| Basic Information | |
|---|---|
| Family ID | F035348 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 172 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MKWKFFVGACILSAGLLIKAGAPLVPIALGIAGAAFINWKTHRSD |
| Number of Associated Samples | 143 |
| Number of Associated Scaffolds | 172 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 7.19 % |
| % of genes near scaffold ends (potentially truncated) | 32.56 % |
| % of genes from short scaffolds (< 2000 bps) | 88.95 % |
| Associated GOLD sequencing projects | 131 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.814 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.046 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.791 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 50.68% β-sheet: 0.00% Coil/Unstructured: 49.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 172 Family Scaffolds |
|---|---|---|
| PF00909 | Ammonium_transp | 12.79 |
| PF00543 | P-II | 1.74 |
| PF13185 | GAF_2 | 0.58 |
| PF00206 | Lyase_1 | 0.58 |
| PF02913 | FAD-oxidase_C | 0.58 |
| PF07642 | BBP2 | 0.58 |
| PF04314 | PCuAC | 0.58 |
| PF00999 | Na_H_Exchanger | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 172 Family Scaffolds |
|---|---|---|---|
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 12.79 |
| COG0347 | Nitrogen regulatory protein PII | Signal transduction mechanisms [T] | 1.74 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.58 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.58 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.58 |
| COG2847 | Copper(I)-binding protein | Inorganic ion transport and metabolism [P] | 0.58 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.58 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.58 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.81 % |
| Unclassified | root | N/A | 19.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459003|FZ032L002GC7LM | Not Available | 502 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101782220 | All Organisms → cellular organisms → Bacteria | 3089 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105295389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300004114|Ga0062593_101079217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 831 | Open in IMG/M |
| 3300004153|Ga0063455_101457471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 531 | Open in IMG/M |
| 3300004156|Ga0062589_100020364 | All Organisms → cellular organisms → Bacteria | 3114 | Open in IMG/M |
| 3300004156|Ga0062589_100523766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1006 | Open in IMG/M |
| 3300004156|Ga0062589_101570209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 650 | Open in IMG/M |
| 3300004157|Ga0062590_100109777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1774 | Open in IMG/M |
| 3300004463|Ga0063356_101665203 | Not Available | 952 | Open in IMG/M |
| 3300004479|Ga0062595_101410580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 635 | Open in IMG/M |
| 3300004479|Ga0062595_101476520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300004479|Ga0062595_101585183 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300004480|Ga0062592_100751810 | Not Available | 856 | Open in IMG/M |
| 3300005171|Ga0066677_10155733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1255 | Open in IMG/M |
| 3300005172|Ga0066683_10182662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1293 | Open in IMG/M |
| 3300005178|Ga0066688_10539012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 750 | Open in IMG/M |
| 3300005180|Ga0066685_10025193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3621 | Open in IMG/M |
| 3300005328|Ga0070676_10376199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 982 | Open in IMG/M |
| 3300005331|Ga0070670_101927345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 544 | Open in IMG/M |
| 3300005332|Ga0066388_101341177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1237 | Open in IMG/M |
| 3300005338|Ga0068868_101126093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 723 | Open in IMG/M |
| 3300005345|Ga0070692_10349490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 918 | Open in IMG/M |
| 3300005356|Ga0070674_102189137 | Not Available | 505 | Open in IMG/M |
| 3300005450|Ga0066682_10487009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300005468|Ga0070707_101550934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 629 | Open in IMG/M |
| 3300005471|Ga0070698_100614352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1028 | Open in IMG/M |
| 3300005526|Ga0073909_10172036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 918 | Open in IMG/M |
