Basic Information | |
---|---|
Family ID | F035521 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 172 |
Average Sequence Length | 42 residues |
Representative Sequence | IKPGEEIHLGAGQRFRVLDVVPFDEEDESPFVGLLQIEAA |
Number of Associated Samples | 113 |
Number of Associated Scaffolds | 171 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 39.88 % |
% of genes near scaffold ends (potentially truncated) | 37.79 % |
% of genes from short scaffolds (< 2000 bps) | 85.47 % |
Associated GOLD sequencing projects | 107 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (69.186 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.605 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.256 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.140 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 30.88% Coil/Unstructured: 69.12% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 171 Family Scaffolds |
---|---|---|
PF13473 | Cupredoxin_1 | 2.92 |
PF14019 | DUF4235 | 2.34 |
PF00571 | CBS | 1.75 |
PF07885 | Ion_trans_2 | 1.17 |
PF00565 | SNase | 1.17 |
PF04545 | Sigma70_r4 | 1.17 |
PF07366 | SnoaL | 1.17 |
PF03793 | PASTA | 1.17 |
PF00589 | Phage_integrase | 0.58 |
PF00300 | His_Phos_1 | 0.58 |
PF13668 | Ferritin_2 | 0.58 |
PF13560 | HTH_31 | 0.58 |
PF13229 | Beta_helix | 0.58 |
PF04906 | Tweety | 0.58 |
PF04326 | AlbA_2 | 0.58 |
PF07690 | MFS_1 | 0.58 |
PF10083 | DUF2321 | 0.58 |
PF05103 | DivIVA | 0.58 |
PF00392 | GntR | 0.58 |
PF04542 | Sigma70_r2 | 0.58 |
PF13602 | ADH_zinc_N_2 | 0.58 |
PF08281 | Sigma70_r4_2 | 0.58 |
PF00140 | Sigma70_r1_2 | 0.58 |
PF14446 | Prok-RING_1 | 0.58 |
PF03795 | YCII | 0.58 |
PF02494 | HYR | 0.58 |
PF14572 | Pribosyl_synth | 0.58 |
PF00912 | Transgly | 0.58 |
PF00989 | PAS | 0.58 |
COG ID | Name | Functional Category | % Frequency in 171 Family Scaffolds |
---|---|---|---|
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.17 |
COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.58 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.58 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.58 |
COG2865 | Predicted transcriptional regulator, contains HTH domain | Transcription [K] | 0.58 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.58 |
COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 69.19 % |
All Organisms | root | All Organisms | 30.81 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2166559005|cont_contig70108 | Not Available | 743 | Open in IMG/M |
2170459002|F0B48LX02HPNDA | Not Available | 541 | Open in IMG/M |
2170459003|FZ032L002HVOPW | Not Available | 523 | Open in IMG/M |
2170459023|GZGNO2B01DCPDO | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
2189573000|GPBTN7E01BQZYJ | Not Available | 521 | Open in IMG/M |
2189573001|GZR05M101A050V | Not Available | 514 | Open in IMG/M |
2189573002|GZIGXIF02IR83O | Not Available | 531 | Open in IMG/M |
2189573003|GZIR7W402JEBQZ | Not Available | 548 | Open in IMG/M |
3300000956|JGI10216J12902_100671097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2029 | Open in IMG/M |
3300000956|JGI10216J12902_114602920 | Not Available | 806 | Open in IMG/M |
3300001535|A3PFW1_10533175 | Not Available | 806 | Open in IMG/M |
3300001535|A3PFW1_10615084 | Not Available | 512 | Open in IMG/M |
3300001536|A1565W1_10036262 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
3300001536|A1565W1_10083813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2589 | Open in IMG/M |
3300002568|C688J35102_118903785 | Not Available | 611 | Open in IMG/M |
3300002568|C688J35102_120949224 | All Organisms → cellular organisms → Bacteria | 2854 | Open in IMG/M |
3300004114|Ga0062593_100578279 | Not Available | 1065 | Open in IMG/M |
3300004156|Ga0062589_100206203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1425 | Open in IMG/M |
3300004156|Ga0062589_100929386 | Not Available | 804 | Open in IMG/M |
3300004157|Ga0062590_100492889 | Not Available | 1041 | Open in IMG/M |
3300004157|Ga0062590_100666759 | Not Available | 929 | Open in IMG/M |
3300004157|Ga0062590_101909706 | Not Available | 613 | Open in IMG/M |
3300004479|Ga0062595_100089951 | Not Available | 1589 | Open in IMG/M |
3300004479|Ga0062595_100571347 | Not Available | 872 | Open in IMG/M |
3300004479|Ga0062595_101335635 | Not Available | 648 | Open in IMG/M |
3300004480|Ga0062592_101370077 | Not Available | 672 | Open in IMG/M |
3300004480|Ga0062592_102431330 | Not Available | 526 | Open in IMG/M |
