Basic Information | |
---|---|
Family ID | F035338 |
Family Type | Metagenome |
Number of Sequences | 172 |
Average Sequence Length | 44 residues |
Representative Sequence | MNFIAILAALGLEQWRAFRWRGALERAFVRYARVLERKLNGGTA |
Number of Associated Samples | 149 |
Number of Associated Scaffolds | 172 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 65.68 % |
% of genes near scaffold ends (potentially truncated) | 97.67 % |
% of genes from short scaffolds (< 2000 bps) | 91.28 % |
Associated GOLD sequencing projects | 145 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.40 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (56.977 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (7.558 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.558 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (33.721 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.61% β-sheet: 0.00% Coil/Unstructured: 51.39% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 172 Family Scaffolds |
---|---|---|
PF13193 | AMP-binding_C | 48.26 |
PF00857 | Isochorismatase | 33.14 |
PF13279 | 4HBT_2 | 5.23 |
PF00501 | AMP-binding | 3.49 |
PF13450 | NAD_binding_8 | 1.74 |
PF03061 | 4HBT | 1.74 |
PF00420 | Oxidored_q2 | 0.58 |
PF16177 | ACAS_N | 0.58 |
PF00480 | ROK | 0.58 |
COG ID | Name | Functional Category | % Frequency in 172 Family Scaffolds |
---|---|---|---|
COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 33.14 |
COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 33.14 |
COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.16 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 56.98 % |
Unclassified | root | N/A | 43.02 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908044|A5_c1_ConsensusfromContig49550 | Not Available | 787 | Open in IMG/M |
3300001213|JGIcombinedJ13530_102549206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 575 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100574781 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1004 | Open in IMG/M |
3300004049|Ga0055493_10034833 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 892 | Open in IMG/M |
3300004057|Ga0055496_10120950 | Not Available | 637 | Open in IMG/M |
3300004114|Ga0062593_103101236 | Not Available | 532 | Open in IMG/M |
3300005293|Ga0065715_10778547 | Not Available | 619 | Open in IMG/M |
3300005340|Ga0070689_101829721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 554 | Open in IMG/M |
3300005353|Ga0070669_100523956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 986 | Open in IMG/M |
3300005365|Ga0070688_101135838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 626 | Open in IMG/M |
3300005466|Ga0070685_10247742 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
3300005468|Ga0070707_100159027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2201 | Open in IMG/M |
3300005546|Ga0070696_101023941 | Not Available | 691 | Open in IMG/M |
3300005548|Ga0070665_100541668 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
3300005568|Ga0066703_10744470 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300005578|Ga0068854_101213546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 676 | Open in IMG/M |
3300005617|Ga0068859_100324320 | Not Available | 1634 | Open in IMG/M |
3300005829|Ga0074479_11138264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 784 | Open in IMG/M |
3300005842|Ga0068858_100037621 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4488 | Open in IMG/M |
3300005844|Ga0068862_100907065 | Not Available | 867 | Open in IMG/M |
3300005844|Ga0068862_102746901 | Not Available | 504 | Open in IMG/M |
3300006032|Ga0066696_10345538 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 969 | Open in IMG/M |
3300006237|Ga0097621_102254705 | Not Available | 521 | Open in IMG/M |
3300006806|Ga0079220_11314716 | Not Available | 607 | Open in IMG/M |
3300006853|Ga0075420_100624363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 930 | Open in IMG/M |
3300007076|Ga0075435_101530004 | Not Available | 585 | Open in IMG/M |
3300009162|Ga0075423_12317713 | Not Available | 584 | Open in IMG/M |
3300009168|Ga0105104_10259465 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 950 | Open in IMG/M |
3300009177|Ga0105248_10861750 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
3300009551|Ga0105238_10481926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1240 | Open in IMG/M |
3300009792|Ga0126374_10941805 | Not Available | 673 | Open in IMG/M |
3300009792|Ga0126374_11687067 | Not Available | 526 | Open in IMG/M |
3300009870|Ga0131092_10407691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira | 1262 | Open in IMG/M |
