| Basic Information | |
|---|---|
| Family ID | F035520 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 172 |
| Average Sequence Length | 42 residues |
| Representative Sequence | AHPDDKGVCDGRAVLTRRVGQADVRLCAPCAVAQGVAEMPH |
| Number of Associated Samples | 153 |
| Number of Associated Scaffolds | 172 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 92.44 % |
| % of genes from short scaffolds (< 2000 bps) | 87.79 % |
| Associated GOLD sequencing projects | 148 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (64.535 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (39.535 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.326 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (37.791 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.84% β-sheet: 17.39% Coil/Unstructured: 63.77% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 172 Family Scaffolds |
|---|---|---|
| PF00756 | Esterase | 6.98 |
| PF04672 | Methyltransf_19 | 2.91 |
| PF02657 | SufE | 2.33 |
| PF00581 | Rhodanese | 2.33 |
| PF02909 | TetR_C_1 | 1.74 |
| PF01243 | Putative_PNPOx | 1.74 |
| PF12697 | Abhydrolase_6 | 1.74 |
| PF02746 | MR_MLE_N | 1.16 |
| PF02515 | CoA_transf_3 | 1.16 |
| PF13649 | Methyltransf_25 | 1.16 |
| PF03706 | LPG_synthase_TM | 1.16 |
| PF13671 | AAA_33 | 1.16 |
| PF08445 | FR47 | 1.16 |
| PF01385 | OrfB_IS605 | 0.58 |
| PF16113 | ECH_2 | 0.58 |
| PF01479 | S4 | 0.58 |
| PF11774 | Lsr2 | 0.58 |
| PF03704 | BTAD | 0.58 |
| PF01726 | LexA_DNA_bind | 0.58 |
| PF13508 | Acetyltransf_7 | 0.58 |
| PF07690 | MFS_1 | 0.58 |
| PF13188 | PAS_8 | 0.58 |
| PF13378 | MR_MLE_C | 0.58 |
| PF07920 | DUF1684 | 0.58 |
| PF08897 | DUF1841 | 0.58 |
| PF00300 | His_Phos_1 | 0.58 |
| PF07885 | Ion_trans_2 | 0.58 |
| PF13464 | DUF4115 | 0.58 |
| PF13385 | Laminin_G_3 | 0.58 |
| PF05746 | DALR_1 | 0.58 |
| PF04024 | PspC | 0.58 |
| PF04542 | Sigma70_r2 | 0.58 |
| PF00903 | Glyoxalase | 0.58 |
| PF00440 | TetR_N | 0.58 |
| PF12323 | HTH_OrfB_IS605 | 0.58 |
| PF01019 | G_glu_transpept | 0.58 |
| PF00108 | Thiolase_N | 0.58 |
| PF12680 | SnoaL_2 | 0.58 |
| PF13412 | HTH_24 | 0.58 |
| PF03551 | PadR | 0.58 |
| PF00196 | GerE | 0.58 |
| PF02627 | CMD | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 172 Family Scaffolds |
|---|---|---|---|
| COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 2.33 |
| COG2166 | Sulfur transfer protein SufE, Fe-S cluster assembly | Posttranslational modification, protein turnover, chaperones [O] | 2.33 |
| COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 1.74 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 1.16 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 1.16 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.58 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.58 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.58 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.58 |
| COG3358 | Uncharacterized conserved protein, DUF1684 family | Function unknown [S] | 0.58 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.58 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.58 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.58 |
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.58 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.58 |
| COG0751 | Glycyl-tRNA synthetase, beta subunit | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG0675 | Transposase | Mobilome: prophages, transposons [X] | 0.58 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.58 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.58 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.58 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.53 % |
| Unclassified | root | N/A | 35.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001661|JGI12053J15887_10197517 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10273052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 688 | Open in IMG/M |
| 3300005435|Ga0070714_101752534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 606 | Open in IMG/M |
| 3300005436|Ga0070713_101315030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 701 | Open in IMG/M |
| 3300005458|Ga0070681_10532144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1089 | Open in IMG/M |
| 3300005547|Ga0070693_100490550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 870 | Open in IMG/M |
| 3300005556|Ga0066707_10806930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 580 | Open in IMG/M |
| 3300005569|Ga0066705_10726695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 597 | Open in IMG/M |
| 3300005764|Ga0066903_100659890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1831 | Open in IMG/M |