| 3300005526|Ga0073909_10534020 | Not Available | 571 | Open in IMG/M |
| 3300005543|Ga0070672_102048359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 516 | Open in IMG/M |
| 3300005546|Ga0070696_101339171 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300005546|Ga0070696_101771670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 533 | Open in IMG/M |
| 3300005559|Ga0066700_10632807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 743 | Open in IMG/M |
| 3300005564|Ga0070664_101411870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 658 | Open in IMG/M |
| 3300005615|Ga0070702_100945477 | Not Available | 678 | Open in IMG/M |
| 3300005616|Ga0068852_101401297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 721 | Open in IMG/M |
| 3300005617|Ga0068859_100217586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1998 | Open in IMG/M |
| 3300005618|Ga0068864_100879041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 884 | Open in IMG/M |
| 3300005719|Ga0068861_101380655 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300005764|Ga0066903_100840830 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
| 3300005834|Ga0068851_10398936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 809 | Open in IMG/M |
| 3300005841|Ga0068863_102384735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 539 | Open in IMG/M |
| 3300005843|Ga0068860_101412957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 717 | Open in IMG/M |
| 3300006028|Ga0070717_10708370 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300006034|Ga0066656_10444509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 843 | Open in IMG/M |
| 3300006046|Ga0066652_100096174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2378 | Open in IMG/M |
| 3300006049|Ga0075417_10411498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 670 | Open in IMG/M |
| 3300006050|Ga0075028_101035555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 512 | Open in IMG/M |
| 3300006237|Ga0097621_100199162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1738 | Open in IMG/M |
| 3300006580|Ga0074049_11714275 | Not Available | 507 | Open in IMG/M |
| 3300006796|Ga0066665_10385411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1153 | Open in IMG/M |
| 3300006797|Ga0066659_11781261 | Not Available | 521 | Open in IMG/M |
| 3300006854|Ga0075425_102468478 | Not Available | 576 | Open in IMG/M |
| 3300006871|Ga0075434_101769187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 625 | Open in IMG/M |
| 3300006880|Ga0075429_100223510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1649 | Open in IMG/M |
| 3300006881|Ga0068865_100855852 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300006953|Ga0074063_12319402 | Not Available | 532 | Open in IMG/M |
| 3300006969|Ga0075419_10489526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 853 | Open in IMG/M |
| 3300009012|Ga0066710_100543910 | All Organisms → cellular organisms → Bacteria | 1756 | Open in IMG/M |
| 3300009012|Ga0066710_100822838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1425 | Open in IMG/M |
| 3300009012|Ga0066710_102745339 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300009038|Ga0099829_10104028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2213 | Open in IMG/M |
| 3300009038|Ga0099829_10475568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1036 | Open in IMG/M |
| 3300009088|Ga0099830_11373174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300009090|Ga0099827_11759732 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300009094|Ga0111539_12403473 | Not Available | 611 | Open in IMG/M |
| 3300009100|Ga0075418_13111168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300009101|Ga0105247_11635614 | Not Available | 530 | Open in IMG/M |
| 3300009137|Ga0066709_100196905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2642 | Open in IMG/M |
| 3300009137|Ga0066709_101182319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1126 | Open in IMG/M |
| 3300009162|Ga0075423_11905270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300009177|Ga0105248_10786824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1074 | Open in IMG/M |
| 3300009177|Ga0105248_11177141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 867 | Open in IMG/M |
| 3300009177|Ga0105248_13445076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300009553|Ga0105249_12291049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300010046|Ga0126384_12461719 | Not Available | 505 | Open in IMG/M |