3300010046|Ga0126384_10004597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 8433 | Open in IMG/M |
3300010047|Ga0126382_10247350 | Not Available | 1304 | Open in IMG/M |
3300010323|Ga0134086_10173742 | Not Available | 795 | Open in IMG/M |
3300010376|Ga0126381_101383394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1017 | Open in IMG/M |
3300010397|Ga0134124_10509711 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
3300010398|Ga0126383_11703918 | Not Available | 719 | Open in IMG/M |
3300012004|Ga0120134_1088697 | Not Available | 571 | Open in IMG/M |
3300012185|Ga0136619_10131546 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300012207|Ga0137381_10847114 | Not Available | 791 | Open in IMG/M |
3300012354|Ga0137366_10131118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1890 | Open in IMG/M |
3300012362|Ga0137361_11659768 | Not Available | 559 | Open in IMG/M |
3300012532|Ga0137373_10013822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 8265 | Open in IMG/M |
3300012532|Ga0137373_10024555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 5962 | Open in IMG/M |
3300012533|Ga0138256_10835774 | Not Available | 706 | Open in IMG/M |
3300012975|Ga0134110_10128215 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
3300013296|Ga0157374_12257519 | Not Available | 571 | Open in IMG/M |
3300013306|Ga0163162_11185763 | Not Available | 866 | Open in IMG/M |
3300014166|Ga0134079_10468287 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300014874|Ga0180084_1131853 | Not Available | 524 | Open in IMG/M |
3300014969|Ga0157376_11948632 | Not Available | 625 | Open in IMG/M |
3300015077|Ga0173483_10708827 | Not Available | 569 | Open in IMG/M |
3300015085|Ga0167632_1046664 | Not Available | 542 | Open in IMG/M |
3300015201|Ga0173478_10251369 | Not Available | 773 | Open in IMG/M |
3300015360|Ga0163144_10856669 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300015371|Ga0132258_11273435 | Not Available | 1858 | Open in IMG/M |
3300015371|Ga0132258_12719583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1234 | Open in IMG/M |
3300015372|Ga0132256_103406623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 535 | Open in IMG/M |
3300015373|Ga0132257_101984838 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300015373|Ga0132257_102784755 | Not Available | 637 | Open in IMG/M |
3300015374|Ga0132255_102751143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 752 | Open in IMG/M |
3300015374|Ga0132255_103488703 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 669 | Open in IMG/M |
3300017792|Ga0163161_10975498 | Not Available | 722 | Open in IMG/M |
3300017792|Ga0163161_11443289 | Not Available | 602 | Open in IMG/M |
3300017959|Ga0187779_10610766 | Not Available | 731 | Open in IMG/M |
3300018072|Ga0184635_10277359 | Not Available | 661 | Open in IMG/M |
3300018431|Ga0066655_11455601 | Not Available | 500 | Open in IMG/M |
3300018476|Ga0190274_12249872 | Not Available | 642 | Open in IMG/M |
3300018482|Ga0066669_11327206 | Not Available | 651 | Open in IMG/M |
3300019361|Ga0173482_10436694 | Not Available | 618 | Open in IMG/M |
3300020001|Ga0193731_1171293 | Not Available | 520 | Open in IMG/M |
3300020022|Ga0193733_1154253 | Not Available | 619 | Open in IMG/M |
3300020167|Ga0194035_1267460 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 507 | Open in IMG/M |
3300021080|Ga0210382_10185838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 900 | Open in IMG/M |
3300021082|Ga0210380_10084997 | Not Available | 1391 | Open in IMG/M |
3300021432|Ga0210384_11554317 | Not Available | 567 | Open in IMG/M |
3300022549|Ga0212091_10337283 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 621 | Open in IMG/M |
3300022756|Ga0222622_10229772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1247 | Open in IMG/M |
3300022756|Ga0222622_10754602 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300025558|Ga0210139_1023633 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
3300025906|Ga0207699_10077855 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2047 | Open in IMG/M |
3300025907|Ga0207645_10293563 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
3300025908|Ga0207643_10683586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 663 | Open in IMG/M |
3300025925|Ga0207650_10431989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1094 | Open in IMG/M |
3300025930|Ga0207701_11560753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 533 | Open in IMG/M |
3300025937|Ga0207669_10327289 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