| 3300005764|Ga0066903_106550880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 606 | Open in IMG/M |
| 3300006028|Ga0070717_11001977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 761 | Open in IMG/M |
| 3300006059|Ga0075017_100255284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1283 | Open in IMG/M |
| 3300006163|Ga0070715_10165475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1096 | Open in IMG/M |
| 3300006173|Ga0070716_101400001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 568 | Open in IMG/M |
| 3300006797|Ga0066659_10597140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 896 | Open in IMG/M |
| 3300006904|Ga0075424_102284967 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300007982|Ga0102924_1174738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia acaciae | 960 | Open in IMG/M |
| 3300009038|Ga0099829_10606123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 910 | Open in IMG/M |
| 3300009088|Ga0099830_10131327 | All Organisms → cellular organisms → Bacteria | 1907 | Open in IMG/M |
| 3300009143|Ga0099792_10282557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 978 | Open in IMG/M |
| 3300009162|Ga0075423_11463032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 732 | Open in IMG/M |
| 3300009698|Ga0116216_10462468 | Not Available | 768 | Open in IMG/M |
| 3300010046|Ga0126384_10326741 | Not Available | 1270 | Open in IMG/M |
| 3300010046|Ga0126384_11273373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 681 | Open in IMG/M |
| 3300010321|Ga0134067_10300520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 619 | Open in IMG/M |
| 3300010358|Ga0126370_11355191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 669 | Open in IMG/M |
| 3300010359|Ga0126376_11532803 | Not Available | 696 | Open in IMG/M |
| 3300010361|Ga0126378_11814163 | Not Available | 694 | Open in IMG/M |
| 3300010376|Ga0126381_101036673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1184 | Open in IMG/M |
| 3300010861|Ga0126349_1256536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 716 | Open in IMG/M |
| 3300010880|Ga0126350_10576772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 690 | Open in IMG/M |
| 3300011120|Ga0150983_16351862 | Not Available | 500 | Open in IMG/M |
| 3300011271|Ga0137393_10651656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 903 | Open in IMG/M |
| 3300012199|Ga0137383_10560994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 836 | Open in IMG/M |
| 3300012356|Ga0137371_10030579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4155 | Open in IMG/M |
| 3300012500|Ga0157314_1041543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
| 3300012944|Ga0137410_10141201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1826 | Open in IMG/M |
| 3300012986|Ga0164304_10935151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 681 | Open in IMG/M |
| 3300015245|Ga0137409_10557708 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300016341|Ga0182035_10892425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 784 | Open in IMG/M |
| 3300016357|Ga0182032_11928835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300016422|Ga0182039_10092223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2211 | Open in IMG/M |
| 3300016422|Ga0182039_12245110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 504 | Open in IMG/M |
| 3300016445|Ga0182038_10121696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1939 | Open in IMG/M |
| 3300017821|Ga0187812_1302966 | Not Available | 508 | Open in IMG/M |
| 3300017924|Ga0187820_1288567 | Not Available | 537 | Open in IMG/M |
| 3300017928|Ga0187806_1342725 | Not Available | 534 | Open in IMG/M |
| 3300017933|Ga0187801_10493396 | Not Available | 517 | Open in IMG/M |
| 3300017934|Ga0187803_10271593 | Not Available | 674 | Open in IMG/M |
| 3300017937|Ga0187809_10326447 | Not Available | 571 | Open in IMG/M |
| 3300017972|Ga0187781_10075429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2328 | Open in IMG/M |
| 3300017975|Ga0187782_10523939 | Not Available | 907 | Open in IMG/M |
| 3300018007|Ga0187805_10049697 | Not Available | 1885 | Open in IMG/M |
| 3300018037|Ga0187883_10630893 | Not Available | 557 | Open in IMG/M |
| 3300018085|Ga0187772_10331740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1048 | Open in IMG/M |
| 3300018468|Ga0066662_11863158 | Not Available | 629 | Open in IMG/M |
| 3300019879|Ga0193723_1145589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 639 | Open in IMG/M |
| 3300020002|Ga0193730_1010063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2670 | Open in IMG/M |
| 3300020069|Ga0197907_10585918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1978 | Open in IMG/M |
