104977723300032741LeafMWNRYSVRRRSRRSRPEYRFERAITFDPTVGSPSNFYRSFRKLFFRRRSRRSRPDFRFEMEITFDLTVGSPSNFYRSLRKLFLLE
Ga0325414_106965023300032741LeafMWNRYSVSRSSPSWRLEYRFERAITFDPTVGSPLIFYRSFRKPFSLEYMWNRYSVCRRYRRSRPEYRFDRAITFDPTVGSPIIFYRRFRKLFFLE
Ga0325414_108432113300032741LeafMWNGYLVRWRSRRSRPEYRFESAITFDPTVGSPSKFYRSFRKLFSMEYMWNRYSVRQRSRRSKPEYRFERAITFDPTVGSPSNFYRSFQKLFFLAQMWN
Ga0325414_108432133300032741LeafMWNGYLVRWRSRRSRPEYRFERAITFDPTVGSPSKFYRSFRKLFSMEYMWNRYSVRRRSRRSRPEYRFKTAITFDPTV
Ga0325414_113617713300032741LeafLWNRYWVRRRSRRFRLEYRFERAITVDPTVGSPSNFYRSLRKPFFLEYMWNRYSVRRRSRRSRPEYRFERAITFDPTVGSPLIFYRSFRKPFFLEYMWNRYSVRRRS
Ga0325414_113707013300032741LeafMWNRYSVSWRYRRVRLEYPLERAITFDPTVGSPSKFYRSFRTPFTKDLMWNRYSVMRRYRHPRTEYPLERAITFDPTVGSPSKFYRSFRTPFSLEWMWNRYSVRRR
Ga0325414_113899523300032741LeafSNFYRCFRKLFFLEDIRNCYSVRRRSRRSRPEYRFERAITFDATVGSPSNFYRSFRKLFSMEYMWNRYSVMWRSRRSRPEYRFETAITLDPTVGSPSNFYRSF
Ga0325414_114383523300032741LeafMWNNYSVRRWSRRSRPEYQFERAITFDPTVGSPTNFYWSFQKPFFLEYMWNRYSMRPRSSRSRPEYRF
Ga0325414_114521313300032741LeafMWNRYSVSRRCRLSRPEYRFERAITFDQTVGSPSNVYRNFRKLFFLEYKWNRYSVRRRCRRSRPEYRFERAITFDPTVGSPSYSYRSFRKL
Ga0325402_1001394183300033160XylemMWNRYSIRRRSRRSRPEYRFERAITFDPTVVSPSNFYRSFPKLFFLEYMWNRYSLRWRSRSSRPQYRFERAITFNPTVGSPSNFYRSFRKPFSLQ
Ga0325402_1001394193300033160XylemMGNRYSMRRRSRRSRPEYQFERARTFDPTVGSPSIFYKSFRKLFFLEYMWNRYSRRPRSRRSRPEYRFERAIIFDPTVGSPSNFY
Ga0325402_1001394203300033160XylemMWNRYLMRWRSRRSRLEYQFERAITFDPTVGSPSIFYKSFRKLFFLEYMWNRYSMRPRSRRSRPEYRFERAITFDPTVGSPSNFYRSLRKPFFLEYM
Ga0325402_102736153300033160XylemMWNLYLVRRRSRRSRPEYRFERAITLDPTVGSPSKFYRSFRKLFSVEYMWNRYSVRRRSRRSRLEYRFERAITFDPTVGSPLNFYRSFRKPFSL
Ga0325402_104799443300033160XylemMWNRYSVRRRSRRSRPEYRFERAITFDPIVGSPSNFYRSFRKLFLVEYMWNCYSVSRRFRRSRPEYRFERAITFDLTVGSLSNFYRSFRKPFSL
Ga0325402_105324333300033160XylemMWNRYSVCWRYRRSRPEYRFERAISFDPTVGSPLIFYRSFRKPFSLEYMWNRYSVCRRYRRSRPEYRFERAITFDPTIGSPLNFYTSFRKPFSL
Ga0325402_105857623300033160XylemMWNRYLVRRRSRRSRPEYRFERAITFDPTVGSPSKFYRSFRKLFSVEYMWNRYSVRRRSRRSRLEYRFERAITFDPTVGSPLNFYRSCRKPFSL
Ga0325402_105973213300033160XylemMLNRYLVRLRSRRSGPGYRFERAITFDPTVGSHSNFYRSFRKLFFRRRSRRSRPDFRFERAITFDPTVGSPSNFYRSFRKLFFL
Ga0325402_107229213300033160XylemMWNRYSVCRRYRRSRPEYRFERAITFDPTVGSPLIFYRSFRKPFSLEYMWNRYSVCRRYRRSRPEYRFERAITFDPTVGLPIIFYTSLRKLFFLE
Ga0325402_113540713300033160XylemMWNRYLVRRRSRRSRPEYRFERAITFVATVGSPSNFYRSFRKLFFLEDMWKCYSVRRRSRRSRPEYRFERAITFDPTVRSPSNFYKIFRKLCCLEYMWNRYAVRRRSPRYRLEYASKGR
Ga0325402_114599013300033160XylemMRNSYSVRWRSLRSRPEYRFERAITFDPTIRSPSNFYRSFRTPFYLDWMWNRYSVRRRSRRSRPEYRFERAITFDPTVGSPSNF
Ga0325402_114893823300033160XylemMWNRYLVRRRSRRSRPEYQFERAITLDPTVGSPSKFYRSFRKLFSMEYMWDRYSVMWRSRRSRPEYRFERAITFDPTVGSP
Ga0325402_115077513300033160XylemMWNRYLVRRRSRRSRPEYRFERAITFDPTVGSPSNFYRSFRELFFLEYMWHRYSVRRRSRRSRLEYRFERAITFDPTVGSPSNFYRSFWELFFLEYMWNRYSVRRR