3300004643|Ga0062591_100032655 | All Organisms → cellular organisms → Bacteria | 2742 | Open in IMG/M |
3300005178|Ga0066688_10940845 | Not Available | 530 | Open in IMG/M |
3300005184|Ga0066671_10293714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1017 | Open in IMG/M |
3300005332|Ga0066388_103113954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 847 | Open in IMG/M |
3300005332|Ga0066388_105231861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 658 | Open in IMG/M |
3300005337|Ga0070682_100316278 | Not Available | 1151 | Open in IMG/M |
3300005337|Ga0070682_101879701 | Not Available | 524 | Open in IMG/M |
3300005434|Ga0070709_10009955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 5255 | Open in IMG/M |
3300005434|Ga0070709_10035653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3024 | Open in IMG/M |
3300005434|Ga0070709_10307125 | Not Available | 1160 | Open in IMG/M |
3300005434|Ga0070709_10330322 | Not Available | 1121 | Open in IMG/M |
3300005434|Ga0070709_10672078 | Not Available | 803 | Open in IMG/M |
3300005435|Ga0070714_100724248 | Not Available | 961 | Open in IMG/M |
3300005439|Ga0070711_100022572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 4080 | Open in IMG/M |
3300005439|Ga0070711_100093480 | Not Available | 2172 | Open in IMG/M |
3300005529|Ga0070741_11350354 | Not Available | 594 | Open in IMG/M |
3300005535|Ga0070684_101241461 | Not Available | 701 | Open in IMG/M |
3300005553|Ga0066695_10307427 | Not Available | 999 | Open in IMG/M |
3300005614|Ga0068856_102690517 | Not Available | 503 | Open in IMG/M |
3300005764|Ga0066903_100557197 | Not Available | 1968 | Open in IMG/M |
3300005764|Ga0066903_100725101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1759 | Open in IMG/M |
3300005764|Ga0066903_100876308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1620 | Open in IMG/M |
3300005764|Ga0066903_100981681 | Not Available | 1541 | Open in IMG/M |
3300005764|Ga0066903_101262261 | Not Available | 1377 | Open in IMG/M |
3300005764|Ga0066903_103191308 | Not Available | 887 | Open in IMG/M |
3300006046|Ga0066652_100339830 | Not Available | 1347 | Open in IMG/M |
3300006059|Ga0075017_100041217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3074 | Open in IMG/M |
3300006059|Ga0075017_100524944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 900 | Open in IMG/M |
3300006059|Ga0075017_101237600 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300006102|Ga0075015_100624304 | Not Available | 633 | Open in IMG/M |
3300006163|Ga0070715_10138330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1180 | Open in IMG/M |
3300006173|Ga0070716_100098672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1785 | Open in IMG/M |
3300006175|Ga0070712_100528976 | Not Available | 991 | Open in IMG/M |
3300006175|Ga0070712_100834515 | Not Available | 792 | Open in IMG/M |
3300006175|Ga0070712_101445842 | Not Available | 600 | Open in IMG/M |
3300006800|Ga0066660_11413208 | Not Available | 546 | Open in IMG/M |
3300006871|Ga0075434_100062752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3699 | Open in IMG/M |
3300009012|Ga0066710_103281355 | Not Available | 619 | Open in IMG/M |
3300009098|Ga0105245_12203402 | Not Available | 605 | Open in IMG/M |
3300009137|Ga0066709_100263577 | All Organisms → cellular organisms → Bacteria | 2316 | Open in IMG/M |
3300009174|Ga0105241_11985680 | Not Available | 572 | Open in IMG/M |
3300009177|Ga0105248_12524661 | Not Available | 586 | Open in IMG/M |
3300009553|Ga0105249_12842198 | Not Available | 555 | Open in IMG/M |
3300010154|Ga0127503_10703056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 739 | Open in IMG/M |
3300010154|Ga0127503_10994324 | Not Available | 554 | Open in IMG/M |
3300010321|Ga0134067_10211348 | Not Available | 717 | Open in IMG/M |
3300010360|Ga0126372_10278290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1455 | Open in IMG/M |
3300010366|Ga0126379_13516726 | Not Available | 525 | Open in IMG/M |
3300010373|Ga0134128_11028136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 910 | Open in IMG/M |
3300010373|Ga0134128_11713061 | Not Available | 692 | Open in IMG/M |
3300010373|Ga0134128_12870981 | Not Available | 531 | Open in IMG/M |
3300010375|Ga0105239_12682562 | Not Available | 581 | Open in IMG/M |
3300010398|Ga0126383_11599752 | Not Available | 741 | Open in IMG/M |