3300025937|Ga0207669_10680863 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 844 | Open in IMG/M |
3300025938|Ga0207704_10598555 | Not Available | 902 | Open in IMG/M |
3300025938|Ga0207704_11112925 | Not Available | 671 | Open in IMG/M |
3300025966|Ga0210105_1015718 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1092 | Open in IMG/M |
3300025972|Ga0207668_10949437 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 767 | Open in IMG/M |
3300025972|Ga0207668_11329232 | Not Available | 647 | Open in IMG/M |
3300025986|Ga0207658_10024204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4246 | Open in IMG/M |
3300026023|Ga0207677_12152160 | Not Available | 519 | Open in IMG/M |
3300026088|Ga0207641_10275843 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
3300026088|Ga0207641_12515523 | Not Available | 513 | Open in IMG/M |
3300026095|Ga0207676_11256539 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300026121|Ga0207683_11234188 | Not Available | 693 | Open in IMG/M |
3300026121|Ga0207683_11298184 | Not Available | 674 | Open in IMG/M |
3300026281|Ga0209863_10098177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 862 | Open in IMG/M |
3300027719|Ga0209467_1313660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 518 | Open in IMG/M |
3300027885|Ga0209450_10433950 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
3300027890|Ga0209496_10717182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 548 | Open in IMG/M |
3300027897|Ga0209254_10220773 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
3300027900|Ga0209253_10276929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1311 | Open in IMG/M |
3300027915|Ga0209069_10367302 | Not Available | 781 | Open in IMG/M |
3300028379|Ga0268266_11947248 | Not Available | 561 | Open in IMG/M |
3300028381|Ga0268264_10600800 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
3300028739|Ga0302205_10072604 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300028740|Ga0302294_10073675 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300028861|Ga0302259_1091310 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300029980|Ga0302298_10130455 | Not Available | 802 | Open in IMG/M |
3300030003|Ga0302172_10161931 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300030047|Ga0302286_10418451 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300030114|Ga0311333_10864418 | Not Available | 761 | Open in IMG/M |
3300030336|Ga0247826_10865184 | Not Available | 711 | Open in IMG/M |
3300030339|Ga0311360_11147551 | Not Available | 612 | Open in IMG/M |
3300030943|Ga0311366_10276905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1453 | Open in IMG/M |
3300030943|Ga0311366_10648284 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 918 | Open in IMG/M |
3300030943|Ga0311366_11039452 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
3300031232|Ga0302323_102158986 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300031521|Ga0311364_10399360 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
3300031521|Ga0311364_11471213 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300031538|Ga0310888_10744455 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 604 | Open in IMG/M |
3300031543|Ga0318516_10072741 | Not Available | 1909 | Open in IMG/M |
3300031720|Ga0307469_10348676 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1242 | Open in IMG/M |
3300031740|Ga0307468_100501465 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
3300031740|Ga0307468_101014461 | Not Available | 731 | Open in IMG/M |
3300031740|Ga0307468_101907005 | Not Available | 566 | Open in IMG/M |
3300031772|Ga0315288_10571524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1097 | Open in IMG/M |
3300031781|Ga0318547_10059944 | Not Available | 2077 | Open in IMG/M |
3300031834|Ga0315290_11548484 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300031858|Ga0310892_10081919 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1712 | Open in IMG/M |
3300031873|Ga0315297_10744326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 819 | Open in IMG/M |
3300031879|Ga0306919_10294411 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
3300031879|Ga0306919_10810791 | Not Available | 719 | Open in IMG/M |
3300031941|Ga0310912_10487962 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
3300031954|Ga0306926_12074505 | Not Available | 637 | Open in IMG/M |
3300031996|Ga0308176_12787496 | Not Available | 520 | Open in IMG/M |
3300031999|Ga0315274_10212189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2387 | Open in IMG/M |
3300032043|Ga0318556_10650002 | Not Available | 549 | Open in IMG/M |