| 3300010047|Ga0126382_10970075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300010159|Ga0099796_10236178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 754 | Open in IMG/M |
| 3300010396|Ga0134126_12440320 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300010401|Ga0134121_12188195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300011269|Ga0137392_10838864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300012096|Ga0137389_10924451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 748 | Open in IMG/M |
| 3300012203|Ga0137399_10448150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1079 | Open in IMG/M |
| 3300012203|Ga0137399_11569409 | Not Available | 546 | Open in IMG/M |
| 3300012208|Ga0137376_10413916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1171 | Open in IMG/M |
| 3300012354|Ga0137366_11119183 | Not Available | 541 | Open in IMG/M |
| 3300012361|Ga0137360_11255863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300012517|Ga0157354_1062682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300012685|Ga0137397_11000922 | Not Available | 615 | Open in IMG/M |
| 3300012917|Ga0137395_11071948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300012927|Ga0137416_10845548 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300012944|Ga0137410_11725536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300012948|Ga0126375_11296297 | Not Available | 612 | Open in IMG/M |
| 3300012951|Ga0164300_11069029 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300012971|Ga0126369_12137446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300012989|Ga0164305_11674120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300014324|Ga0075352_1116406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300015245|Ga0137409_11035813 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300015371|Ga0132258_10049894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9567 | Open in IMG/M |
| 3300015371|Ga0132258_10148940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5609 | Open in IMG/M |
| 3300015371|Ga0132258_10166859 | All Organisms → cellular organisms → Bacteria | 5303 | Open in IMG/M |
| 3300015371|Ga0132258_10212952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4695 | Open in IMG/M |
| 3300015373|Ga0132257_100979813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1063 | Open in IMG/M |
| 3300015373|Ga0132257_103927744 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300015374|Ga0132255_105130418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300015374|Ga0132255_105519079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300016294|Ga0182041_10411809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1153 | Open in IMG/M |
| 3300017792|Ga0163161_11348025 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300018000|Ga0184604_10074094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1001 | Open in IMG/M |
| 3300018027|Ga0184605_10268100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300018028|Ga0184608_10080175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1337 | Open in IMG/M |
| 3300018028|Ga0184608_10418375 | Not Available | 580 | Open in IMG/M |
| 3300018060|Ga0187765_10006573 | All Organisms → cellular organisms → Bacteria | 5028 | Open in IMG/M |
| 3300018061|Ga0184619_10341754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 683 | Open in IMG/M |
| 3300018061|Ga0184619_10530316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300018064|Ga0187773_10351165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 839 | Open in IMG/M |
| 3300018075|Ga0184632_10115836 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300018076|Ga0184609_10046753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1836 | Open in IMG/M |
| 3300018083|Ga0184628_10500391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 629 | Open in IMG/M |
| 3300018433|Ga0066667_12033963 | Not Available | 529 | Open in IMG/M |
| 3300018476|Ga0190274_11718780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300019279|Ga0184642_1416957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 890 | Open in IMG/M |
| 3300019279|Ga0184642_1538104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1469 | Open in IMG/M |
| 3300019881|Ga0193707_1045300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1412 | Open in IMG/M |
| 3300021080|Ga0210382_10052417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1609 | Open in IMG/M |
| 3300021082|Ga0210380_10452871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300022756|Ga0222622_11008520 | Not Available | 612 | Open in IMG/M |