| 3300020069|Ga0197907_11155513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 621 | Open in IMG/M |
| 3300020070|Ga0206356_10573714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1779 | Open in IMG/M |
| 3300020082|Ga0206353_11454085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1069 | Open in IMG/M |
| 3300020580|Ga0210403_11248362 | Not Available | 570 | Open in IMG/M |
| 3300020583|Ga0210401_11207570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 615 | Open in IMG/M |
| 3300021171|Ga0210405_11091903 | Not Available | 597 | Open in IMG/M |
| 3300021374|Ga0213881_10006701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4734 | Open in IMG/M |
| 3300021403|Ga0210397_11113070 | Not Available | 614 | Open in IMG/M |
| 3300021405|Ga0210387_10643214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 941 | Open in IMG/M |
| 3300021405|Ga0210387_11022837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 723 | Open in IMG/M |
| 3300021406|Ga0210386_11257263 | Not Available | 624 | Open in IMG/M |
| 3300021432|Ga0210384_11516390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 576 | Open in IMG/M |
| 3300021474|Ga0210390_10218931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia acaciae | 1611 | Open in IMG/M |
| 3300021474|Ga0210390_11132531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 634 | Open in IMG/M |
| 3300021475|Ga0210392_11499733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 504 | Open in IMG/M |
| 3300021477|Ga0210398_10079411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2666 | Open in IMG/M |
| 3300021559|Ga0210409_10267862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1544 | Open in IMG/M |
| 3300022527|Ga0242664_1153671 | Not Available | 510 | Open in IMG/M |
| 3300022708|Ga0242670_1078674 | Not Available | 514 | Open in IMG/M |
| 3300022712|Ga0242653_1034330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 773 | Open in IMG/M |
| 3300022715|Ga0242678_1046277 | Not Available | 617 | Open in IMG/M |
| 3300024271|Ga0224564_1135439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 508 | Open in IMG/M |
| 3300025924|Ga0207694_10778222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 808 | Open in IMG/M |
| 3300025928|Ga0207700_10653579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 937 | Open in IMG/M |
| 3300025928|Ga0207700_10943744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 772 | Open in IMG/M |
| 3300025929|Ga0207664_10232964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1601 | Open in IMG/M |
| 3300025929|Ga0207664_10652954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 945 | Open in IMG/M |
| 3300025944|Ga0207661_11565565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 603 | Open in IMG/M |
| 3300026322|Ga0209687_1243111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
| 3300026475|Ga0257147_1029971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 781 | Open in IMG/M |
| 3300026547|Ga0209156_10134087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1208 | Open in IMG/M |
| 3300027895|Ga0209624_10387059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 932 | Open in IMG/M |
| 3300028715|Ga0307313_10058133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1142 | Open in IMG/M |
| 3300029951|Ga0311371_11142513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 907 | Open in IMG/M |
| 3300030056|Ga0302181_10247583 | Not Available | 807 | Open in IMG/M |
| 3300030058|Ga0302179_10436104 | Not Available | 576 | Open in IMG/M |
| 3300030531|Ga0210274_1520147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 594 | Open in IMG/M |
| 3300030548|Ga0210252_10677476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 561 | Open in IMG/M |
| 3300030630|Ga0210282_10337719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 543 | Open in IMG/M |
| 3300030677|Ga0302317_10392038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → unclassified Pseudonocardiaceae → Pseudonocardiaceae bacterium | 613 | Open in IMG/M |
| 3300030730|Ga0307482_1158401 | Not Available | 665 | Open in IMG/M |
| 3300030738|Ga0265462_10732822 | Not Available | 789 | Open in IMG/M |
| 3300030740|Ga0265460_12908923 | Not Available | 515 | Open in IMG/M |
| 3300030743|Ga0265461_14010304 | Not Available | 501 | Open in IMG/M |
| 3300030776|Ga0075396_1558867 | Not Available | 503 | Open in IMG/M |
| 3300031231|Ga0170824_101141996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 788 | Open in IMG/M |