3300032076|Ga0306924_12640621 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
3300032156|Ga0315295_10653802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1063 | Open in IMG/M |
3300032173|Ga0315268_10257115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1683 | Open in IMG/M |
3300032173|Ga0315268_12530315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 527 | Open in IMG/M |
3300032180|Ga0307471_100145499 | Not Available | 2268 | Open in IMG/M |
3300032205|Ga0307472_101985197 | Not Available | 582 | Open in IMG/M |
3300032275|Ga0315270_11134576 | Not Available | 520 | Open in IMG/M |
3300032516|Ga0315273_11402424 | Not Available | 865 | Open in IMG/M |
3300032770|Ga0335085_12430677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 521 | Open in IMG/M |
3300032828|Ga0335080_10100366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3211 | Open in IMG/M |
3300033004|Ga0335084_10592089 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
3300033233|Ga0334722_10964965 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300033233|Ga0334722_11111904 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300033413|Ga0316603_10600697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1021 | Open in IMG/M |
3300033414|Ga0316619_11190921 | Not Available | 672 | Open in IMG/M |
3300033414|Ga0316619_11411110 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300033418|Ga0316625_100765429 | Not Available | 822 | Open in IMG/M |
3300033418|Ga0316625_102629530 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 512 | Open in IMG/M |
3300033419|Ga0316601_101982220 | Not Available | 587 | Open in IMG/M |
3300033434|Ga0316613_10997120 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
3300033485|Ga0316626_10651003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 913 | Open in IMG/M |
3300033513|Ga0316628_101602376 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
3300033521|Ga0316616_103314177 | Not Available | 607 | Open in IMG/M |
3300034129|Ga0370493_0003922 | All Organisms → cellular organisms → Bacteria | 4036 | Open in IMG/M |
3300034157|Ga0370506_085019 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300034354|Ga0364943_0389076 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.56% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 7.56% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 6.40% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.49% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.49% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.49% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.49% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.33% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.33% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.91% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.74% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.74% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.74% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.74% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.74% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.74% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.16% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.16% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.16% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.16% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.16% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.16% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.58% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.58% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.58% |
Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.58% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.58% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.58% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.58% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.58% |
Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.58% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.58% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.58% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.58% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.58% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.58% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.58% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.58% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.58% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.58% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.58% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.58% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.58% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.58% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.58% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.58% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.58% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.58% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.58% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.58% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.58% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.58% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.58% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.58% |
Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.58% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004049 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2 | Environmental | Open in IMG/M |
3300004057 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
3300012004 | Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M | Environmental | Open in IMG/M |
3300012185 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ353 (21.06) | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012533 | Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG | Engineered | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014874 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_2_16_10D | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015085 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300015360 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
3300020167 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L239-20m | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300022549 | Cold Creek_combined assembly | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025558 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025966 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
3300027719 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E1_3 | Environmental | Open in IMG/M |
3300028740 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_3 | Environmental | Open in IMG/M |
3300028861 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_4 | Environmental | Open in IMG/M |
3300029980 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3 | Environmental | Open in IMG/M |
3300030003 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3 | Environmental | Open in IMG/M |
3300030047 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3 | Environmental | Open in IMG/M |
3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300034129 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_16 | Environmental | Open in IMG/M |
3300034157 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_18 | Environmental | Open in IMG/M |
3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
3300034358 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_16 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
A5_c1_00942130 | 2124908044 | Soil | MNFIAILVALGLEQSRAFQWRNGVQRLFGRYARFLERRF |
JGIcombinedJ13530_1025492062 | 3300001213 | Wetland | MNFIAILAALGLEQWRAFRWRGALERAFVRYARVLERKLNGGTA |
JGIcombinedJ26739_1005747814 | 3300002245 | Forest Soil | MNFIAILVALGLEQWRAFQWRNGVQRLFGRYARFLERRFN |
Ga0055493_100348331 | 3300004049 | Natural And Restored Wetlands | VNLLAILVALGLEQWRTLAWRDAVARAFVRYARDLERKLN |
Ga0055496_101209501 | 3300004057 | Natural And Restored Wetlands | VNFLAILVALGLEQWRAFGWRDAVGRSFVRYARDLERKLNGGRPEQALLATAA |
Ga0062593_1031012361 | 3300004114 | Soil | MNFLAALAALGLEQWRAFRWRDSLERAFVRYARMIERKLNGGTAQQGLI |
Ga0065715_107785471 | 3300005293 | Miscanthus Rhizosphere | MNVIAIVAALGIEQWRTFRWRGALQQAFIRYARWLEHRFNGGSA |
Ga0070670_1002795081 | 3300005331 | Switchgrass Rhizosphere | MSFLALVAALGLEQWRAFSWRASVERAFVRYARWIERKWNGGTAQHGWLALVVAI |
Ga0070689_1018297211 | 3300005340 | Switchgrass Rhizosphere | MNVIAILAALGLEQWRAFRWRAALEQLFVRYARTLERKLNGGSAEQGSVATLAAVA |
Ga0070669_1005239562 | 3300005353 | Switchgrass Rhizosphere | MSFLAILLALGLEQWRAFDWRAGVERAFVRYVRTLERKLNGGTRQHGVLAVIA |
Ga0070688_1011358382 | 3300005365 | Switchgrass Rhizosphere | MNLLAILAALGLEQWRAFAWRVAVERAFVGYARRLERQLNGGT |
Ga0070685_102477421 | 3300005466 | Switchgrass Rhizosphere | MNVIAILAALGLEQWRAFQWRAALEHFFIQYARAVERKLNGGTA |
Ga0070707_1001590271 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VNLLAILAALGLEQWRTFRWRGGLQRAFVRYGRALERRFNAG |
Ga0070696_1010239412 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VNVIAILAALGLEQWRAFHWRAALEQLFVRYARALERKLNGGTAQ |
Ga0070665_1005416682 | 3300005548 | Switchgrass Rhizosphere | MNVIAILAALGLEQWRAFQWRSALEHSFIQYARAVERK |
Ga0066703_107444701 | 3300005568 | Soil | MNFIAVLAALGLEQWRAFRWRAALERAFRAYARWL |