| 3300025315|Ga0207697_10157729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 989 | Open in IMG/M |
| 3300025922|Ga0207646_11950050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300025923|Ga0207681_10805327 | Not Available | 785 | Open in IMG/M |
| 3300025925|Ga0207650_11628031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300025930|Ga0207701_11711767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300025940|Ga0207691_10582484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 948 | Open in IMG/M |
| 3300025941|Ga0207711_10339519 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
| 3300025941|Ga0207711_11658317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 583 | Open in IMG/M |
| 3300025945|Ga0207679_11187028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300025986|Ga0207658_11366669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300025986|Ga0207658_12136942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 509 | Open in IMG/M |
| 3300026088|Ga0207641_10463735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1226 | Open in IMG/M |
| 3300026089|Ga0207648_12120097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 523 | Open in IMG/M |
| 3300026121|Ga0207683_10042826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia glathei | 3954 | Open in IMG/M |
| 3300026540|Ga0209376_1181143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 979 | Open in IMG/M |
| 3300027873|Ga0209814_10125774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1094 | Open in IMG/M |
| 3300027915|Ga0209069_10685694 | Not Available | 600 | Open in IMG/M |
| 3300028536|Ga0137415_10829457 | Not Available | 735 | Open in IMG/M |
| 3300028536|Ga0137415_10861566 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300028784|Ga0307282_10074457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1548 | Open in IMG/M |
| 3300028792|Ga0307504_10375516 | Not Available | 554 | Open in IMG/M |
| 3300028884|Ga0307308_10257966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 835 | Open in IMG/M |
| 3300029987|Ga0311334_11196186 | Not Available | 637 | Open in IMG/M |
| 3300031058|Ga0308189_10007127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2144 | Open in IMG/M |
| 3300031058|Ga0308189_10391579 | Not Available | 571 | Open in IMG/M |
| 3300031093|Ga0308197_10217865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300031114|Ga0308187_10120065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 842 | Open in IMG/M |
| 3300031226|Ga0307497_10205377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300031366|Ga0307506_10472712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300031538|Ga0310888_10254725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 987 | Open in IMG/M |
| 3300031833|Ga0310917_10392906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 943 | Open in IMG/M |
| 3300031912|Ga0306921_10965661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 963 | Open in IMG/M |
| 3300031912|Ga0306921_12151187 | Not Available | 590 | Open in IMG/M |
| 3300032001|Ga0306922_10878939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 932 | Open in IMG/M |
| 3300032261|Ga0306920_104052943 | Not Available | 531 | Open in IMG/M |
| 3300033289|Ga0310914_10230980 | All Organisms → cellular organisms → Bacteria | 1659 | Open in IMG/M |
| 3300033412|Ga0310810_10013641 | All Organisms → cellular organisms → Bacteria | 9598 | Open in IMG/M |
| 3300033475|Ga0310811_11079759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300034667|Ga0314792_105410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300034671|Ga0314796_055440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.98% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.23% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.65% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.49% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.74% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.16% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.16% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.16% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.16% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.16% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.16% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.16% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.16% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.58% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.58% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.58% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.58% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.58% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.58% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.58% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012517 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610 | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034667 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034671 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_12650390 | 2170459003 | Grass Soil | MKSWKYFVGACILAAGLLIKVGVPLVPIALGVAAAAYLNWKRLAPRT |