| 3300031236|Ga0302324_102547852 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300031474|Ga0170818_113058234 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300031525|Ga0302326_11839770 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300031543|Ga0318516_10214272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1113 | Open in IMG/M |
| 3300031546|Ga0318538_10391689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 751 | Open in IMG/M |
| 3300031546|Ga0318538_10655368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 569 | Open in IMG/M |
| 3300031640|Ga0318555_10319856 | Not Available | 840 | Open in IMG/M |
| 3300031668|Ga0318542_10368265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 740 | Open in IMG/M |
| 3300031679|Ga0318561_10453235 | Not Available | 706 | Open in IMG/M |
| 3300031681|Ga0318572_10677024 | Not Available | 614 | Open in IMG/M |
| 3300031682|Ga0318560_10180218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1125 | Open in IMG/M |
| 3300031708|Ga0310686_106258184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 796 | Open in IMG/M |
| 3300031708|Ga0310686_113894337 | Not Available | 1233 | Open in IMG/M |
| 3300031713|Ga0318496_10402847 | Not Available | 756 | Open in IMG/M |
| 3300031715|Ga0307476_11250639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
| 3300031744|Ga0306918_10149209 | Not Available | 1724 | Open in IMG/M |
| 3300031747|Ga0318502_10953759 | Not Available | 522 | Open in IMG/M |
| 3300031748|Ga0318492_10412924 | Not Available | 710 | Open in IMG/M |
| 3300031748|Ga0318492_10658832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 560 | Open in IMG/M |
| 3300031751|Ga0318494_10165639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1250 | Open in IMG/M |
| 3300031751|Ga0318494_10966720 | Not Available | 500 | Open in IMG/M |
| 3300031764|Ga0318535_10326432 | Not Available | 686 | Open in IMG/M |
| 3300031768|Ga0318509_10614045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 605 | Open in IMG/M |
| 3300031770|Ga0318521_10166923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1257 | Open in IMG/M |
| 3300031779|Ga0318566_10268899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 844 | Open in IMG/M |
| 3300031782|Ga0318552_10022709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2804 | Open in IMG/M |
| 3300031796|Ga0318576_10578946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 529 | Open in IMG/M |
| 3300031819|Ga0318568_10326290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 954 | Open in IMG/M |
| 3300031819|Ga0318568_10933588 | Not Available | 536 | Open in IMG/M |
| 3300031835|Ga0318517_10227233 | Not Available | 842 | Open in IMG/M |
| 3300031845|Ga0318511_10325631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 697 | Open in IMG/M |
| 3300031879|Ga0306919_11105297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 604 | Open in IMG/M |
| 3300031894|Ga0318522_10080316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1190 | Open in IMG/M |
| 3300031894|Ga0318522_10168199 | Not Available | 828 | Open in IMG/M |
| 3300031896|Ga0318551_10299159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 905 | Open in IMG/M |
| 3300031897|Ga0318520_10645784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 659 | Open in IMG/M |
| 3300031910|Ga0306923_11279292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 779 | Open in IMG/M |
| 3300031941|Ga0310912_11081757 | Not Available | 613 | Open in IMG/M |
| 3300032008|Ga0318562_10637108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 615 | Open in IMG/M |
| 3300032010|Ga0318569_10559805 | Not Available | 532 | Open in IMG/M |
| 3300032059|Ga0318533_10914075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 644 | Open in IMG/M |
| 3300032063|Ga0318504_10103343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1278 | Open in IMG/M |
| 3300032064|Ga0318510_10220314 | Not Available | 772 | Open in IMG/M |
| 3300032068|Ga0318553_10012290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3801 | Open in IMG/M |
| 3300032089|Ga0318525_10483395 | Not Available | 634 | Open in IMG/M |
| 3300032089|Ga0318525_10644707 | Not Available | 539 | Open in IMG/M |
| 3300032180|Ga0307471_104155756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 511 | Open in IMG/M |
| 3300032770|Ga0335085_11561790 | Not Available | 685 | Open in IMG/M |
| 3300032782|Ga0335082_11070277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 672 | Open in IMG/M |
| 3300032896|Ga0335075_11225589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 648 | Open in IMG/M |
| 3300032896|Ga0335075_11418062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 584 | Open in IMG/M |
| 3300032896|Ga0335075_11465243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 571 | Open in IMG/M |
| 3300032954|Ga0335083_10281293 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