3300010401|Ga0134121_10371487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1284 | Open in IMG/M |
3300011994|Ga0120157_1052822 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
3300011996|Ga0120156_1102641 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300012199|Ga0137383_10546962 | Not Available | 847 | Open in IMG/M |
3300012199|Ga0137383_11363977 | Not Available | 503 | Open in IMG/M |
3300012200|Ga0137382_10305128 | Not Available | 1111 | Open in IMG/M |
3300012200|Ga0137382_10974862 | Not Available | 609 | Open in IMG/M |
3300012201|Ga0137365_10770938 | Not Available | 702 | Open in IMG/M |
3300012201|Ga0137365_10888646 | Not Available | 650 | Open in IMG/M |
3300012206|Ga0137380_10235623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1653 | Open in IMG/M |
3300012207|Ga0137381_10901835 | Not Available | 764 | Open in IMG/M |
3300012208|Ga0137376_11019340 | Not Available | 709 | Open in IMG/M |
3300012208|Ga0137376_11106626 | Not Available | 677 | Open in IMG/M |
3300012209|Ga0137379_11772972 | Not Available | 512 | Open in IMG/M |
3300012211|Ga0137377_10231095 | Not Available | 1776 | Open in IMG/M |
3300012351|Ga0137386_11236030 | Not Available | 521 | Open in IMG/M |
3300012356|Ga0137371_10457937 | Not Available | 987 | Open in IMG/M |
3300012359|Ga0137385_11143951 | Not Available | 639 | Open in IMG/M |
3300012359|Ga0137385_11251489 | Not Available | 604 | Open in IMG/M |
3300012951|Ga0164300_10010836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2859 | Open in IMG/M |
3300012951|Ga0164300_10011700 | Not Available | 2789 | Open in IMG/M |
3300012955|Ga0164298_10835803 | Not Available | 663 | Open in IMG/M |
3300012955|Ga0164298_11055279 | Not Available | 605 | Open in IMG/M |
3300012957|Ga0164303_10001827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 5958 | Open in IMG/M |
3300012957|Ga0164303_10454568 | Not Available | 807 | Open in IMG/M |
3300012957|Ga0164303_10521656 | Not Available | 765 | Open in IMG/M |
3300012957|Ga0164303_11146247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 565 | Open in IMG/M |
3300012957|Ga0164303_11479565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Virgisporangium → Virgisporangium ochraceum | 512 | Open in IMG/M |
3300012958|Ga0164299_10660708 | Not Available | 725 | Open in IMG/M |
3300012960|Ga0164301_10090743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1723 | Open in IMG/M |
3300012960|Ga0164301_10234801 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
3300012960|Ga0164301_10873869 | Not Available | 695 | Open in IMG/M |
3300012960|Ga0164301_10997130 | Not Available | 658 | Open in IMG/M |
3300012961|Ga0164302_10014098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3259 | Open in IMG/M |
3300012961|Ga0164302_10014098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3259 | Open in IMG/M |
3300012961|Ga0164302_10446354 | Not Available | 897 | Open in IMG/M |
3300012961|Ga0164302_10718476 | Not Available | 743 | Open in IMG/M |
3300012975|Ga0134110_10431132 | Not Available | 590 | Open in IMG/M |
3300012984|Ga0164309_10289655 | Not Available | 1175 | Open in IMG/M |
3300012984|Ga0164309_10642406 | Not Available | 834 | Open in IMG/M |
3300012984|Ga0164309_10914129 | Not Available | 716 | Open in IMG/M |
3300012985|Ga0164308_10646439 | Not Available | 905 | Open in IMG/M |
3300012985|Ga0164308_10862964 | Not Available | 794 | Open in IMG/M |
3300012986|Ga0164304_11752152 | Not Available | 519 | Open in IMG/M |
3300012987|Ga0164307_10259008 | Not Available | 1218 | Open in IMG/M |
3300012988|Ga0164306_10116684 | Not Available | 1770 | Open in IMG/M |
3300012988|Ga0164306_10454887 | Not Available | 975 | Open in IMG/M |
3300012988|Ga0164306_11922132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
3300012989|Ga0164305_10291749 | Not Available | 1201 | Open in IMG/M |
3300013296|Ga0157374_10306509 | Not Available | 1572 | Open in IMG/M |
3300013297|Ga0157378_11191791 | Not Available | 801 | Open in IMG/M |
3300013763|Ga0120179_1007093 | All Organisms → cellular organisms → Bacteria | 3044 | Open in IMG/M |
3300014968|Ga0157379_12293199 | Not Available | 537 | Open in IMG/M |
3300014969|Ga0157376_11234261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 776 | Open in IMG/M |
3300014969|Ga0157376_12419255 | Not Available | 565 | Open in IMG/M |
3300015374|Ga0132255_101131880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1177 | Open in IMG/M |