| INPhiseqgaiiFebDRAFT_1017822203 | 3300000364 | Soil | MKWKYFLGACILSVGLLLKAGAPLVPVVLGIAGAAFINWKKHRRE* |
| INPhiseqgaiiFebDRAFT_1052953892 | 3300000364 | Soil | MNWKFFIGSCILVAGLLLKAGAPVVPIAAGMAIAGIVTWRMQRRTNGAPRSSR* |
| Ga0062593_1010792172 | 3300004114 | Soil | MKWKFFVGACILSAGLLIKAGAPLVPIALGIVGAAFINWKTHRSD* |
| Ga0063455_1014574711 | 3300004153 | Soil | MKTWKYFLGSCILAAGLAFKAGAPIVPVIVGLAAAAFLTWKK |
| Ga0062589_1000203644 | 3300004156 | Soil | VRRDDVDMKWNDFFEACILAVGLLLKAGGGPIVPIVLGIAGAAFIKWRKHRSE* |
| Ga0062589_1005237663 | 3300004156 | Soil | MKWKFFVGACILSAGLLIKAGAPLVPIALGIAGAAFINWKTHRSD* |
| Ga0062589_1015702092 | 3300004156 | Soil | MKWKYFVGACILAVGLVLKAGAPLIPVVLGVAAAAFITWKTQRSG* |
| Ga0062590_1001097773 | 3300004157 | Soil | MKWNDFFEACILAVGLLLKAGGGPIVPIVLGIAGAAFFKWRKHRSE* |
| Ga0063356_1016652032 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKWNDFFEACILAVGLLLKAGGGPIVPIVLGIAGAAFIKWRKHRSE* |
| Ga0062595_1014105801 | 3300004479 | Soil | MKWKFFIGSSILAAGLLIKFGAPLVPVAIGIAAAAFITWKKLQSE* |
| Ga0062595_1014765201 | 3300004479 | Soil | MKKWTWFIGSCILATGILLKLGVPLVPLVAGIAGAAFLTWKMQRSA* |
| Ga0062595_1015851832 | 3300004479 | Soil | MKWKFFIGSCILVAGLLIKFGAPIVPVAIGIAGAAFITWKKLQRE* |
| Ga0062592_1007518101 | 3300004480 | Soil | DMKWNDFFEACILAVGLLLKAGGGPIVPIVLGIAGAAFIKWRKHRSE* |
| Ga0066677_101557333 | 3300005171 | Soil | MMNWKYFVGACILSAGLLFKFGAPLPAVAMGIAAATFINWRKQRSSR* |
| Ga0066683_101826622 | 3300005172 | Soil | MKKWRWFVGSCILATGLLLKAGVPLVPLVAGIAGAAFLNWKMQRGA* |
| Ga0066688_105390121 | 3300005178 | Soil | MKWKFFIGSCILVAGLLLKAGAPVVAVILGIAGAAFLTWKKQRT* |
| Ga0066685_100251933 | 3300005180 | Soil | MKKWRWFVGSCILATGLLLKAGVPLVPLVAGIAGAAFLNWKMQRSA* |
| Ga0070676_103761992 | 3300005328 | Miscanthus Rhizosphere | MKWKFFIGSCILVAGLLIKFGAPIVPVAIGIAGAALITWKKLQRE* |
| Ga0070670_1019273451 | 3300005331 | Switchgrass Rhizosphere | MKWKYFLGACILSVGLLLKAGAPLVPIGLGIAGAAFINWRTHRRE* |
| Ga0066388_1013411771 | 3300005332 | Tropical Forest Soil | MSDHSMKWKFFLGSCILAAGLLIKAGAPIVPIAAGMAVAGLVTWKLQRRTTRLPR* |
| Ga0070666_107114401 | 3300005335 | Switchgrass Rhizosphere | HGRGGVRDYDVEMKWKFFIGSCILVAGLLVKFGAPIVPVAIGIAGAAFVTWKKLQRE* |
| Ga0068868_1011260931 | 3300005338 | Miscanthus Rhizosphere | MKWKFFVGSSILVAGLLIKAGAPLIAILIGIAGAAFINWKRQRV* |
| Ga0070692_103494902 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MKWKFFVGACILSAGLLLKAGAPLIPVALGLVAAAFLTWKLQGSE* |
| Ga0070674_1021891371 | 3300005356 | Miscanthus Rhizosphere | WKFFIGSCILVAGLLIKFGAPIVPVAIGIAGAALITWKKLQRE* |
| Ga0066682_104870091 | 3300005450 | Soil | MTKWKFFIGSCILAAGLLIKAGVPIVSIALGIALAAVVTWKSARRTKRLPR* |
| Ga0070707_1015509341 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MKWKFFLGATILTVGLVLKAGAPLVPIALGVAAAAFFNWKKLRTH* |
| Ga0070698_1006143521 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MKWKFFLGATILTAGLMLKAGAPLVAIALGVAGAAFFNWKKLRTH* |
| Ga0073909_101720362 | 3300005526 | Surface Soil | MKWKFFIGASILSVGLLIKLGAPLVPIALGLAVAAFLTWKKQRSE* |
| Ga0073909_105340202 | 3300005526 | Surface Soil | MNWKFFVGASILSVGLLLKLGAPLVPVALGIVGAALVNWKTQRS* |
| Ga0070672_1020483591 | 3300005543 | Miscanthus Rhizosphere | MKWKFFIGSCILVAGLLVKFGAPIVPVAIGIAGAAFVTWKKLQRE* |
| Ga0070696_1013391711 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | RYDVEMKWKFFVGACILSAGLLIKAGAPLVPIALGIVGAAFINWKKHRSD* |
| Ga0070696_1017716701 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKWRWFIGSCILATGLLLKLGVPLVPLVAGIAGAAFLNWKMQRNA* |
| Ga0066700_106328072 | 3300005559 | Soil | MRWKFFIGSCILVAGLLLKAGAPVVAVVLGIAAAAFVTWKKQRT* |
| Ga0070664_1014118701 | 3300005564 | Corn Rhizosphere | LRRHDVEMKWKFFVGACILTVGLLIKAGAPLVPIILGIAGAAFLNWKKQRSD* |
| Ga0070702_1009454771 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKWQYFIGASILAAGLLVKAGAPLVPIVLGLAVAAFLTWKNTPKA* |
| Ga0068852_1014012971 | 3300005616 | Corn Rhizosphere | WKFFIGSCILVAGLLIKFGAPIVPVAIGIAGAAFITWKKLQRE* |
| Ga0068859_1002175862 | 3300005617 | Switchgrass Rhizosphere | MKWKFFVGACILSAGLLIKAGAPLVPIALGIAGSAFINWKTHRSD* |
| Ga0068864_1008790413 | 3300005618 | Switchgrass Rhizosphere | MKWKFFVGACILSAGLLIKAGAPLVPIALGIAGAAFINW |
| Ga0068861_1013806552 | 3300005719 | Switchgrass Rhizosphere | RDLRGYDVAMRWKYFVGACILSVALVLKAGAPLVPVALGVAAAAFLTWKTQRSG* |