Ga0068854_1012135462 | 3300005578 | Corn Rhizosphere | MSLVAILVALGLEQWRAFDWRASVERAFVTYARTVERKFNGGTYQHGVFATVA |
Ga0068859_1003243202 | 3300005617 | Switchgrass Rhizosphere | MTLLAILAALGLEQWRAFEWRAAVERASVGYARRLERQFNG |
Ga0074479_111382643 | 3300005829 | Sediment (Intertidal) | MNIIAILAALGLEQWRAFHWRVAMEGLFIRYARGVERK |
Ga0068858_1000376215 | 3300005842 | Switchgrass Rhizosphere | MNVIAIVAALGIEQWRTFRWRGALQQAFIRYARWLEHRF |
Ga0068862_1009070651 | 3300005844 | Switchgrass Rhizosphere | MNVIAILAALGLEQWRAFQWRSALEHSFIQYARAVERKLNG |
Ga0068862_1027469012 | 3300005844 | Switchgrass Rhizosphere | LNLIAILSALGLEQWRAFRWRASVEHAFVRYARAIERRLN |
Ga0066696_103455382 | 3300006032 | Soil | MNLLAILAALGLEQWHAFRWRAGAERTFVGYVRQLERKLNG |
Ga0097621_1022547052 | 3300006237 | Miscanthus Rhizosphere | MNFLAALAALGLEQWRAFRWRDSLERAFVRYARMIERKLNGG |
Ga0079220_113147162 | 3300006806 | Agricultural Soil | LNLIAILSALGLEQWRAFRWRASVEHAFIRYARAIERRLNGGTLQQGAIATVIA |
Ga0075420_1006243632 | 3300006853 | Populus Rhizosphere | MTLLAILAALGLEQWRAFEWRAAAERTFVAFARQLERQLNGGSA |
Ga0075435_1015300041 | 3300007076 | Populus Rhizosphere | MNLLAILAALGLEQWHAFRWRASAERAFASYVRRLERKLNGGTRGQGAVATV |
Ga0075423_123177131 | 3300009162 | Populus Rhizosphere | MTLLAVLAALGLEQWRAFEWRAAAERVFVAYARRLE |
Ga0105104_102594651 | 3300009168 | Freshwater Sediment | VNFLAILIALGVEQWRTFGWRDAIARSFVRYARDLERKLN |
Ga0105248_108617501 | 3300009177 | Switchgrass Rhizosphere | MNLLAILAALGLEQWRAFAWRVAVERAFVGYARRLERQLNG |
Ga0105238_104819261 | 3300009551 | Corn Rhizosphere | MNVIAIVAALGIEQWRTFRWRGALQQAFIRYARWLE |
Ga0126374_109418051 | 3300009792 | Tropical Forest Soil | LNLIAILSALGLEQWRAFRWRASVERAFVQYARAIERRLNAGTAQQGTIATVL |
Ga0126374_116870672 | 3300009792 | Tropical Forest Soil | MTFLAVIAALGLEQWRAFRWRSGVQHAFVRYAKLLERRL |
Ga0131092_104076911 | 3300009870 | Activated Sludge | VSLIALLAALGLEQWRAFEWRAGAERAFVRYARSL |
Ga0126384_100045978 | 3300010046 | Tropical Forest Soil | MNFLAVIAALGLEQWRAFHWRAGVQRGFVRYAKFLEQRFNGGKA |
Ga0126382_102473501 | 3300010047 | Tropical Forest Soil | MNFLAVIAALGLEQWRAFQWRGGAQHGFIRYAKFLEQRFNGG |
Ga0134086_101737421 | 3300010323 | Grasslands Soil | MNLLAILAALGLEQWHAFRWRAGAERAFVGSARSVELNVNGGTAGQGAV |
Ga0126381_1013833941 | 3300010376 | Tropical Forest Soil | VNFIAVLAAIGLEQWRAFRWRAGLEHAFVAYAHWLEEKLDGGTTRQGIVAVI |
Ga0134124_105097112 | 3300010397 | Terrestrial Soil | LNLIAILSALGLEQWRAFRWRASVEHAFVRYARAIERRLNGGTLQQGAIA |
Ga0126383_117039182 | 3300010398 | Tropical Forest Soil | MTLLAVIAALALEQWRAFRWRGAVQQAFVRYARLLEQRLNGG |
Ga0137776_11939512 | 3300010937 | Sediment | VNFLAIVAALGLEQWRAFEWRGALQRAFVRYGHALERRFNAGTTQQGVIAAVLA |
Ga0120134_10886971 | 3300012004 | Permafrost | MNVIAIVVALGVEQWRTFRWRGALQQAFTRYARWLEHRFNGGSAQHG |
Ga0136619_101315462 | 3300012185 | Polar Desert Sand | LNFLAILAALGLEQWSAFHWRVAVERSFVQYARGIEHRFNGGTTQH |
Ga0137381_108471142 | 3300012207 | Vadose Zone Soil | VNLLAILAALGLEQWRTFRWRGGLQRAFVRYGRALERRF |
Ga0137366_101311183 | 3300012354 | Vadose Zone Soil | MNFIAVLAALGLEQWRAFRWRGALERAFVLYVRRIEEKL |
Ga0137361_116597681 | 3300012362 | Vadose Zone Soil | MNLLAILAALGLEQWHAFRWRAAAERAFVGYARRLERKLNGG |
Ga0137373_100138227 | 3300012532 | Vadose Zone Soil | MNFIAVLAALGLEQWRAFGPRVALERAFIRYARALER |
Ga0137373_100245557 | 3300012532 | Vadose Zone Soil | MNFIAVLAALGLEQWRAFRWRGALERAFVLYVRRIEEKLNGGTRQQGVVAAILALAP |
Ga0138256_108357742 | 3300012533 | Active Sludge | VSLLAILAALGLEQWHAPGWRVSIERAFVRQARALERRFNGGKA |
Ga0134110_101282152 | 3300012975 | Grasslands Soil | MNLLAIVMALALEQCRTFRWRGGAQRAFIRYARWLEQRFNA |
Ga0157374_122575191 | 3300013296 | Miscanthus Rhizosphere | MSLVAILLALGLEQWRAFDWRAGVERAFVRYARLLERKLNGGTRQHGVIAAIAA |
Ga0163162_111857631 | 3300013306 | Switchgrass Rhizosphere | MSLIAILLALGLEQWRAFDWRAGVERAFVRYVRMLERKLNGGTRQHGVLAVIAA |
Ga0134079_104682871 | 3300014166 | Grasslands Soil | MNFIAVLAALGLEQWRAFRWRAALERAFRAYARWLDEKLN |
Ga0180084_11318531 | 3300014874 | Soil | MSFLALVAALGLEQWRAFSWRASVERAFVRYARWIERKWN |
Ga0157376_119486321 | 3300014969 | Miscanthus Rhizosphere | MNFLAVLAALGLEQWRAFRWRVELERGYVRYIRAIERKLNGGTA |
Ga0173483_107088272 | 3300015077 | Soil | MNFIAVLAALGLEQWRAFHWRATLEHLFVRYARAVERKLNGGTSHHALIATLA |
Ga0167632_10466642 | 3300015085 | Glacier Forefield Soil | MNLIAILIALGLEQWRAFRWRNGVQQLFGRYARFLERHFSA |
Ga0173478_102513692 | 3300015201 | Soil | LTLLAIIAALAFEQWHAPGWRVAIESAYVRHAHRLERMF |
Ga0163144_108566692 | 3300015360 | Freshwater Microbial Mat | MSFLAILIALGLEQWRAFDWRTAGERAFVRYARAGEREPNGGT |
Ga0132258_112734352 | 3300015371 | Arabidopsis Rhizosphere | MNLLAILAALGLEQWHAFRWRAGAERVFATYIRRLERKLNG |
Ga0132258_127195831 | 3300015371 | Arabidopsis Rhizosphere | VNFIAVLAALGLEQWRAFRWRAGLEHAFVAYAHWLEEKLDGGTTRQGVVALIA |