| 3300033289|Ga0310914_10537614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Haloechinothrix → Haloechinothrix halophila | 1056 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 39.53% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.65% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.07% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.07% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.49% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.49% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.49% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.91% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.74% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.74% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.16% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.16% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.16% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.16% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.16% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.58% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.58% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.58% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.58% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.58% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.58% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.58% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.58% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Host-Associated | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022708 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027110 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030531 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO038SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030548 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR016SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030630 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO115SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030776 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12053J15887_101975171 | 3300001661 | Forest Soil | DQGVCDGRAILTRRLGEANMPTCAPCAVAQGVAEMRH* |
| JGIcombinedJ51221_102730521 | 3300003505 | Forest Soil | PADTGVCDGRAVMTRKVGGSAVSLCAPCAVAQGVAEMKL* |
| Ga0070714_1017525342 | 3300005435 | Agricultural Soil | AHPDDKGVCDGRAVLTRRVGQADVRLCAPCAVAQGVAEMPH* |
| Ga0070713_1013150303 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | AGNWGTCQCPCGAAHPQDRNVCDGSAVLTRRFGEKDVPLCAPCAVATGVAEMPH* |
| Ga0070681_105321442 | 3300005458 | Corn Rhizosphere | ATAHPQDKGVCDGGAIMTRRVNGADLHLCAPCAVAQGVAEMRH* |
| Ga0070693_1004905501 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | PDDKGVCDGRAVLSRRVGQADVRMCAPCAVAQGVAEMPH* |
| Ga0066707_108069301 | 3300005556 | Soil | CRCECGTAHPDDKGVCDGRAVLTRRVGRADTRLCAPCAVAQGVAEMPH* |
| Ga0066705_107266951 | 3300005569 | Soil | KGVCDGRAVLTRRVGQADVRLCAPCAVAQGVAEMPH* |
| Ga0066903_1006598901 | 3300005764 | Tropical Forest Soil | PQDRNVCDGRAVLTRRLGKADLPVCAPCAVAQGVAEMRR* |
| Ga0066903_1065508802 | 3300005764 | Tropical Forest Soil | TAHPQDRNVCDGRAVLTRRLGKADLPVCAPCAVAQGVAEMRR* |
| Ga0070717_110019771 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RCQCGTAHPDDKGVCDGRAVLTRRVGQADMRLCAPCAVAQGVAEMPH* |
| Ga0075017_1002552843 | 3300006059 | Watersheds | DSGVCDGSAVLTRRLGDADISLCAPCAVAQGVAEFPR* |
| Ga0070715_101654751 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | TAHPDDKGVCDGRAVLTRRVGTADTRLCAPCAVAQGVAEMPH* |
| Ga0070716_1014000011 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | CDGKAVLSRRIASADVSLCAPCAVAQGVAEFPRGPR* |
| Ga0066659_105971402 | 3300006797 | Soil | LSGDWHACRCECGTAHPDDKGVCDGRAVLTRRVGRADTRLCAPCAVAQGVAEMPH* |
| Ga0075424_1022849671 | 3300006904 | Populus Rhizosphere | DDKGVCDGRAVLTRRVGQADMRLCAPCAVAQGVAEMRH* |
| Ga0102924_11747383 | 3300007982 | Iron-Sulfur Acid Spring | GVCDGKAVMTRRLGEADVSLCAPCAVAQGVAEFSG* |
| Ga0099829_106061231 | 3300009038 | Vadose Zone Soil | PDDLGVCDGRAVMTRQLGDADVRLCAPCAVAQGVAEMAR* |
| Ga0099830_101313273 | 3300009088 | Vadose Zone Soil | HPEDKGVCDGKAVLTRPLDTGDVSLCAPCAVAQGVAEFPR* |
| Ga0099792_102825572 | 3300009143 | Vadose Zone Soil | SGDWHACRCQCGTAHPDDKGVCDGRAVLTRRVGTADTRLCAPCAVAQGVAEMPH* |
| Ga0075423_114630322 | 3300009162 | Populus Rhizosphere | CGTAHPDDKGVCDGRAVLTRRVGTADTRLCAPCAVAQGVAEMPH* |
| Ga0116216_104624681 | 3300009698 | Peatlands Soil | TAHPDDSGVCDGRAVMTRRVGEADVSLCAPCAVAQGVAEMTL* |
| Ga0126384_103267412 | 3300010046 | Tropical Forest Soil | GLLLGCQCRCGTAHPDDVGVCDGGAVLTRRLGDTEVPLCAPCAVAQGVAEMPH* |
| Ga0126384_112733731 | 3300010046 | Tropical Forest Soil | CPCATAHPQDKDVCDGRAVLSRRLGEADLPICAPCAVAQGVAEMPR* |