| Ga0066903_1008408302 | 3300005764 | Tropical Forest Soil | MHWKFFIGSCILVAGLLLKAGAPVVPIAAGMVLAGIITWKMQRRANGATRSSR* |
| Ga0068851_103989361 | 3300005834 | Corn Rhizosphere | SCILVAGLLIKFGAPIVPVAIGIAGAALITWKKLQRE* |
| Ga0068863_1023847351 | 3300005841 | Switchgrass Rhizosphere | MKWKFFIGSCILVAGLLIKFGAPIVPVAIGIAGAAFVTWKKLQRE* |
| Ga0068860_1014129572 | 3300005843 | Switchgrass Rhizosphere | MKWKFFVGACILSAGLLIKAGAPLVPIALGIVGAAFINWKKHRSD* |
| Ga0070717_107083702 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VKWKYFLGATILAVGLLLKAGAPLVPIALGVAGAAFFNWKKIRSD* |
| Ga0066656_104445091 | 3300006034 | Soil | MTKWRWFVGSCILATGLLLKAGVPLVPLVAGIAGAAFLNWKMQRGA* |
| Ga0066652_1000961742 | 3300006046 | Soil | MEMKKWRWFVGSCILATGLLLKAGVPLVPLVAGIAGAAFLNWKMQRSA* |
| Ga0075417_104114982 | 3300006049 | Populus Rhizosphere | MNWKFFVGASILSIGLLLKLGAPLVPVALGIAAAALVNWKTQRN* |
| Ga0075028_1010355552 | 3300006050 | Watersheds | MKWKFFLGAAILSVGLLFKAGAPMVPIALGLALAAFLTWKKQRSE* |
| Ga0097621_1001991622 | 3300006237 | Miscanthus Rhizosphere | MKWKFFIGSSILAAGLLIKFGAPLVPVAIGIAAAAFITWKKLQGE* |
| Ga0074049_117142751 | 3300006580 | Soil | GVRVYDVGMKWKFFIGSCILVAGLLIKFGAPIVPVAIGIAGAAFITWKKLQRE* |
| Ga0066665_103854112 | 3300006796 | Soil | MKKWRWFVGSCILATGLLLKAGVPLVPLVIGIAGAAFLNWKMQRSA* |
| Ga0066659_117812612 | 3300006797 | Soil | MKKWRWFAGSCILATGLLLKAGVPLVPLVIGIAGAAFLNWKMQRSA* |
| Ga0075425_1024684782 | 3300006854 | Populus Rhizosphere | ILVAGVLVKAGAPIVPIVAGLAIAGFVTWKLQRRSNGLTR* |
| Ga0075434_1017691871 | 3300006871 | Populus Rhizosphere | MKWKFFIGSCILAAGLLLKAGAPVVPIAAGMAIAGIITWKMQRRTDGASRSSR* |
| Ga0075429_1002235101 | 3300006880 | Populus Rhizosphere | MNWKFFVGASILSIGLLLKLGAPLVPVALGIAAAA |
| Ga0068865_1008558521 | 3300006881 | Miscanthus Rhizosphere | EMKWKFFIGSSILAAGLLIKFGAPLVPVAIGIAAAAFITWKKLQSE* |
| Ga0074063_123194022 | 3300006953 | Soil | WKFFIGSCILAAGLVVKAGAPLVPVAGGLLLAGILTWLRHRRANTSHS* |
| Ga0075419_104895263 | 3300006969 | Populus Rhizosphere | MNWKFFVGASILSIGLLLKLGAPLVPVALGIAAAALV |
| Ga0066710_1005439103 | 3300009012 | Grasslands Soil | MKKWRWFVGSCILATGLLLKAGVPLVPLVIGIAGAAFLNWKMQRSA |
| Ga0066710_1008228382 | 3300009012 | Grasslands Soil | MTMLMSWKFFVGACILAVGLLLKVGAPLVPVALGVAGAAFVNWKRQRS |
| Ga0066710_1027453391 | 3300009012 | Grasslands Soil | KWRWFVGSCILATGLLLKAGVPLVPLVAGIAGAAFLNWKMQRGA |
| Ga0099829_101040282 | 3300009038 | Vadose Zone Soil | MNWKYFIGSSILVAGLLIKLGAPVFAVALGIAGAAFFNWKKQRI* |
| Ga0099829_104755682 | 3300009038 | Vadose Zone Soil | MRWKFFIGACILSVGLLFKAGAPLVPVVLGIAGAAFFNWKKLRSE* |
| Ga0099830_113731741 | 3300009088 | Vadose Zone Soil | MKWKFFIGSCILAAGLLLKAGAPVVAVALGIAGAA |
| Ga0099827_117597321 | 3300009090 | Vadose Zone Soil | MKWKFFIGSCILATGLLLKAGAAVVAVALGIAGAAFLN |
| Ga0111539_124034732 | 3300009094 | Populus Rhizosphere | MSDISMKWKFYIGSCILVAGVLVKAGAPIVPIVAGLAIAGFVTWKLQRRSNGLTR* |
| Ga0075418_131111682 | 3300009100 | Populus Rhizosphere | MTKWKFFIGACILAVGLLLKTGAPIVPIVLGIALAAFVTW |
| Ga0105247_116356142 | 3300009101 | Switchgrass Rhizosphere | MKWKFFIGSCILVAGLLITFGAPSVPVAIGIAGAALITWKKLQRE* |
| Ga0066709_1001969052 | 3300009137 | Grasslands Soil | MTKWKFFIGACILAAGLLIKAGVPIVSIALGIALAAVVTWKSARRTKRLPR* |
| Ga0066709_1011823192 | 3300009137 | Grasslands Soil | MNWKFFIGSCILATGLLVKAGAPLVPIALGIAGAAVVNWKKQRV* |
| Ga0111538_133567991 | 3300009156 | Populus Rhizosphere | APDGSGRRIFGHFGSHVRRDDVEMKWKYFLGACILSVGLLLKAGAPILPIVLGIAGAAFFNWRRHRSE* |
| Ga0075423_119052702 | 3300009162 | Populus Rhizosphere | MKWKFFIGSCILAAGLLFKAGAPVVPIAAGIAIAA |
| Ga0105248_107868242 | 3300009177 | Switchgrass Rhizosphere | MKWKFFIGSSILAAGLLIKFGAPLVPVAIGIAAAAFLTWKKLQSE* |
| Ga0105248_111771413 | 3300009177 | Switchgrass Rhizosphere | MNWKFFIGSCILVAGLLLKAGAPIVPVAAGMALAAIITWRMQRRADGAPRSSR* |
| Ga0105248_124276152 | 3300009177 | Switchgrass Rhizosphere | RFFGHGRGGVRDYDVEMKWKFFIGSCILVAGLLVKFGAPIVPVAIGIAGAAFVTWKKLQRE* |
| Ga0105248_134450762 | 3300009177 | Switchgrass Rhizosphere | MKWKFFLGSSVLVAGLLIKFGAPLVPVAIGIAGAAFI |
| Ga0105249_122910492 | 3300009553 | Switchgrass Rhizosphere | MKWKFFIGSCILVAGLLIKFGAPIVPVAIGIAGAALITWKKLQR |
| Ga0126384_124617192 | 3300010046 | Tropical Forest Soil | MTTWKFFIGACILATGLLLKAGAPLVPVALGVAAAAFFNWKRQRTLPTKK* |
| Ga0126382_109700752 | 3300010047 | Tropical Forest Soil | MNWKFFVGASILSVGLLLKLGAPLVPVALGIAGAALVNWKTQRN* |
| Ga0099796_102361782 | 3300010159 | Vadose Zone Soil | MNWKYFIGSCILVAGLLIKVGAPVVAVALGIAGAAFVNWKRQRV* |
| Ga0134126_124403201 | 3300010396 | Terrestrial Soil | ADLRRYDVEMKWKFFVGACILSAGLLIKAGAPLVPIALGIVGAAFINWKKHRSD* |
| Ga0134121_121881951 | 3300010401 | Terrestrial Soil | MSWKLFVGASILSVGLLIKVGAPLIPVALGVAMAAAFNH |