3300015374|Ga0132255_101326422 | Not Available | 1086 | Open in IMG/M |
3300018433|Ga0066667_11162644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 670 | Open in IMG/M |
3300018433|Ga0066667_12035303 | Not Available | 529 | Open in IMG/M |
3300018468|Ga0066662_10540037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1074 | Open in IMG/M |
3300019361|Ga0173482_10176896 | Not Available | 855 | Open in IMG/M |
3300019361|Ga0173482_10584003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 558 | Open in IMG/M |
3300020075|Ga0206349_1391427 | Not Available | 1078 | Open in IMG/M |
3300020080|Ga0206350_10835087 | Not Available | 639 | Open in IMG/M |
3300021560|Ga0126371_11723814 | Not Available | 750 | Open in IMG/M |
3300022467|Ga0224712_10331393 | Not Available | 717 | Open in IMG/M |
3300023077|Ga0247802_1069053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 582 | Open in IMG/M |
3300024055|Ga0247794_10075204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 968 | Open in IMG/M |
3300025900|Ga0207710_10668663 | Not Available | 544 | Open in IMG/M |
3300025915|Ga0207693_10448160 | Not Available | 1008 | Open in IMG/M |
3300025917|Ga0207660_11119296 | Not Available | 641 | Open in IMG/M |
3300025922|Ga0207646_10001396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 29960 | Open in IMG/M |
3300025927|Ga0207687_10074152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2438 | Open in IMG/M |
3300025928|Ga0207700_10064139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella mangrovi | 2797 | Open in IMG/M |
3300025929|Ga0207664_10052412 | Not Available | 3226 | Open in IMG/M |
3300025929|Ga0207664_10722426 | Not Available | 896 | Open in IMG/M |
3300025929|Ga0207664_11087480 | Not Available | 715 | Open in IMG/M |
3300025939|Ga0207665_10372857 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
3300025941|Ga0207711_11609815 | Not Available | 593 | Open in IMG/M |
3300026008|Ga0208529_1016744 | Not Available | 678 | Open in IMG/M |
3300026095|Ga0207676_10199738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1766 | Open in IMG/M |
3300026142|Ga0207698_11735941 | Not Available | 639 | Open in IMG/M |
3300026325|Ga0209152_10328013 | Not Available | 579 | Open in IMG/M |
3300027821|Ga0209811_10139814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 892 | Open in IMG/M |
3300027894|Ga0209068_10285340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 924 | Open in IMG/M |
3300028881|Ga0307277_10186631 | Not Available | 906 | Open in IMG/M |
3300031910|Ga0306923_12437779 | Not Available | 518 | Open in IMG/M |
3300032892|Ga0335081_12615342 | Not Available | 518 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.60% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.88% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.30% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 6.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.65% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.65% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 4.07% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.49% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.33% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 2.33% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.33% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.33% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.33% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.91% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.91% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.91% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.74% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.74% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.16% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.16% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.16% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.16% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.16% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.16% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.16% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.16% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.16% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.58% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.58% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.58% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.58% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.58% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.58% |
Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.58% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
2189573003 | Grass soil microbial communities from Rothamsted Park, UK - FE2 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011994 | Permafrost microbial communities from Nunavut, Canada - A7_65cm_12M | Environmental | Open in IMG/M |
3300011996 | Permafrost microbial communities from Nunavut, Canada - A39_65cm_12M | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6 | Environmental | Open in IMG/M |
3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026008 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202 (SPAdes) | Environmental | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
cont_0108.00004580 | 2166559005 | Simulated | EVLYGNGRRFRVLDVVPFEEEDESPFVGLLQVEAA |
E1_02168130 | 2170459002 | Grass Soil | MLIKPGEEIIAGSNQRFRVLDVVPFEEDAESPFVGLLQVEAA |
E4A_08351300 | 2170459003 | Grass Soil | MIHAGEEIHLGAGQRFRVIDVVPFKEEDESPFVGLLQVEAAY |
FA3_00069410 | 2170459023 | Grass Soil | MIQPGEEILLGAGRTFRVLDVVPFEEDESSFVGLLQVEAVSV |
N55_02069280 | 2189573000 | Grass Soil | MIQPGEEIIAGNAQHFRVLDLVPFAEEDESPFVGLLQVEVA |
FD2_04168740 | 2189573001 | Grass Soil | MMIKPAEEIIAGINQRFRVLDVVPFEEEDESPFVGMLQVEVA |
FE1_07772420 | 2189573002 | Grass Soil | MMIKPEEILLGAGRRFRVLTVVPFEEEDESPFVGLLRVDTA |
FE2_07756540 | 2189573003 | Grass Soil | VQLVELPVAMMIKPGEEIQFGGGRRFRVLDVLTFEEEDESPLVGLLQVEAA |
JGI10216J12902_1006710971 | 3300000956 | Soil | MDPPPDEEIIAGNNQRFCVLHVGPFDEEDESPFVGLLQVEAA* |
JGI10216J12902_1146029201 | 3300000956 | Soil | MRARQPTQVMIHPGQEILFDNGRRFPVLAVVPFEEEDESPFVGLLQ |
A3PFW1_105331751 | 3300001535 | Permafrost | ATYAVMIKPGEEILFGAGRRFRVLVVVPFGEEDDSPFVGLLQVEAA* |
A3PFW1_106150841 | 3300001535 | Permafrost | MITPREEILVGNGRRFRVLALVPVDDEESRFVGLLQVEAA* |
A1565W1_100362621 | 3300001536 | Permafrost | TYAIMIQPGEEILFGKADASAVLDVVPFEEEESPFVGLLQVEAV* |
A1565W1_100838134 | 3300001536 | Permafrost | VIVKPGEEILVGNGRRFRVLDVVAFEEEDESPFVGLLKVEAA* |
C688J35102_1189037851 | 3300002568 | Soil | QMIHLGDEIHLGAGQRFRVLDVVPFEEEDSPFVGLLQVEPA* |
C688J35102_1209492242 | 3300002568 | Soil | MIHLGHEIHVGAGQRFRVLAVVPFEEEDESPFVGLLQVEAARDS* |
Ga0062593_1005782793 | 3300004114 | Soil | MRARQPTQVMIHPGQEILVGNGRRFRVLDVVPFEDEDESPFVGLLKVEAA* |
Ga0062589_1002062032 | 3300004156 | Soil | MMIQPGEEILLGPGQRFRVVDLVPFGEEDESPFVGLLQVARPAPE* |
Ga0062589_1009293861 | 3300004156 | Soil | GEATYAMMIQPGGEIHGSGGQRLRVLDVPMFDEEDESPFVGLLQVEAT* |
Ga0062590_1004928891 | 3300004157 | Soil | DLGEATYAMMIQPGGEIHGSGGQRLRVLDVPMFDEEDESPFVGLLQVEAT* |
Ga0062590_1006667593 | 3300004157 | Soil | RPREEILVGNGRRFRVVDVVPFEEEDESPLVGMLKVEVA* |
Ga0062590_1019097061 | 3300004157 | Soil | MIDRGEEIIAGKNEHFRVVDVVPFEEEDESPFVGLLQVEAV* |
Ga0062595_1000899513 | 3300004479 | Soil | VIHIGDEIHLGAGQRFRVLDVVPFDEEDESPFVGLLQIEAA* |
Ga0062595_1005713471 | 3300004479 | Soil | MIHPDEEIVAGDDQHFRVLDVVPFEEEDESPFVGLLQVEAA* |
Ga0062595_1013356351 | 3300004479 | Soil | VTYAALIRPGEEILVGNGRRFHVLDVVPFDEEDESTFVRLLQVEAALAGL* |
Ga0062592_1013700771 | 3300004480 | Soil | MMIHPGEEILLGPGQRFRVVDLVPFGEEDESPFVGLLQVERPAPE* |
Ga0062592_1024313301 | 3300004480 | Soil | MIQPGEEIHLGAGQRFRVLDLVPFEEKDESPFVGLLRVEAA* |
Ga0062591_1000326554 | 3300004643 | Soil | MMIQPGEEILLGPGQRFRVVDLVPFGEEDESPFVGLLQVERPAPE* |
Ga0066688_109408451 | 3300005178 | Soil | MIKPGEEILVGSGRRFRVLDVVPFEEEDELPSIGLLQVEAA* |
Ga0066671_102937142 | 3300005184 | Soil | MIHPGDEVYVRAAERFRVLDVVPFEEEDESPFVGLLQVEAA* |
Ga0066388_1031139541 | 3300005332 | Tropical Forest Soil | EATYALMIKPGEEIIGEGTDWFRVIDVVPFDEEDESPFVGC* |
Ga0066388_1052318612 | 3300005332 | Tropical Forest Soil | EATYALMIKPGEEIIGEGTDWFRVIDVVPFDEEDESPFVGVLTVEAA* |
Ga0070682_1003162782 | 3300005337 | Corn Rhizosphere | VIKPGEEIHLGAGQRFRVIDVVPFEEQDASPFVGLLQVEAA* |
Ga0070682_1018797011 | 3300005337 | Corn Rhizosphere | MIRPGEEIHLGAGQRFRVVDVVPFEEEDESPFVGLLQVAAA* |
Ga0070709_100099555 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MGPRGRRIIAGNNQRFRVLHVVPFDEEDKSPFVGLPQVEAA* |
Ga0070709_100356536 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MMIKPGEEIPSGAGQRFRVIDVVAFEEEDESQFVGLLRVEAA* |
Ga0070709_103071252 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MIYPGEEIIAGDNEHFRVLELVPIEEEDESPFVGLLQVEAA* |
Ga0070709_103303221 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | RPGEEIHLGAGQRFRVVDVVPFEEEDESPFVGLLQVAAA* |