| Ga0134067_103005202 | 3300010321 | Grasslands Soil | AHPDDKGVCDGRAVLTRRVGQADMRLCAPCAVAQGVAEMRH* |
| Ga0126370_113551911 | 3300010358 | Tropical Forest Soil | DWHACRCQCRAAHPDDQGVCDVRAVLTRRVGQADVRLCAPCAVAQGVAEMPH* |
| Ga0126376_115328031 | 3300010359 | Tropical Forest Soil | RCDTAHPNDAGVCDGRAVMIRRVSGADVSLCAPCAVAQGVAEMKL* |
| Ga0126378_118141631 | 3300010361 | Tropical Forest Soil | ATAHPQDRNVCDGSAVLARRLGEKDVPLCAPCAVATGVAEMPH* |
| Ga0134125_103940861 | 3300010371 | Terrestrial Soil | DVCDHSAVLTRRMGDDDVPLCAPCAVAQGVAEMP* |
| Ga0126381_1010366731 | 3300010376 | Tropical Forest Soil | NWGTCQCPCAAAHPQDQNVCDGSAVLARRLGEKDVPLCAPCAVATGVAEMPH* |
| Ga0126349_12565361 | 3300010861 | Boreal Forest Soil | CGTAHPDDTGVCDGKAVLVRRLGEADVSLCAPCAVAQGVAEMPRLSSQR* |
| Ga0126350_105767722 | 3300010880 | Boreal Forest Soil | HPDDKGVCDGKAVLTRRIASADVSLCAPCAVAQGVAEFRPGR* |
| Ga0150983_163518621 | 3300011120 | Forest Soil | DTGVCDGKAVLVRRLGDVDVSLCAPCAVAQGVAEMPH* |
| Ga0137391_112164931 | 3300011270 | Vadose Zone Soil | MGVCVASAVMTRELGDVDVRLCAPCAVAQGVSEMAR* |
| Ga0137393_106516562 | 3300011271 | Vadose Zone Soil | WRRCHCPCGEAHPDDMGVCDGRAVMTRQLGDVDVRLCAPCAVAQGVAEMAR* |
| Ga0137383_105609942 | 3300012199 | Vadose Zone Soil | EAHPDDMGVCDGRAVMTRQLGDVNVRLCAPCAVAQGVAEMAP* |
| Ga0137367_100631371 | 3300012353 | Vadose Zone Soil | HPDDMGVCDGRAVMTRQLGDVDVRLCAPCAVAQGVAELPR* |
| Ga0137371_100305791 | 3300012356 | Vadose Zone Soil | AHPDDKGVCDGRAVLTRRVGTANLRLCAPCAVAQGVAEMPH* |
| Ga0157314_10415431 | 3300012500 | Arabidopsis Rhizosphere | ACRCQCGTAHPDDKGVCDGRAVLSRRVGQADVRLCAPCAVAQGVAEMPH* |
| Ga0137410_101412011 | 3300012944 | Vadose Zone Soil | HPDDKGVCDGRAVLTRRVGQADTRLCAPCAVAQGVAEMPH* |
| Ga0164304_109351511 | 3300012986 | Soil | TAHPQDKGVCDGGAIMTRRVNGADLHLCAPCAVAQGVAEMRHY* |
| Ga0137409_105577083 | 3300015245 | Vadose Zone Soil | PDDKGVCDGRAVLTRRVGTADTRLCAPCAVAQGVAEMPH* |
| Ga0182035_108924251 | 3300016341 | Soil | TGDWHVCRCQCRTAHPDDQGVCDSRAVLTRRVGQQDVRLCAPCAVAQGVAEMPH |
| Ga0182032_119288352 | 3300016357 | Soil | WHACRCQCRTAHPDDQGVCDSRAVLTRRVGQADVRLCAPCAVAQGVAEMPH |
| Ga0182039_100922233 | 3300016422 | Soil | CQCRTAHPDDAGVCDGRAVLTRRTGQSDVRLCAPCAVAQGVAEMPH |
| Ga0182039_122451101 | 3300016422 | Soil | HPQDRDVCDGNAILSRHQGDTDVPLCAPCAVAQGVAEMPR |
| Ga0182038_101216961 | 3300016445 | Soil | CRCRCGTAHPDDQGVCDGKAVLTRRVGQADVRLCAPCAVAQGVAEMPH |
| Ga0187812_13029662 | 3300017821 | Freshwater Sediment | DTAHPNDAGVCDGRAVMTRRVGGADVSLCAPCAVAQGVAEMKL |
| Ga0187820_12885671 | 3300017924 | Freshwater Sediment | DSGVCDGRAVMTRKVSGADVSLCAPCAVAQGVAEMTL |
| Ga0187806_13427251 | 3300017928 | Freshwater Sediment | DDSGVCDGRAVMTRRVGEADVSLCAPCAVAQGVAEMTL |
| Ga0187801_104933961 | 3300017933 | Freshwater Sediment | RCHCPCGELHPDDRGVCDGRAVMTRQLGDADVRLCAPCAVAQGVAEMGG |
| Ga0187803_102715933 | 3300017934 | Freshwater Sediment | DPGVCDGQAVMTRRVGEADVSLCAPCAVAQGVAEMKP |
| Ga0187809_103264471 | 3300017937 | Freshwater Sediment | DSGVCDGRAVMTRRVGGADVSLCAPCAVAQGVAEMSL |
| Ga0187781_100754294 | 3300017972 | Tropical Peatland | PCATAHPDDRNVCDGKAVLTRLVGEAEVSMCAPCAVAQGVAEMPG |
| Ga0187782_105239393 | 3300017975 | Tropical Peatland | AHPDDLGVCDGRAVMTRQVSGTDVSLCAPCAVAQGVAEMKS |
| Ga0187805_100496972 | 3300018007 | Freshwater Sediment | GVCDGRAVMTRRVGEADVSLCAPCAVAQGVAEMTL |
| Ga0187883_106308931 | 3300018037 | Peatland | KGVCDGKAVVTRRVAAADVSMCAPCAVAQGVAEFRH |
| Ga0187772_103317402 | 3300018085 | Tropical Peatland | EDKGVCDGRAVLTRQVGNADVSLCAPCAVAQGVAEMPH |
| Ga0066662_118631582 | 3300018468 | Grasslands Soil | WRACRCQCGSAHPDDKGVCDGRAVLTRRVGQTGVRLCAPCAVAQGVAEMPH |
| Ga0193723_11455892 | 3300019879 | Soil | GAAHPDDKGVCDGRAVLTRRVGQADVRLCAPCAVAQGVAEMPH |
| Ga0193730_10100631 | 3300020002 | Soil | PDDKGVCDGRAVLTRRVGQADTRLCAPCAVAQGVAEMPH |
| Ga0197907_105859181 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | HPQDKGVCDGGAIMTRRVNGADLHLCAPCAVAQGVAEMRHY |
| Ga0197907_111555132 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | HPQDKGVCDGGAIMTRRVNGADLHLCAPCAVAQGVAEMRH |
| Ga0206356_105737141 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | TAHPQDKGVCDGGAIMTRRVNGADLHLCAPCAVAQGVAEMRHY |
| Ga0206353_114540852 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | ACRCQCGTAHPDDKGVCDGRAVLSRRVGQADVRMCAPCAVAQGVAEMPH |
| Ga0210403_112483621 | 3300020580 | Soil | AHPADSGVCDGRAVMTRSIGGANVSLCAPCAVAQGVAEMKL |
| Ga0210401_112075701 | 3300020583 | Soil | CGTTHPDDAGVCDGRAVLTRRVGQADVRLCAPCAVAQGVAEMPH |
| Ga0210405_110919032 | 3300021171 | Soil | HPDDRNVCDGSAVLTRRLDEADVSLCAPCAVAQGVAEFPR |
| Ga0210388_107317121 | 3300021181 | Soil | TCGTAHPDDRGVCDGSAVMTRRVGQTDVRLCAPCAVAQGFAEFSR |
| Ga0213881_100067016 | 3300021374 | Exposed Rock | RCPCSTAHPDDKGVCDGRAVLTRRLGQGDVSMCAPCAVAQGVAEMR |