Ga0132256_1034066232 | 3300015372 | Arabidopsis Rhizosphere | MNFIAILAALGLEQWRAFHWRGALERVFVRYVRALERKLD |
Ga0132257_1019848381 | 3300015373 | Arabidopsis Rhizosphere | MNVIAILAALGLEQWRRFRWRAALERLFVRYARTLERKLNGGSAQQG |
Ga0132257_1027847552 | 3300015373 | Arabidopsis Rhizosphere | MNFIAVLAALGLEQWRAFRWRAALERAFIGYARWLD |
Ga0132255_1027511432 | 3300015374 | Arabidopsis Rhizosphere | MNFIAILAALGLEQWRAFHWRGALERVFVRYVRVLERKLDG |
Ga0132255_1034887031 | 3300015374 | Arabidopsis Rhizosphere | MNFIAILAALGLEQWRAFQWRGALEKGSLRYVRALERRLNGGRMEQGVI |
Ga0163161_109754983 | 3300017792 | Switchgrass Rhizosphere | MSLIAILAALGLEQWRAFDWRASVERAFVSYARTL |
Ga0163161_114432891 | 3300017792 | Switchgrass Rhizosphere | MNVIAILAALGLEQWRAFRWRAALEQLFVRYARTLERKLNGGSAEQGS |
Ga0187779_106107662 | 3300017959 | Tropical Peatland | MNFLAVIAALGLEQWRAFHWRGGTQRAFVRYAKFLEQRFNGGKA |
Ga0184635_102773591 | 3300018072 | Groundwater Sediment | MSLIAILAALGLEQWRAFDWRASVERAFVGYARMLERKFNGGTYQHGIFAT |
Ga0066655_114556012 | 3300018431 | Grasslands Soil | MNLLAILAALGLEQWHAFRWRAGAERVFATYIRRLERK |
Ga0190274_122498721 | 3300018476 | Soil | MTLLAILAALGLEQWRAFEWRAGAERWFVGLARRLE |
Ga0066669_113272062 | 3300018482 | Grasslands Soil | MNFIAVLAALGLEQWRAFRWRAALERVFIGYTRWLDAKLNA |
Ga0173482_104366942 | 3300019361 | Soil | MNVIAIVAALGIEQWRTFRWRGALQQAFIRYARWLEHRFN |
Ga0193731_11712931 | 3300020001 | Soil | MNLLAILAALGLEQWHAFRWRAAAERAFVAYARRLE |
Ga0193733_11542531 | 3300020022 | Soil | MNLLAILAALGLEQWHAFRWRAAAERAFVAYARRLERKLNGGTV |
Ga0194035_12674601 | 3300020167 | Anoxic Zone Freshwater | LSFLAVIAALGLEQWRAFHWRGALERLFVRYARLLERKLNGGSAHQGAIAMAAALAP |
Ga0210382_101858383 | 3300021080 | Groundwater Sediment | MNLAAILIALGLEQWRAFRWRNGVQQLFGRYARFL |
Ga0210380_100849971 | 3300021082 | Groundwater Sediment | MNVIAILAALGLEQWRAFQWRAALEHFFIQYARAVERKLNGG |
Ga0210384_115543172 | 3300021432 | Soil | VNLLAIVVALALEQWRTFRWRGGLQHAFVRYGRALERRFNGGAAKQGV |
Ga0212091_103372832 | 3300022549 | Groundwater | MNFLAVLAAIGLEQWRAFHWRGALERLFVSYVRTLERKFNGGTAQQGAI |
Ga0222622_102297721 | 3300022756 | Groundwater Sediment | MSFLAILAAIGLEQWRAFAWRARVERAFVRYARWIERRWNG |
Ga0222622_107546022 | 3300022756 | Groundwater Sediment | MNLLAILAALGLEQWRAFAWRVAVERAFVGYARRLERQLNGGTPGQGA |
Ga0210139_10236331 | 3300025558 | Natural And Restored Wetlands | MNIIAVLAALALEQWRAFRWRAGVERVFVRYARAV |
Ga0207699_100778553 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MNVIAIVVALGIEQWRTFRWRGALQQAFIRYARWLEHRFNGGSAQQ |
Ga0207645_102935631 | 3300025907 | Miscanthus Rhizosphere | MIFVAILAALGLEQWRPCPWRPALERAFCGYARTLEHRFNGG |
Ga0207643_106835861 | 3300025908 | Miscanthus Rhizosphere | MNLIAILSALGLEQWRAFRWRASVERVFVQYVRAVERRLNGGTTQQGMAATVIAL |
Ga0207650_104319893 | 3300025925 | Switchgrass Rhizosphere | MNFLAIVAALGLEQWRAFRWRVGLERTFVRWTRRLERSL |
Ga0207701_115607532 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFLAIVAALGLEQWRAFRWRVGLERTFVRWTRRLERSLNGGTL |
Ga0207669_103272891 | 3300025937 | Miscanthus Rhizosphere | VSLLAILIALGLEQWHAFRWRAAAERLFVAYARSLERK |
Ga0207669_106808631 | 3300025937 | Miscanthus Rhizosphere | MNLIAILSALGLEQWRAFRWRASVERVFVQYVRAVERRLNGGT |
Ga0207704_105985552 | 3300025938 | Miscanthus Rhizosphere | MNFIAVLAALGLEQWRAFHWRATLEQLFVRYARAVERKLNGGTTQHALIGTLAAVG |
Ga0207704_111129251 | 3300025938 | Miscanthus Rhizosphere | MNVIAILAALGLEQWRAFQWRSALEHSFIQYARAVE |
Ga0210105_10157182 | 3300025966 | Natural And Restored Wetlands | VNFLAILVALGLEQWRAFGWRDAVGRSFVRYARDLERKLNGGRPEQALLATAAATVMPNS |
Ga0207668_109494372 | 3300025972 | Switchgrass Rhizosphere | VNFIAILAAIGLEQWRPCPWRIPIERLFVDYVRGLEHRLN |
Ga0207668_113292322 | 3300025972 | Switchgrass Rhizosphere | MTLLAILAALGLEQWRAFEWRAAVERAFVGYARRL |
Ga0207658_100242041 | 3300025986 | Switchgrass Rhizosphere | MNVIAIVAALGIEQWRTFRWRGALQQAFIRYARWLEHRFNGGSAQQGA |
Ga0207677_121521602 | 3300026023 | Miscanthus Rhizosphere | MNLLAILAALGLEQWRAFLWRVAAEHAFVGYARRLERQLNGGT |
Ga0207641_102758431 | 3300026088 | Switchgrass Rhizosphere | MSLVAILLALGLEQWRAFDWRAGVERAFVRYARLLERKLNGGTRQHGVIAA |
Ga0207641_125155232 | 3300026088 | Switchgrass Rhizosphere | MTLLAILAALGLEQWRAFEWRAAVERAFVGYARRLERQF |
Ga0207676_112565391 | 3300026095 | Switchgrass Rhizosphere | LNFLAALAALGLEQWRAFRWRDSLERVFIRYARVVERKLNGGTT |
Ga0207683_112341882 | 3300026121 | Miscanthus Rhizosphere | MSFVAILVALGLEQWRAFEWRAAVERSFVRYARTLERKLNGGTRQHG |
Ga0207683_112981842 | 3300026121 | Miscanthus Rhizosphere | MNFLAILAALGLEQWRAFRWRVELERRFVRFVRTVERKLNSGSAQQGLIATLVT |
Ga0209863_100981773 | 3300026281 | Prmafrost Soil | VSFLAILAALGLEQWRAFSWRAGVERGFVRYARWIERRWNGGTA |
Ga0209467_13136602 | 3300027719 | Freshwater | MNFLAILVALALEQWQAFRWRAAFERVFVRYSRGVERRLNG |
Ga0209450_104339501 | 3300027885 | Freshwater Lake Sediment | MNLLAILAALALEQWRAFRWRAAVERLFVRWARAIERRFNGGAPQHGVLGAALA |