Ga0070709_106720782 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MMIKPGEEIHLGAGQRFRILDVVPFDEADESPFVGLLQVEAAYVRSAARET* |
Ga0070714_1007242481 | 3300005435 | Agricultural Soil | VTYAVLVKPGEEILVVNGRRFRVLDVVPFDGEDESPFVGLIKVEAA* |
Ga0070714_1016857852 | 3300005435 | Agricultural Soil | EDAPLVRIREELFFGGGRRFRIVDVVIFEEEDGSPFVGLLKVEAA* |
Ga0070711_1000225726 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MMIKPGEESTSGAGQRFRVIDVVAFEEEDESQFVGLLRVEAA* |
Ga0070711_1000934804 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MMIKPGEEIHLGTGQRFRVLDVVPFEDESPFVGLSQVEPA* |
Ga0070741_113503542 | 3300005529 | Surface Soil | EASYIQQIKPGEEILYGNGRRFRVLDIAPFDEEDESRFVAMLKVEAT* |
Ga0070684_1012414611 | 3300005535 | Corn Rhizosphere | MDQPPDEEIIAGNNQRFRVLHVVPFDEEDESPFVGLLQVEA |
Ga0066695_103074271 | 3300005553 | Soil | MIGPGDEIYLGAGQRFRVLDVVPFNEEDESPFVGLLRVEAA* |
Ga0068856_1026905171 | 3300005614 | Corn Rhizosphere | NAMMIKPGEEIHGNGGQGLRVVAVVPFEEEDESPFVGLLQVDAA* |
Ga0066903_1005571973 | 3300005764 | Tropical Forest Soil | MMIKQGEENIAGSAEHFHVVSVVPFEEEDESPFVRC* |
Ga0066903_1007251011 | 3300005764 | Tropical Forest Soil | EATYAQMIKPGEEIIGDGNQHFLVVDVVPFAEEDESEFVGMLKVETA* |
Ga0066903_1008763084 | 3300005764 | Tropical Forest Soil | MMIKPGEEIPLDAGQRFRVVAVVPFEEEDESPFVGMLKVEAA* |
Ga0066903_1009816812 | 3300005764 | Tropical Forest Soil | MLIKPGEEILFGGVRCFRVLDVVPFEENDELGFVGMLTVEAA* |
Ga0066903_1012622612 | 3300005764 | Tropical Forest Soil | MIKPGEEIHLAAGQRFGVLAVVPFDEEEAPPFVG* |
Ga0066903_1031913082 | 3300005764 | Tropical Forest Soil | MQIKPDEEIHLGGGQTFRVLDVVSFEEADELGFVGMLKVEAA* |
Ga0066652_1003398304 | 3300006046 | Soil | MIHPDEEIIARDNQHFPVIDVVPFGDDESPSVGMLKVENA* |
Ga0075017_1000412174 | 3300006059 | Watersheds | MMIKPGEEILLGAGQRFRVLDLVPFDGDESPFVGLLKIESI* |
Ga0075017_1005249441 | 3300006059 | Watersheds | AMMIKPGEEIHLGSGQRFCVVDVVLFGEGDELPFVGLLQVEAA* |
Ga0075017_1012376002 | 3300006059 | Watersheds | MVKPGEEILVGNGRRFRVLDVVPFEEEDSRILRLLKVEAA* |
Ga0075015_1006243042 | 3300006102 | Watersheds | MMIKPGEEILLGAGQRFRVLDLVPFDGDESPFVGLLKIESV* |
Ga0070715_101383301 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKPGEGIHLGAGERFRVLDVVAFGEEDGSPFVGLLQVEAV* |
Ga0070716_1000986725 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MMIKPGEETTSGAGQRFRVIDVVAFEEEDESQFVGLLRVEAA* |
Ga0070712_1005289762 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MIHPGEEIIAGGNQHFRVVDVVMFADEDDSPFVGLLQLEAA* |
Ga0070712_1008345152 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LGEATYLSQIRLGEEILFGNGRRLRVVDVVAFDEHEESAYVGMLKVEAA* |
Ga0070712_1014458421 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | KPGEEIIAGDNRRFRVVDVVPFGEEEESPFVAMRKVDAA* |
Ga0066660_114132081 | 3300006800 | Soil | MMIHPGEEIIAGHNQRFRVLAVVPFVKDESPFVGLLQVQAA* |
Ga0075434_1000627525 | 3300006871 | Populus Rhizosphere | MIHLGDEIHLVAGQRFRGVDVVEFDEEDEWPLIGLLQVEATSS* |
Ga0066710_1032813552 | 3300009012 | Grasslands Soil | MIRPGEEILVGNGRLCRVLDLVSIDEEDSPFVGLLQVEAI |
Ga0105245_122034021 | 3300009098 | Miscanthus Rhizosphere | IKPGEEIHLGAGQRFRVLDVVPFDEEDESPFVGLLQIEAA* |
Ga0066709_1002635774 | 3300009137 | Grasslands Soil | MIHPGDEIHLGAGQRFRVLDVVPFEEEDESPFIGLLQVEAAA* |
Ga0105241_119856801 | 3300009174 | Corn Rhizosphere | MIDRGEEIIAGKNEHFRVVDVVPFEEEDESPFVGLLQVEARLPRVRQ* |
Ga0105248_125246611 | 3300009177 | Switchgrass Rhizosphere | EEIQGNGGQRLRVLAVGPFDEEDESPFVGLLPAEAV* |
Ga0105249_128421981 | 3300009553 | Switchgrass Rhizosphere | GEEIIAGKNEHFRVVDVVPFEEEDESPFVGLLQVEAV* |
Ga0127503_107030562 | 3300010154 | Soil | MIKPGEEIIAGKNEHFRVVAVIPFGEEDESPFVGLLRVEAA* |
Ga0127503_109943242 | 3300010154 | Soil | MEEVAGRAILVGNGRHFRVLAVIPFAEEDESRFVGLLQVEAA* |
Ga0134067_102113482 | 3300010321 | Grasslands Soil | MIKPGEEIIAGANERFQVVDVPFEEEDKSPFVGLLQVEAAWRDWSILLLF |
Ga0126372_102782902 | 3300010360 | Tropical Forest Soil | MIQPGDEVHVGNGRRFRVLDVVLSEEEDESPFVGLLKVETA* |
Ga0126377_127678371 | 3300010362 | Tropical Forest Soil | LRLHAGEEIIADKNQHFRVVAVVPFEGTDELGFVGMLRVESAQT* |
Ga0126379_135167261 | 3300010366 | Tropical Forest Soil | MQIKPGEEIIGEGTQWFRVVDVVPFDEEDESPFVGVLTVEAR* |
Ga0134128_110281361 | 3300010373 | Terrestrial Soil | KRPTRSVIKPGEEIHLGAGQRFRVIDVVPFEEQDASPFAGLLQVEAA* |
Ga0134128_117130612 | 3300010373 | Terrestrial Soil | MMIKPGEEIHLGAGQRFRVVDVVPFEEEDESPFVGL |
Ga0134128_128709812 | 3300010373 | Terrestrial Soil | MGPRGRRIIAGNNQRFRVLHVVPFDEEDKSPFVGLLQVGAT* |