Ga0325402_115882113300033160XylemRSRPEYRFERAITFDQTVGSPSNFYRTFRKLFFLEYMWNRYSVRRRSHRSRPEYRFERAITFDPTVGSPSNFNRSFRKPLSF
Ga0325419_018024_2173_24573300034389LeafMESFSVRRRTRRSRPEYRFERAIIFDPTVGSPPNVYRIFRKMFSFKYMWKRYLVRRRSRRFRLEYRFERAITVDPTVGSPSNFYRSFRKPFSLW
Ga0325419_018024_4205_44743300034389LeafMRRRTRRSRPEYRFERAITFDPTVGSPPNVYRIFRKLFSFKYMWNRYLVRRRSHRRRLEYRFERAITIDPTVGSRSNFYRSFRKLFSLW
Ga0325419_055452_944_12853300034389LeafMWNRYSVRRRSRRFRLQFRFERDITFDPTVGSPLNFYRSFRKLFFLEYMWNRYSMRRRSRRSRSEYRFKRAITFDSTVGSPPNVYRIFRKLFSFKYMWNRYLVRRRSRRFRLQ
Ga0325419_075167_399_6863300034389LeafMWNRYSVCRRYRRSRPEYLFERAITFDPTVGSHLIFYRSFRKPFSLEYIWNRYSVCRRYRRSRPEYRFERAITFDQTVGSPIIFYRRFRKLFFLE
Ga0325420_071581_1459_17103300034688LeafMLNRYLVRLRSRRSGPGYLFERAITFDPTVGSPLNFYRSFRKLFFRRRSRRSRPDFQFERAITFDPIVGSPSNFYRSFRKLFFL
Ga0325420_091651_902_12103300034688LeafMWNLYLVRQRSRRSRPEYRFERAITFDPIVGSPSNFYGSLRKPFSLEHMCNRYSVRRRSSRFRVEYPFERAITFDPTVGSPSIFYRSFRKPFLLEYMWNRYST
Ga0325420_092834_890_11893300034688LeafSFKFMWNRYLVRRRSRRFRLEYRFERAITVDPTVGSPSNFYRSFRKPFFLEYMWNRYSMRRRARRSRPEYRFERAITFDPNVGSPLIFYRSFRKLFFLA
Ga0325420_108955_1_2613300034688LeafMWNRYSVMRRYRRPRPEYPLERAITFDSTIGSPSKFYRGFRTPFFKDLMWNRYSVRRRYHRPQPEYPFEIAITFDPTVGSPSKFYRS
Ga0325420_109771_2_2533300034688LeafRFRLEYRFERAITVDPTVGSPSNFYRSFRKPFFLEYMWNRYSVRQRSRRSRPEYRFERAITFDPTIGSPLIFYRSFWKLFFLE
Ga0325420_118135_546_8393300034688LeafMWNRYFVRRQYHRPRLEYPFERAITFDPTVGSPSKFYRSFQTPFFKVLMWNRYSVKRQYRRPRLEYPFERAITFDPTVGSPSKFYRSFRTPFSKVLMW
Ga0325420_122356_1_2583300034688LeafMWNRYSVTRRYRRPRPEYPFERAITFDPTVGSPSKFYRSFRTPFSKILMWNRYSVRRRYRRPRPEYPIERAITFDPTVGSPSKFYR
Ga0325420_147044_266_5893300034688LeafMWNRYLVSRRSRRSRPEYRFERAITFDPTVGSPLNVYRIFRMLFSFKYMWNRYLVRRRSRRFRLEYRFERAITVDPTVGSPSNFYRSFRKPFFLEYMWNRYSVRRRSR
Ga0325421_009733_6275_65593300034689LeafMWNRYSMSRRYRRSRQEYWFEKVITFDPTVGSLSNVYRILRKLFSLEYMWNRYSVRRRSRRFKLEYRFVRAITFDPTVGSRSNFYRSFRKPFSL
Ga0325421_029866_3764_40213300034689LeafMLNRYLVRLRSRRSGPGYRFERAITFDPTVGSPLNFYRSFRKLFFRRRSRRSRPDFQFERAITFDPIVGSPSNFYRSFRKLFFLK
Ga0325421_035093_2493_27803300034689LeafMCNRYSVRRRSMRSKPEYRFERAITFDPTVGSPSNFYRSLRTLFSLEYMWNPYSVRRRSRRSRSEYRFENAITFAPTVGSHSNVYRSFRILFFLL
Ga0325421_061940_1341_15983300034689LeafMLNRYLVRLRSRRSGPGYRFERAITFDPTVGSPLNFYKSFRKLFFRRRSRRSRPDFRFERAITFDPTVGSPSNFYRSFRKLFFLE
Ga0325421_061940_1599_18743300034689LeafYSVSGRSLRSRKEYRFERAITFDPTVGSHSNFYRSFRKPFSLEYFWNRYSVRRRSRRSRQEYRFERAITFDPTVRSSSNFYRSFRKLFLLE
Ga0325423_133303_281_5353300034778LeafMWNRYSVRRRYRRPRPEYSFERPITFDPTVGSPSKFYRSFRTPFSKDLMWNRYSVRRRYRRPRPEYPIERAITFDPTVGSPSKFY
Ga0325409_099179_247_5343300034901XylemMWNRYSVCRRYRRSRPEYRFERAITFDPTVGSPLIFYRSFRKPFSLEYMWNRYSVCRRYRRSRPEYRFERAITFDPTVGLPIIFYTSFWKLFFLE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.