| Ga0210397_111130701 | 3300021403 | Soil | GVCDGRAVLTRRVDETDMPLCAPCAVAQGVAEMPL |
| Ga0210387_106432143 | 3300021405 | Soil | QNVCEGGAIMTRRVAGRDMSLCAPCAVAQGVAEMRR |
| Ga0210387_110228371 | 3300021405 | Soil | GACQCLCESAHPQDKGVCDGGAILSRRIDGVDVPLCAPCAVAQGVQEMPH |
| Ga0210386_112572632 | 3300021406 | Soil | GVCDGRAVMTRSIGGADVSLCAPCAVAQGVAEMKL |
| Ga0210384_115163901 | 3300021432 | Soil | EWRSCHCPCGTAHPDDRNVCDGSAVLTRRLDEADVSLCAPCAVAQGVAEFPR |
| Ga0210391_105475901 | 3300021433 | Soil | DDRGVCDGSAVMTRRVGETDVRLCAPCAVAQGFAEFSR |
| Ga0210390_100809161 | 3300021474 | Soil | DRGVCDGSAVMTRRVGETDVRLCAPCAVAQGFAEFSR |
| Ga0210390_102189313 | 3300021474 | Soil | DRGVCDGKAVMTRRLGEADVSLCAPCAVAQGVAEFSG |
| Ga0210390_111325312 | 3300021474 | Soil | TAHPDDKDVCDGSAVLTRRLSDGDVSLCAPCAVAQGVAEMPL |
| Ga0210392_114997332 | 3300021475 | Soil | CASAHPQDQDVCDHSAVLTRRLGETDVPLCAPCAVAQGVAEMP |
| Ga0210398_100794111 | 3300021477 | Soil | RCPCGTAHPDDRGVCDGKAVMTRRLGEADVSLCAPCAVAQGVAEFSG |
| Ga0210409_102678621 | 3300021559 | Soil | DDKGVCDGRAVLTRRVGRADTRLCAPCAVAQGVAEMPH |
| Ga0242664_11536712 | 3300022527 | Soil | CQCRTAHPADSGVCDGRAVMTRSIGGANVSLCAPCAVAQGVAEMKL |
| Ga0242670_10786742 | 3300022708 | Soil | AHPSDTGVCDGRAVMTRSVSGADVSLCAPCAVAQGVAEMKL |
| Ga0242653_10343302 | 3300022712 | Soil | AHPQDKGVCDGGAILTRRLDGVEVPLCAPCAVAQGVAEMRK |
| Ga0242678_10462772 | 3300022715 | Soil | HPADTGVCDGRAVMTRKVGGSAVSLCAPCAVAQGVAEMKL |
| Ga0224564_11354391 | 3300024271 | Soil | DDKDVCDGRAVMIRRLDGADVSLCAPCAVAQGVAEMSD |
| Ga0207663_114749822 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | QDKNVCDHSAVLTRRIGDSDVPLCAPCAVAQGVAEMP |
| Ga0207694_107782221 | 3300025924 | Corn Rhizosphere | GVCDGRAVLSRRVGQADVRLCAPCAVAQGVAEMPH |
| Ga0207700_106535793 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GAAHPQDRNVCDGSAVLTRRFGEKDVPLCAPCAVATGVAEMPH |
| Ga0207700_109437441 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | TAHPDDRGVCDGKAVLSRRIASADVSLCAPCAVAQGVAEFPRGPR |
| Ga0207664_102329641 | 3300025929 | Agricultural Soil | VLSGDWHACRCQCGTAHPDDKGVCDGRAVLTRRVGTADTRLCAPCAVAQGVAEMPH |
| Ga0207664_106529541 | 3300025929 | Agricultural Soil | CLCATAHPQDKGVCDGGAIMTRRVNGADVHLCAPCAVAQGVAEMPR |
| Ga0207661_115655652 | 3300025944 | Corn Rhizosphere | AHPDDKGVCDGRAVLSRRVGQADVRLCAPCAVAQGVAEMPH |
| Ga0209687_12431111 | 3300026322 | Soil | GDWRACRCQCGTAHPEDKGVCDGRAVLTRRVGQADVRLCAPCAVAQGVAEMPH |
| Ga0257147_10299712 | 3300026475 | Soil | QCGTAHPDDKGVCDGRAVLTRRVGQADTRLCAPCAVAQGVAEMPH |
| Ga0209156_101340871 | 3300026547 | Soil | CGTAHPEDKGVCDGRAVLTRRVGQADVRLCAPCAVAQGVAEMPH |
| Ga0208488_10582871 | 3300027110 | Forest Soil | DLDVCDHSAVLTRRLGDSDVPLCAPCAVAQGVAEMRR |
| Ga0209624_103870593 | 3300027895 | Forest Soil | TAAHPQDANVCDGSAVLTRRLREKDVPLCAPCAVATGVAEMPH |
| Ga0209006_112851581 | 3300027908 | Forest Soil | DRGVCDGRAVVTRHAGDADVSLCAPCAVAQGFAEMPH |
| Ga0307313_100581332 | 3300028715 | Soil | CGAAHPDDKGVCDGRAVLTRRVGQADVRLCAPCAVAQGVAEMPH |
| Ga0222749_105999391 | 3300029636 | Soil | PDDRGVCDGSAVMTRRVGETDVRLCAPCAVAQGFAEFSR |
| Ga0311371_111425131 | 3300029951 | Palsa | MGVCDGSAILTRQVGNSQMPLCAPCAVAQGVAEMPH |
| Ga0302181_102475832 | 3300030056 | Palsa | SDAGVCDGQAVMSRKVGEADVSLCAPCAVAQGVAEMKL |
| Ga0302179_104361041 | 3300030058 | Palsa | AGVCDGQAVMSRKVGEADVSLCAPCAVAQGVAEMKL |
| Ga0302184_101949672 | 3300030490 | Palsa | PQDRGVCDGDAILTRRVDEADVPLCAPCAVAQGVAEMRRR |
| Ga0210274_15201471 | 3300030531 | Soil | CRCEQAHPDDQDVCDGRAVMTRRLDGADVSLCAPCAVAQGVAEMSD |
| Ga0210252_106774762 | 3300030548 | Soil | HCPCGTTHPEDRDVCDGRAVLTRRLGESDVSLCAPCAVAQGVAEFPRGLPFTPDAAP |
| Ga0210282_103377191 | 3300030630 | Soil | RNCHCQCGTTHPDDPGVCDGQAVVTRKVAGSVVSLCAPCAVAQGVAEMRH |
| Ga0302317_103920382 | 3300030677 | Palsa | RCPCSTAHPQDPGVCDRSAVLTRRVDGVEMPLCAPCVVAQGVAEMPH |
| Ga0307482_11584012 | 3300030730 | Hardwood Forest Soil | GVCDSRAVLTRRVDETDMPLCAPCAVAQGVAEMPL |
| Ga0265462_107328221 | 3300030738 | Soil | GPCAAAHPQDRNVCDGSAVLSRRFGEQDVPLCAPCAVATSVAEMPH |
| Ga0265460_129089232 | 3300030740 | Soil | DAGVCDGRAVMNRSIGGANVSLCAPCAVAQGVAEMKL |
| Ga0265461_140103042 | 3300030743 | Soil | QCPCATAHPQDKDVCDRSAILTRRLADTEVRLCAPCAVAQGVAEMRR |
| Ga0075396_15588671 | 3300030776 | Soil | GTCQCPCGAAHPQDRNVCDGSAVLTRRLGEKDVPLCAPCAVATGVAEMPH |
| Ga0265766_10236921 | 3300030863 | Soil | DVCDHSAVLTRRLADSDVPLCAPCAVAQGVAEMRR |
| Ga0170824_1011419963 | 3300031231 | Forest Soil | TCQCPCAAAHPQDRNVCDGGAVLTRRLGEKDVPLCAPCAVATGVAEMPH |
| Ga0302324_1025478522 | 3300031236 | Palsa | QCATAHPDDQGVCDGRAMLTRRLGHTEVSLCAPCAVAQGVAEMRH |
| Ga0170818_1130582342 | 3300031474 | Forest Soil | DDQGVCDGRAMLTRRLGHTEVSLCAPCAVAQGVAEMRR |
| Ga0302326_118397702 | 3300031525 | Palsa | DDQGVCDGRAMLTRRLGHTEVSLCAPCAVAQGVAEMRH |