Ga0105239_126825621 | 3300010375 | Corn Rhizosphere | MIEAIHLAADQGFRVIDVIPLDVEDESPFVGLLQVEAA* |
Ga0126383_115997522 | 3300010398 | Tropical Forest Soil | MMIQPGEEIIADKNQHFRVVDAVLFDEEDESQFVGLLKVEAA* |
Ga0134121_103714872 | 3300010401 | Terrestrial Soil | VIKPGEEIHLVAGQRFRVIDVVPFEEQDASPFVGLLQVEAA* |
Ga0120157_10528222 | 3300011994 | Permafrost | MITPREEILVGNGRRFRVLALVPVDDEESRFVGLLQV* |
Ga0120156_11026412 | 3300011996 | Permafrost | VKPGEEILVGNGRRFRVLDVVAFEEEDESPFVGLLRVEAA* |
Ga0137383_105469621 | 3300012199 | Vadose Zone Soil | AMMIKTGEEIIAGTNERFRVLDVVPFEEEDESPFVGLLKVEAA* |
Ga0137383_113639772 | 3300012199 | Vadose Zone Soil | RVSAPGHEILAGGGRRFRVIDVVPFDEEDESPFVGLLQVEAA* |
Ga0137382_103051281 | 3300012200 | Vadose Zone Soil | PGEEIIFVNGRRFRILAVSPFEEEDESPFVGLLQVEAA* |
Ga0137382_109748623 | 3300012200 | Vadose Zone Soil | RFLNPILVVGNGRRFRVLAVVPFEDEDESQFVELLQVEAA* |
Ga0137365_107709381 | 3300012201 | Vadose Zone Soil | LVKPGEEILVGNGRRFRVLDVVPFDEEDESAFVGLLKVEAA* |
Ga0137365_108886462 | 3300012201 | Vadose Zone Soil | MMIKPGEETHGSGGQRLRVLDVVPFDEEDESPFVGPLQIEAA* |
Ga0137380_102356232 | 3300012206 | Vadose Zone Soil | MKIHPGEEVLLGASRRFRVLDFVPFEEEGESSLVGLLQVEAM* |
Ga0137381_109018351 | 3300012207 | Vadose Zone Soil | EILGGDGRRFRVIDVGPFDEEDESPFVGLLQVEAA* |
Ga0137376_110193401 | 3300012208 | Vadose Zone Soil | MMIRPGEEILFGNGRRFRVLAVVPFVEDESPFVGLLQVQAA* |
Ga0137376_111066261 | 3300012208 | Vadose Zone Soil | VIHPGEKIHLGAGQRFRVLDVVPFEEEDESLLVGLLKVEAA* |
Ga0137379_117729722 | 3300012209 | Vadose Zone Soil | MIHPGEEIIAKGNEHFQVVDVVPFEEEDSPFVGLLQVEAA* |
Ga0137377_102310952 | 3300012211 | Vadose Zone Soil | GEATYAVMIRPGEEILVGNGRRFRVLDLVSIDEEDSPFVGLLQVEAT* |
Ga0137386_112360301 | 3300012351 | Vadose Zone Soil | MIHPGDEIHLGAGRRFRVLDVVPFEEEGESPFVGLLQ |
Ga0137371_104579372 | 3300012356 | Vadose Zone Soil | MMIKPGEETHGSGGQRLRVLDVVPFDDEDESPFVRLLQVVEV* |
Ga0137385_111439512 | 3300012359 | Vadose Zone Soil | MIKPVEEIVAGDDRRFRVLDVVPFEEEDESAFVELLRVEVA* |
Ga0137385_112514892 | 3300012359 | Vadose Zone Soil | LSPGEEIFVGNGRRLRVLAVVPFSEKDESPFVGLLQVEAV* |
Ga0164300_100108361 | 3300012951 | Soil | STSGAGQRFRVIDVVAFEEEDESQFVGLLRVEAA* |
Ga0164300_100117007 | 3300012951 | Soil | VIKPGEEIHLGAGQRFRVIDVVPLEEQDASPFVGLLQVEAA* |
Ga0164298_108358031 | 3300012955 | Soil | GEATYAQMIHVGDEIHVGAGQRFRVLDIVTFDEEDESPFVGMLKVEVA* |
Ga0164298_110552791 | 3300012955 | Soil | MTIRAGEEIHGSGGQPLRAVDVVPCEEEHESPFVGLLQVETT* |
Ga0164303_1000182710 | 3300012957 | Soil | MGPRGRRIIAGNNQRFRVLHVAPFDEEDKSPFVGLLQVEAA* |
Ga0164303_104545681 | 3300012957 | Soil | MIKPGEEILLGGGQHFRVLYVVAFHEEDESPFVGMLKVEAA* |
Ga0164303_105216562 | 3300012957 | Soil | IKPGEEILFGNGRRFRVLDVVPFEEEDESPFVGLLRVEAA* |
Ga0164303_111462471 | 3300012957 | Soil | EATYAQMINPGDEVHVGAGQRFRVIDVVAFEEEDESPFVGLLQVEAA* |
Ga0164303_114795651 | 3300012957 | Soil | MIHLGDEIHLNAGQRFRVVDVVEFEEEDESPFVGLL |
Ga0164299_106607082 | 3300012958 | Soil | MMIKPGEEIHLGAGQRFRILGVVPFDEADESPFVGLLQVEAAYVR* |
Ga0164301_100907431 | 3300012960 | Soil | VIKPGEEIHLGAGQRFRVIDAVPFEEQDASPFVGLLQVEAA* |
Ga0164301_102348013 | 3300012960 | Soil | MIKPGEEIHLGAGQRFRILDVVPFDEADESPFVGLL |
Ga0164301_108738692 | 3300012960 | Soil | MGPPGRRIIAGNNQRFRVLHVAPFDEEDKSPFVGLLQVEAA* |
Ga0164301_109971302 | 3300012960 | Soil | MTIRAGEEIHGSGGQRLRVVDVVPFEEEDESPFVGLLQVETT* |
Ga0164302_100140981 | 3300012961 | Soil | MGPPGRRIIAGNNQRFRVLHVVPFDEEDKSPFVGLPQVEAA* |
Ga0164302_100140985 | 3300012961 | Soil | VIKPGEEIHLVAGQRFRVIDVVPFEEQDASPFGGLLQVEAA* |
Ga0164302_104463542 | 3300012961 | Soil | MIHTGDEIHLSAGQRFRVLDVVTFDEEDESPFVGLLQVEAA* |
Ga0164302_107184761 | 3300012961 | Soil | KVGEEILVGNGRRFRVLDVVPFEEEDESPFVGMLKVEVA* |
Ga0134110_104311321 | 3300012975 | Grasslands Soil | MMIKPGEEIIAGANERFQVVDVPFEEEDKSPFVGLLQ |
Ga0164309_102896552 | 3300012984 | Soil | MGPPGRRIIAGNNLRFRVLHVVPFDEEDKSPFVGLLQVEAA* |
Ga0164309_106424062 | 3300012984 | Soil | MMIKPGEEIHLGAGQRFRILDVVPFDEADESPFVGLLQVEAAYVR* |
Ga0164309_109141291 | 3300012984 | Soil | MIKPGEEILLGGGQHFRVLDVVAFDEEDESPFVGMLKVEAA* |
Ga0164308_106464393 | 3300012985 | Soil | MGPPGRRIIAGNNQRFRVLHVAPFDEEDKSPFVGLLRVEAADA |
Ga0164308_108629641 | 3300012985 | Soil | TYAMMIKPGEEIHLGAGQRFRILDVVPFDEADESPFVGLLQVEAAYVR* |
Ga0164304_117521521 | 3300012986 | Soil | LGEATYAMMIKPGEEILYGNGRRFRVLDVVPFEEDDQSPFVGLLQVEAA* |
Ga0164307_102590082 | 3300012987 | Soil | MIKPGEEILLGGGQHFRVLYVVAFDEEDESPFVGMLKVEAA* |
Ga0164306_101166844 | 3300012988 | Soil | VIKPGEEIHLGAGQRFRVIDVVPFEEQDASPFVGL |