| Ga0137392_108388641 | 3300011269 | Vadose Zone Soil | MKWKFFIGSCILAAGLLLKAGAPVVAVALGIAGAAFVNWKRQRA* |
| Ga0137389_109244512 | 3300012096 | Vadose Zone Soil | MRWKFFIGACILSVGLLFKAGAPLVPVILGIAGAAFFNWKKLRSE* |
| Ga0137399_104481501 | 3300012203 | Vadose Zone Soil | MKKWRWFVGSCILATGLLLKAGVPLVPLVVGIAGAAFLNWKMQRSA* |
| Ga0137399_115694092 | 3300012203 | Vadose Zone Soil | CILATGLLLKAGVPLVPLVIGIAGAAFLNWKMQRSA* |
| Ga0137376_104139162 | 3300012208 | Vadose Zone Soil | MKWKFFVGACILSAGLMIKAGAPLVPVALGLAAAAFLTWKFQRSE* |
| Ga0137366_111191832 | 3300012354 | Vadose Zone Soil | MKWTYFIGASILSVGLLFKAGAPLVPVVIGVAAVAFLNWRKQSSR* |
| Ga0137360_112558631 | 3300012361 | Vadose Zone Soil | VEVKWKFFVGSCILATGLLLKAGAPVVAVARGIAGAAFLNWKRQ* |
| Ga0157354_10626821 | 3300012517 | Unplanted Soil | MRWKFFVGAAILSAGLLIKIGAPIVPIAAGIAAAAFLQ |
| Ga0137397_110009221 | 3300012685 | Vadose Zone Soil | MKKWRWFVGSCILATGLLLKAGVPLVPLVLGIAGAAFLNWKMQRSA* |
| Ga0137395_110719482 | 3300012917 | Vadose Zone Soil | VKWKFFIGSCILATGLLLKAGAPIVAIALGIAGAAFVNWKKQRT* |
| Ga0137416_108455482 | 3300012927 | Vadose Zone Soil | MKWKFFIGSCILATGLLLKAGAPIVPVVLGIAGAAFVNWKKQQA* |
| Ga0137410_117255362 | 3300012944 | Vadose Zone Soil | MEMKKWKWFVGSCILATGLLLKAGVPLVPLVAGIAGAAFLNWKMRRSA* |
| Ga0126375_112962972 | 3300012948 | Tropical Forest Soil | RGDGLAMSDHSMKWKFFLGSCILAAGLLIKAGAPIVPIAAGMAVAGLVTWKLQRRTTRLPR* |
| Ga0164300_110690292 | 3300012951 | Soil | FIGSCILVAGLLIKFGAPIVPVAIGIAGAAFITWKKLQRE* |
| Ga0126369_121374462 | 3300012971 | Tropical Forest Soil | MHWKFFIGSCILAAGLLVKAGAPLVPIAVGIALAAGLTWKRLRRPNGLPR* |
| Ga0164305_116741202 | 3300012989 | Soil | MKHWKYFVGACILAAGLLIKAGVPVVPIVIGIAGAAYLNWKRLASRA* |
| Ga0075352_11164061 | 3300014324 | Natural And Restored Wetlands | MKWKFFIGSSIIVAGALIKFGAPLIAVLIGIAAAAFITWKKLQSE* |
| Ga0137409_110358132 | 3300015245 | Vadose Zone Soil | MKWKFFVGACILSAGLVIKAGAPLVPVVLGLAAAAFLTWKLQRSE* |
| Ga0132258_100498948 | 3300015371 | Arabidopsis Rhizosphere | MHWKFFIGSCILVAGLLLKAGAPVVPIAAGMALAGIVTWKMQRRANGAPRSSR* |
| Ga0132258_101489404 | 3300015371 | Arabidopsis Rhizosphere | MKWKFFIGACILSVGLLLKAGAPLIPVALGIAGAAFFNWKKLRSE* |
| Ga0132258_101668595 | 3300015371 | Arabidopsis Rhizosphere | MNWKYFVGASILSVGILLKLGAPLVPVALGLVGAALVNWKTQRS* |
| Ga0132258_102129523 | 3300015371 | Arabidopsis Rhizosphere | MKWKFFLGSSILVAGLLIKFGAPLVPVAIGIAGAAFITWKKLQSE* |
| Ga0132257_1009798131 | 3300015373 | Arabidopsis Rhizosphere | MNWKFFVGASILSVGILLKLGAPLVPVALGLVGAALVNWKTQRS* |
| Ga0132257_1039277442 | 3300015373 | Arabidopsis Rhizosphere | WKYFVGSCILATGLLLKAGVPFAPIALGIAAAAYLNWKRLTPRA* |
| Ga0132255_1051304182 | 3300015374 | Arabidopsis Rhizosphere | TFFVGAAILAIGMLLAAGAPLVPITLGIAGAAIIHWRAQEP* |
| Ga0132255_1055190791 | 3300015374 | Arabidopsis Rhizosphere | MKWKFFVGATILSVGLILKAGAPLVPVLLGAAGAAVFFNWKKRRSE* |
| Ga0182041_104118092 | 3300016294 | Soil | MNGATMKWKFFVGSCILAAGLLIKAGAPIVPVAVGMAVAGLVTWKLQQRTNRLSR |
| Ga0163161_113480252 | 3300017792 | Switchgrass Rhizosphere | MKWKFFVGSSILVAGLLIKAGAPLIAILIGIAGAAFINWKRQRV |
| Ga0184604_100740941 | 3300018000 | Groundwater Sediment | MKWKFFVGACILSAGLLIKAGAPLVAIALGIGGAAFINWKKHR |
| Ga0184605_102681003 | 3300018027 | Groundwater Sediment | MKWKFFVGACILSAGLMIKAGAPLVPVVLGLAAAAFLTWKL |
| Ga0184608_100801752 | 3300018028 | Groundwater Sediment | MKKWRWFVGSCILATGLLLKAGVPLVPLVLGIAGAAFLNWKMQRSA |
| Ga0184608_104183752 | 3300018028 | Groundwater Sediment | MKWKFFVGACILSAGLMIKAGAPLVPVVLGLAAAAFLTWKFQRSE |
| Ga0187765_100065736 | 3300018060 | Tropical Peatland | MKWKFFVGATILTVGLMLKVGAPLVPIALGVAGAAFINWKKLKSE |
| Ga0184619_103417541 | 3300018061 | Groundwater Sediment | VEMKWKYFVGACILSAGLVIKAGAPLVPVVLGLAAAAFLTWKFQRSE |
| Ga0184619_105303162 | 3300018061 | Groundwater Sediment | MKWKFFVGACILSAGLMIKAGAPLVPVVLGLIAAAFLTWKFQRSE |
| Ga0187773_103511651 | 3300018064 | Tropical Peatland | MKWKFFVGATILTVGLMLKAGAPLVPIAIGVAGAAFVNWKKLQSE |
| Ga0184632_101158363 | 3300018075 | Groundwater Sediment | MKWKFFVGACILSAGLLIKAGAPLVPVALGLVAAAFLTWKLQRSE |
| Ga0184609_100467532 | 3300018076 | Groundwater Sediment | MEMKKWRWFVGSCILATGLLLKAGVPLVPLVLGIAGAAFLNWKMQRSA |
| Ga0184628_105003912 | 3300018083 | Groundwater Sediment | DVEMKWKFFIGSCIIVAGALIKLGAPIVPVAIGIAGAAFITWKKLQRE |
| Ga0066667_120339632 | 3300018433 | Grasslands Soil | MMNWKYFVGACILSAGLLFKAGAPLTAVAMGIAAATFINWRKQRSSR |
| Ga0190274_117187802 | 3300018476 | Soil | MNWKYFIGSCILVAGLLIKVGAPVVAVALGIAGAAFINWKRQRV |
| Ga0190274_123240492 | 3300018476 | Soil | DGGGGVRRYDVEMNWKYFIGSCILVAGLLIKVGAPVVAVALGIAGAAFINWKRQRV |
| Ga0184642_14169571 | 3300019279 | Groundwater Sediment | MEMKKWRWFVGSCILATGLLLKAGVPLVPLILGIAGAAFLNWKMQRSA |