| Ga0318516_102142723 | 3300031543 | Soil | PDDSGVCDGRAVMTRRISGADVSMCAPCAVAQGFAELRD |
| Ga0318538_103916891 | 3300031546 | Soil | RCQCGTAHPDDKGVCDGRAVLTRRVGQASVRLCAPCAVAQGVAEMPH |
| Ga0318538_106553682 | 3300031546 | Soil | HVCRCQCRTAHPDDQGVCDSRAVLTRRVGQQDVRLCAPCAVAQGVAEMPH |
| Ga0318555_103198562 | 3300031640 | Soil | QCPCITAHPQDRDVCDGSAILTRRLGETDMRLCAPCAVAQGVAEMPH |
| Ga0318542_103682651 | 3300031668 | Soil | QCPCATAHPQDQNVCDGRAVLTRRLGNADMSVCAPCAVAQGVAEMRR |
| Ga0318561_104532352 | 3300031679 | Soil | SGVCDGRAVMIRRVGGTDVSLCAPCAVAQGVAEMKL |
| Ga0318572_106770242 | 3300031681 | Soil | GDSGVCDGRAVMTRRVGGADVSMCAPCAVAQGFAELTD |
| Ga0318560_101802182 | 3300031682 | Soil | SGDWHACRCQCRTAHPDDAGVCDGRAVLTRRTGQADVRLCAPCAVAQGVAEMPH |
| Ga0310686_1062581843 | 3300031708 | Soil | AHPDDRGVCDGKAVMTRRLGEADVSLCAPCAVAQGVAEFSG |
| Ga0310686_1138943373 | 3300031708 | Soil | GVCDGRAVMTRSVGGANVSLCAPCAVAQGVAEMKL |
| Ga0318496_104028472 | 3300031713 | Soil | CQCPCITAHPQDRDVCDGSAILTRRLGETDMRLCAPCAVAQGVAEMPH |
| Ga0307476_112506392 | 3300031715 | Hardwood Forest Soil | AHPDDKGVCDGRAVLSRRVGTADTRLCAPGAVAQGVAEMPH |
| Ga0306918_101492093 | 3300031744 | Soil | AHPKDSGVCDGRAVMIRRVGGMDVSLCAPCAVAQGVAEMKL |
| Ga0318502_109537591 | 3300031747 | Soil | PDDSGVCDGKAVLTRRVGKADVSLCAPCAVAQGVAELPR |
| Ga0318492_104129243 | 3300031748 | Soil | GHPADLGVCDGRAVMTRRVGGADVSLCAPCAVAQGVAEMKL |
| Ga0318492_104309323 | 3300031748 | Soil | DSGVCDGRAVLTRRLDGADVSLCAPCAVAQGFAEFSR |
| Ga0318492_106588322 | 3300031748 | Soil | DKNVCDGRAVLTRRLGKADLPVCAPCAVAQGVAEMRR |
| Ga0318494_101656391 | 3300031751 | Soil | CRCQCRTAHPDDAGVCDGKAVLTRRVGQADVRLCAPCAVAQGVAEMPH |
| Ga0318494_109667201 | 3300031751 | Soil | CPCATAHPQDRDVCDRSAILTRRLGETEMRLCAPCAVAQGVAEMPH |
| Ga0318535_103264321 | 3300031764 | Soil | DTGVCDGRAVMIRRVSGADVSLCAPCAVAQGVAEMKL |
| Ga0318509_106140452 | 3300031768 | Soil | DDAGVCDGRAVLTRRVGQADVRLCAPCAVAQGVAEMPH |
| Ga0318521_101669234 | 3300031770 | Soil | AHPQDQNVCDGRAVLTRRRGNADMSVCAPCAVAQGVAEMRR |
| Ga0318566_102688991 | 3300031779 | Soil | CQSPDSAERPDDKGVCDGRAVLTRRVGQASVRLCAPCAVAQGVAEMPH |
| Ga0318552_100227091 | 3300031782 | Soil | THPDDSGVCDGRAVMTRRISGADVSMCAPCAVAQGFAELRD |
| Ga0318576_105789462 | 3300031796 | Soil | DRNVCDGRAVLTRRLGRTDLPVCAPCAVAQGVAEMRR |
| Ga0318568_103262902 | 3300031819 | Soil | TAHPQDQNVCDGRAVLTRRLGNADMSVCAPCAVAQGVAEMRR |
| Ga0318568_109335881 | 3300031819 | Soil | AHPQDRDVCDGSAILTRRLGETDMRLCAPCAVAQGVAEMPH |
| Ga0318517_102272333 | 3300031835 | Soil | CEMAHPKDAGVCDGRAVMTRRVRGADVSLCAPCAVAQGVAEMKL |
| Ga0318511_103256312 | 3300031845 | Soil | CRCQCRTAHPDDAGVCDGRAVLTRRTGQADVRLCAPCAVAQGVAEMPH |
| Ga0306919_111052971 | 3300031879 | Soil | DWHACRCRCGTAHPDDQGVCDGKAVLTRRVGQADVRLCAPCAVAQGVAEMPH |
| Ga0318522_100803161 | 3300031894 | Soil | PQDQNVCDGRAVLTRRLGNADMSVCAPCAVAQGVAEMRR |
| Ga0318522_101681991 | 3300031894 | Soil | PGDSGVCDGRAVMTRRVGGADVSMCAPCAVAQGFAELTD |
| Ga0318551_102991591 | 3300031896 | Soil | QCPCVTAHPQDKNVCDGRAVLTRRLGKADLPVCAPCAVAQGVAEMRR |
| Ga0318520_106457841 | 3300031897 | Soil | DDAGVCDGRAVLTRRTGQSDVRLCAPCAVAQGVAEMPH |
| Ga0306923_112792922 | 3300031910 | Soil | DQNVCDGRAVLTRRLGNADMSVCAPCAVAQGVAEMRR |
| Ga0310912_110817572 | 3300031941 | Soil | AHPQDKDVCDGSAILTRRLGQTEMRLCAPCAVAQGVAEMPH |
| Ga0318562_106371081 | 3300032008 | Soil | ACQCPCATAHPQDRGVCEGGAIMTRRVAGTDMSLCAPCAVAQGVAEMRR |
| Ga0318569_105598051 | 3300032010 | Soil | AHPKDSGVCDGRAVMIRRVGGTDVSLCAPCAVAQGVAEMKL |
| Ga0318533_109140752 | 3300032059 | Soil | CGTAHPDDKGVCDGRAVLTRRVGQASVRLCAPCAVAQGVAEMPH |
| Ga0318504_101033432 | 3300032063 | Soil | GVCDSRAVLTRRVGQQDVRLCAPCAVAQGVAEMPH |
| Ga0318510_102203141 | 3300032064 | Soil | QCEMAHPKDAGVCDGRAVMTRRVRGADVSLCAPCAVAQGVAEMKL |
| Ga0318553_100122901 | 3300032068 | Soil | CQCRTAHPDDQGVCDSRAVLTRRVGQQDVRLCAPCAVAQGVAEMPH |
| Ga0318525_104833952 | 3300032089 | Soil | CQCPCFTAHPQDRDVCDGSAILTRRLGETDMRLCAPCAVAQGVAEMPH |
| Ga0318525_106447071 | 3300032089 | Soil | CQCDTAHPDDTGVCDGRAVMTRRLGGMDVSLCAPCAVAQGVAEMR |
| Ga0307471_1041557561 | 3300032180 | Hardwood Forest Soil | SGDWHACRCQCGTAHPDDKGVCDGRAVLTRRVGQADTRLCAPCAVAQGVAEMPH |
| Ga0335085_115617902 | 3300032770 | Soil | PCRTAHPDDSGVCDGKAVLTRRLGDADVSMCAPCAVAQGVAEFRR |
| Ga0335082_110702772 | 3300032782 | Soil | CQCRTAHPDDAGVCDGRAVLTRRVGQADVRLCAPCAVAQGVAEMPH |
| Ga0335075_112255892 | 3300032896 | Soil | AHPQDKDVCDGGAILTRRIDGAEVGLCAPCAVAQGFAEMPH |
| Ga0335075_114180621 | 3300032896 | Soil | CQCSTAHPDDRGVCDGQAVMTRRVGEEDVSLCAPCAVAQGVAEMKP |
| Ga0335075_114652432 | 3300032896 | Soil | HPDDLGVCDGQAVMTRKVSGAVVSLCAPCAVAQGVAEMSR |
| Ga0335083_102812934 | 3300032954 | Soil | CRTAHPDDSGVCDGKAVLTRRIGNADVSMCAPCAVAQGVAEFRR |
| Ga0310914_105376143 | 3300033289 | Soil | QDQNVCDGRAVLTRRLGNADMSVCAPCAVAQGVAEMRR |
| ⦗Top⦘ |