Ga0164306_104548871 | 3300012988 | Soil | TYAQMIHVGDEIHVGAGQRFRVLDIVPFDEEDESPFVGMLKVEVA* |
Ga0164306_119221322 | 3300012988 | Soil | LGEATYAMMIKPDEEIHLGAGKRFRVLDVVAFEEEDESPFVGLLQVEAA* |
Ga0164305_102917491 | 3300012989 | Soil | VTYAVLVKPGEEILVVNGRRFRVLDVVPFDGEDESPFVGLLKVEAA* |
Ga0157374_103065091 | 3300013296 | Miscanthus Rhizosphere | MIHPGEKILLGAGRRCRVLDVVPFDEEDESPFVDRL |
Ga0157378_111917911 | 3300013297 | Miscanthus Rhizosphere | MIDRGEEIIAGKNEHFRVVDVVPFEEADESPFVGLLQVEAV* |
Ga0120179_10070933 | 3300013763 | Permafrost | LVKPGETIITGAGRKLRVLAVVPIEEDSPFVGLLQAEAA* |
Ga0157379_122931991 | 3300014968 | Switchgrass Rhizosphere | DLGEATYAMMIKPGEEIHLGTGQRFRVLDVVPFEDESPFVGLSQVEPA* |
Ga0157376_112342612 | 3300014969 | Miscanthus Rhizosphere | MIHLGDEIHLGAGQRFRVIDVVAFEEEDESPFVGLLRVEAA* |
Ga0157376_124192552 | 3300014969 | Miscanthus Rhizosphere | EEILLGAGRRFRVLDVVTFEEEDESQLVGLLQVEAA* |
Ga0132255_1011318802 | 3300015374 | Arabidopsis Rhizosphere | MDQPPDEEIIAGNNQRFRVLHVVPFDEEDESPFVGLLQVEAA* |
Ga0132255_1013264222 | 3300015374 | Arabidopsis Rhizosphere | VIERGEEIHLAAGERLRVLAVSPFDEEDESPFGELLQVEAA* |
Ga0066667_111626441 | 3300018433 | Grasslands Soil | MIHPGDEVYVRAAERFRVLDVVPFEEEDESPFVGLLQVEAA |
Ga0066667_120353031 | 3300018433 | Grasslands Soil | MMIHPGEEIIAGHNQRFRVLAVVPFVEDESPFVGLLQVQAA |
Ga0066662_105400372 | 3300018468 | Grasslands Soil | MMIKPGEEIIAGTNELFRVLGVVPFEEEDESPSSGCSRS |
Ga0173482_101768962 | 3300019361 | Soil | MIDRGEEIIAGKNEHFRVVDVVPFEEEDESPFVGLLQVEAV |
Ga0173482_105840032 | 3300019361 | Soil | QPGEEILLGPGQRFRVVDLVPFGEEDESPFVGLLQVARPAPE |
Ga0206349_13914272 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | MDQPPDEEIIAGNNQRFRVLHVVPFDEEDESPFVGLLQVEAV |
Ga0206350_108350872 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | MDPPPDEEIIAGNNQRFRVLHVVPFDEEDESPFVGLLQVEAA |
Ga0126371_108954312 | 3300021560 | Tropical Forest Soil | MIHADEEIIANGNKRFRVVDVVPLEEADELGFVGMLRVEAA |
Ga0126371_117238143 | 3300021560 | Tropical Forest Soil | KPGEEIHVSGGQRMRVLDVVPFEEEDESPFVGLPQVEVV |
Ga0224712_103313932 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MDQPPDEEIIAGNNQRFRVLHVVPFDEEDESPFVGLLQVEAA |
Ga0247802_10690531 | 3300023077 | Soil | TYAQMIHLGDEIHLGAGQRFRVLDVVPFDEEDESPFVGLLQVEAT |
Ga0247794_100752041 | 3300024055 | Soil | VRPREEILVGNGRRFRVVDVVPFEEEDESPLVGMLKVEVA |
Ga0207710_106686631 | 3300025900 | Switchgrass Rhizosphere | KPGEEIIAGSNQHYRVVDLVEFDEEEDALFVGLLQVEAA |
Ga0207693_104481602 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MIHPGEEIIAGGNQHFRVVDVVMFADEDDSPFVGLLQLEAA |
Ga0207663_101851772 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MIYPGEEIIAGDNEHFRVLELVPIEEEDKSPFVGLLQVEAA |
Ga0207660_111192962 | 3300025917 | Corn Rhizosphere | MIHPDEEIIAGRNERYRVLDVGPVEEEHESFVGLLQVEAA |
Ga0207646_1000139623 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LNPSLIGNGRRFRVLDVVPFEEESPFVRLLVVEAA |
Ga0207687_100741522 | 3300025927 | Miscanthus Rhizosphere | MIDRGEEIIAGKNEHFRVVDVVQFDEEDESPFVGLLQVEAV |
Ga0207700_100641396 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VTWKPGDEIFVGPGKRLKVLDVVPVEEEDSPYRGLLKVEAA |
Ga0207664_100524125 | 3300025929 | Agricultural Soil | MINPGEEIIGGQNEHFRVFDEEDESPFVGLLRVEEA |
Ga0207664_107224262 | 3300025929 | Agricultural Soil | VLVKPGEEILVVNGRRFRVLDVVPFDGEDESPFVGLIKVEAA |
Ga0207664_110874801 | 3300025929 | Agricultural Soil | SRAGGEEIIAGNNQHFRVVDVVPFDEEDELPVVGQLQVEAA |
Ga0207665_103728571 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MMIKPGEEIHLGAGQRFHILDVVPFDEADESPFVGLLQ |
Ga0207711_116098151 | 3300025941 | Switchgrass Rhizosphere | EEIQGNGGQRLRVLAVGPFDEEDESPFVGLLPAEAV |
Ga0208529_10167442 | 3300026008 | Rice Paddy Soil | VAWKRKEIFLDNGRRLRVLDVVPFEEEDESPFVGLLKVEAT |
Ga0207676_101997381 | 3300026095 | Switchgrass Rhizosphere | MIHLGDEIHLGAGQRFRVIDVVAFEEEDESPFVGLLQVEAV |
Ga0207698_117359412 | 3300026142 | Corn Rhizosphere | MIDRGEEIIAGKNEHFRVVDVVPFEEEDESPFVGLLQVEAE |
Ga0209152_103280132 | 3300026325 | Soil | AMMIKPGEEIIAGSNQRFRVVDIVPFAEEDESPFVGLLQVEAA |
Ga0209811_101398142 | 3300027821 | Surface Soil | MMIKPGEEIHLGAGQRFRVIDVVPFEEQDASPFVGLLQVKAA |
Ga0209068_102853402 | 3300027894 | Watersheds | RREPGEEILLGAGQRFRVLDLVPFDGDESPFVGLLKIESI |
Ga0307277_101866312 | 3300028881 | Soil | VRPGEEILVGNGRRFRVLDVIPFEEEDESPFVGLLQVEAA |
Ga0306923_124377791 | 3300031910 | Soil | AGEEIIAGRAERFRVLDVVPFEEEDESPFVGLLRIEAA |
Ga0335081_126153421 | 3300032892 | Soil | KPGEEVLYGNGRRFRVIDVAPFAEEDESVFVAMLKVEAL |
⦗Top⦘ |