| Ga0184642_15381043 | 3300019279 | Groundwater Sediment | MKWKFFVGACILSAGLMIKAGAPLVPVALGLAAAAFLTWKFQRSE |
| Ga0193707_10453003 | 3300019881 | Soil | MKWKFFVGACILSAGLLIKAGAPLVPIVLGIVGAAFINWKKHRSD |
| Ga0210382_100524172 | 3300021080 | Groundwater Sediment | MKWKFFVGACILSAGLVLKAGAPLVPVVLGLLAAACLTWKLQRSE |
| Ga0210380_104528712 | 3300021082 | Groundwater Sediment | MKWKFFIGSCIIVAGALIKLGAPIVPVAIGIAGAAFITWKKLQRE |
| Ga0222622_110085202 | 3300022756 | Groundwater Sediment | MKWKFFVGACILSAGLLIKAGAPLVPIALGIVGAAFINWKKHRSD |
| Ga0207697_101577292 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MKWKFFIGSCILVAGLLIKFGAPIVPVAIGIAGAALITWKKLQRE |
| Ga0207645_111161952 | 3300025907 | Miscanthus Rhizosphere | HAGADVRRYDVEMKWKFFVGACILSAGLLIKAGAPLVPIALGIAGAAFINWKTHRSD |
| Ga0207646_119500502 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKWKYFLGAAILAAGLAFKAGAPIAPIALGLAAAGLLTW |
| Ga0207681_108053272 | 3300025923 | Switchgrass Rhizosphere | MKWKFFVGACILSAGLLIKAGAPLVPIALGIAGAAFINWKTHRSD |
| Ga0207650_116280311 | 3300025925 | Switchgrass Rhizosphere | MKWKYFLGACILSVGLLLKAGAPLVPIGLGIAGAAFINWRTHRRE |
| Ga0207701_117117671 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MSWKLFVGASILSAGLLIKIGAPLVPIALGIAGAAFVNRWR |
| Ga0207691_105824842 | 3300025940 | Miscanthus Rhizosphere | MKWKFFIGSCILVAGLLVKFGAPIVPVAIGIAGAAFVTWKKLQRE |
| Ga0207711_103395192 | 3300025941 | Switchgrass Rhizosphere | MKWKFFIGSCILVAGLLIKFGAPIVPVAIGIAGAAFITWKKLQRE |
| Ga0207711_116583171 | 3300025941 | Switchgrass Rhizosphere | GRGGVRDYDVEMKWKFFIGSCILVAGLLVKFGAPIVPVAIGIAGAAFVTWKKLQRE |
| Ga0207679_111870281 | 3300025945 | Corn Rhizosphere | MKWKYFLGACILSVGLLLKAGAPLLPVVLGIAGAAFINWKKHRRE |
| Ga0207658_113666691 | 3300025986 | Switchgrass Rhizosphere | MSWKLFVGASILSVGLLIKAGAPLMPLVMGIAMAAFFN |
| Ga0207658_121369421 | 3300025986 | Switchgrass Rhizosphere | MSWKLFVGASILSAGLLIKVGAPLVPVALGIAGAAFVNR |
| Ga0207641_104637351 | 3300026088 | Switchgrass Rhizosphere | MKWKFFIGSCILVAGLLVKFGAPIVPVAIGIAGAAFVTWKK |
| Ga0207648_121200972 | 3300026089 | Miscanthus Rhizosphere | KFFIGTCILVAGLLLKFGAPIVPMAIGIAGAAFITWKKLQRE |
| Ga0207683_100428261 | 3300026121 | Miscanthus Rhizosphere | MSWKFFIGASILSAGLLIKVGAPLVPVVVGIAMAA |
| Ga0209376_11811431 | 3300026540 | Soil | MEMKKWRWFVGSCILATGLLLKAGVPLVPLVAGIAGAAFLNWKMQRSA |
| Ga0209814_101257742 | 3300027873 | Populus Rhizosphere | MNWKFFVGASILSIGLLLKLGAPLVPVALGIAAAALVNWKTQRN |
| Ga0209069_106856942 | 3300027915 | Watersheds | MKWKFFLGAAILSVGLLFKAGAPMVPIALGLALAAFLTWKKQRSE |
| Ga0137415_108294572 | 3300028536 | Vadose Zone Soil | MRWKFFIGACILSVGLLFKAGAPLVPVVLGIAGAAFFNWKKLRSE |
| Ga0137415_108615662 | 3300028536 | Vadose Zone Soil | MKWKFFIGSCILATGLLLKAGAPIVPVVLGIAGAAFVNWKKQQA |
| Ga0307282_100744572 | 3300028784 | Soil | MKWKFFVGACILSAGLVIKAGAPLVPVVLGLAAAAFLTWKLQRSE |
| Ga0307504_103755162 | 3300028792 | Soil | MNWKYFIGSSILVAGLLIKFHAPLFAVALGIAGAAFFNWKKQRI |
| Ga0307308_102579662 | 3300028884 | Soil | AGADVRRYDVEMKWKFFVGACILSAGLMIKAGAPLVPVVLGLIAAAFLTWKLQRSE |
| Ga0311334_111961862 | 3300029987 | Fen | MKWKYFLGACILSVGLLLKVRAPLVPVALGVAGAAVLNWKKRQRE |
| Ga0308189_100071273 | 3300031058 | Soil | MEMKKWTWFIGSCILATGILLKLGVPLVPLVAGIAGAAFLTWKMQ |
| Ga0308189_103915792 | 3300031058 | Soil | MKWKFFVGACILSAGLLIKAGAPLVPIALGIVGAAFINWKTHRSD |
| Ga0308197_102178651 | 3300031093 | Soil | MKWKFFVGACILSAGLMIKAGAPLVPVVLGLAAAAFLT |
| Ga0308187_101200652 | 3300031114 | Soil | MEMKKWTWFIGSCILATGILLKLGVPLVPLVAGIAGAAFLTWKMQRSA |
| Ga0307497_102053772 | 3300031226 | Soil | MKWKFFIGSCILVAGLLIKLGAPIVPVAIGIAGAAFITWKKLQSE |
| Ga0307506_104727121 | 3300031366 | Soil | MKWKFFIGSCIIVAGALIKFGAPIVPVAIGIAGAAFITWKKLQRE |
| Ga0310888_102547251 | 3300031538 | Soil | MNWKFFVGASILATGLLIKVGAPLVPLAIGIAMAALVNW |
| Ga0310917_103929062 | 3300031833 | Soil | MKWKFFIGSCILAAGLLIKAGAPIVPVAVGMAVAGLVTWKLQQRTNGLSR |
| Ga0306921_109656612 | 3300031912 | Soil | MKWKFFIGSCILAAGLLIKAGAPIVPVAVGMAVAGLVTWKLQQRTNRLSR |
| Ga0306921_121511872 | 3300031912 | Soil | MKWKFFIGSCILAAGLLVKAGAPIAPIAAGIALAAALTWKRLRRPNGLPR |
| Ga0306922_108789391 | 3300032001 | Soil | FFIGSCILAAGLLIKAGAPIVPVAVGMAVAGLVTWKLQQRTNRLSR |
| Ga0306920_1040529432 | 3300032261 | Soil | MKWKFFLGATILTVGLMLKAGAPLVPIALGVAGAAFINWKKLQSE |
| Ga0310914_102309802 | 3300033289 | Soil | FIGSCILAAGLLIKAGAPIVPVAVGMAVAGLVTWKLQQRTNRLSR |
| Ga0310810_100136417 | 3300033412 | Soil | MKWKFFVGACILTVGLLIKAGAPLVPIILGIAGAAFLNWKKQRSD |
| Ga0310811_110797592 | 3300033475 | Soil | MNWKFFIGSCILVAGLLLKAGAPIVPVAAGMALAAIITWRMQRRTDGAPRSSR |
| Ga0314792_105410_2_115 | 3300034667 | Soil | MKWKFFVGSSILVAGLLIKAGAPLIAILIGIAGAAFIN |
| Ga0314796_055440_655_765 | 3300034671 | Soil | MSWKLFVGASILSAGLLIKVGAPLIPVAMGIAMAAFF |
| ⦗Top⦘ |