Ga0209496_107171822 | 3300027890 | Wetland | MNFIVILAALGLEQWRAFEWRASVERAFVRYVRTIERK |
Ga0209254_102207733 | 3300027897 | Freshwater Lake Sediment | VNFLSILIALGVEQWRTFGWRDAIARSFVRYARDLERKLNGG |
Ga0209253_102769291 | 3300027900 | Freshwater Lake Sediment | MNIIAILAALGLEQWRAFHWRVAMEGLYIRYARGVERKLNDGT |
Ga0209069_103673022 | 3300027915 | Watersheds | MNLIAVLAALGLEQWRAFRWRATLERLFIGYARAVERKLNGGA |
Ga0268266_119472481 | 3300028379 | Switchgrass Rhizosphere | MNVIAILAALGLEQWRAFQWRSALEHSFIQYARAVERKLNGGT |
Ga0268264_106008002 | 3300028381 | Switchgrass Rhizosphere | LNLLAILAALALEQWHAPAWRVAIERAFVRHARRLERLFNGGTAT |
Ga0302205_100726041 | 3300028739 | Fen | VSFLALLAALGLEQWRAFSWRAGVEHAFVRYARWI |
Ga0302294_100736753 | 3300028740 | Fen | VSFLALLAALGLEQWRAFSWRAGVEHAFVWYARWIERRWNG |
Ga0302259_10913102 | 3300028861 | Fen | MNFIAILAALGLEQWRAFRWRAALERAFIAYARWL |
Ga0302298_101304553 | 3300029980 | Fen | LSFLAVLVALGLEQWRAFSWRNAAERQFVRYARWIERRW |
Ga0302172_101619311 | 3300030003 | Fen | VSFLALLAALGLEQWRAFSWRAGVEHAFVRYARWIERRWNGGTAQ |
Ga0302286_104184512 | 3300030047 | Fen | VSFLALLAALGLEQWRAFSWRAGVEHAFVWYARWIERRWNGGTTQHGWL |
Ga0311333_108644182 | 3300030114 | Fen | LSFLAVLVALGLEQWRAFSWRNAAERQFVRYARWIERRWNGGT |
Ga0247826_108651842 | 3300030336 | Soil | VNLLAILAALGLEQWHAPRWRVAIERAFVRQAHRLERMFNGGTA |
Ga0311360_111475511 | 3300030339 | Bog | MSFLAILAALGLEQWRAFSWRAGAERAFVRYARWIERRWNGGTAQHG |
Ga0311366_102769051 | 3300030943 | Fen | MSFLAVLVALGLEQWRAFSWRTGVERQFVRYARWIERRWN |
Ga0311366_106482843 | 3300030943 | Fen | VSFLALLAALGLEQWRAFSWRAGVEHAFVRYARWIERRWNGGTA |
Ga0311366_110394521 | 3300030943 | Fen | VSFLALLAALGLEQWRAFSWRAGVEHAFVRYARWIERRWNGGTTQH |
Ga0302323_1021589861 | 3300031232 | Fen | MNFIAVLVALGLEQWRAFRWRAVLERLFVRSARAVERKLNGGTARQG |
Ga0311364_103993601 | 3300031521 | Fen | MSLLAILAALGFEQWRAFDWRAGVERAFVRYARMLERKFNGG |
Ga0311364_114712132 | 3300031521 | Fen | VSFLALLAALGLEQWRAFSWRAGFERAFVRYARWIEGRWNGGTAQH |
Ga0310888_107444552 | 3300031538 | Soil | VNLLAILAALGLEQWHAPRWRVAIERAFVRQAHRLERMFN |
Ga0318516_100727412 | 3300031543 | Soil | MSLIAILAALGLEQWHAFHWRASIERAFVLLARRLEQRLNGGTRTQ |
Ga0307469_103486761 | 3300031720 | Hardwood Forest Soil | MNVIVIVAALGIEQWRTFRWRGALQQAFIRYARWLEHRFNGGSAQQ |
Ga0307468_1005014651 | 3300031740 | Hardwood Forest Soil | MNLIAILSALGLEQWRAFHWRASVEQVFVQYARAIERRLNGGTVQQ |
Ga0307468_1010144612 | 3300031740 | Hardwood Forest Soil | MNFIAVLAALGLEQWRAFHWRATLEHLFVRYARAVEHKLNGGATHHALVATLAT |
Ga0307468_1019070052 | 3300031740 | Hardwood Forest Soil | MNLLAILAALGLEQWRAFRWRAAFERAFVDYARRLEHRLNAGEFSQG |
Ga0315288_105715241 | 3300031772 | Sediment | MNIIAILAALGLEQWRAFHWRVAMEDLFIRYARRVERKLNDGTAQHGLVATL |
Ga0318547_100599441 | 3300031781 | Soil | MSLIAILAALGLEQWHAFHWRASIERAFVLLARRLEQRLNGGTRTQGSIALL |
Ga0315290_115484841 | 3300031834 | Sediment | MNIIAVLAALGLEQWRAFRWRGALEQLFVRYARAVERRLNGGTAQQGVIAAL |
Ga0310892_100819193 | 3300031858 | Soil | MNFLAIVAALGLEQWRAFRWRVGLERTFVRWTRRL |
Ga0315297_107443262 | 3300031873 | Sediment | LSFLAVLIALGLEQWRAFSWRKAVERQFVRYARWIERRWNGGTAQHGWMA |
Ga0306919_102944111 | 3300031879 | Soil | MSLIAILAALGLEQWHAFHWRASIERAFVLLARRLEQRLNG |
Ga0306919_108107913 | 3300031879 | Soil | MNLLAILSALGLEQWRKFGWRGSVVRAFRRYARALDRRLNAGTTQQGVVAAV |
Ga0310912_104879622 | 3300031941 | Soil | MNLIAILSALGLEQWRAFRWRASVEHAFVQYVRAI |
Ga0306926_120745051 | 3300031954 | Soil | MTLLAILAALGLEQWRAFGWRAAAERAFVSYARRL |
Ga0308176_127874961 | 3300031996 | Soil | MSLVAILLALGLEQWRAFDWRAGVERAFVRYARLLERKLNGGTRQHGVIAAIA |
Ga0315274_102121891 | 3300031999 | Sediment | MNIIAILAALGLEQWRAFRWRANVERLFVRYARAVERRLNGGTAQQGMIATLV |
Ga0318556_106500021 | 3300032043 | Soil | MNLIAILSALALEQWRAFRWRASVEHAFVQYARAIERRLNAGTAQQGTIAVAIALV |
Ga0306924_126406213 | 3300032076 | Soil | MNLLAILSALGLEQWRKFGWRGSVVRAFRRYARALD |
Ga0315295_106538023 | 3300032156 | Sediment | MNIIAILAALGLEQWRAFHWRVALEGLFIRYARGVERKLNDGTA |
Ga0315268_102571153 | 3300032173 | Sediment | MNIIAILAALGLEQWRAFHWRVAMEGLFIRYARGVERKLNDGTPQHGLVAT |
Ga0315268_125303152 | 3300032173 | Sediment | MNFIAILAALGLEQWRAFRWRGALERVFVRYVRAL |
Ga0307471_1001454991 | 3300032180 | Hardwood Forest Soil | VRRRVSEWGMNLLAILIALGLEQWHAFRWRAAAERAFVVYARGLERKLNGGTAA |
Ga0307472_1019851971 | 3300032205 | Hardwood Forest Soil | LNLLAILAALALEQWHAPAWRVAIERAFVRHARRLERLFNGGTATQGA |
Ga0315270_111345762 | 3300032275 | Sediment | MNVIAILAALGLEQWRAFHWRAALEQLFVRYARALERKLNGGTAQQ |
Ga0315273_114024241 | 3300032516 | Sediment | LSFLAVLIALGLEQWRAFSWRTAVERQFVRYARWIERRWNGGTAQHGWIALVA |
Ga0335085_124306771 | 3300032770 | Soil | MNFIAILAALGLEQWRTLPWRAGIERAFVSYARMLESRLNGGT |
Ga0335080_101003661 | 3300032828 | Soil | MNFLAVIAALALEQWRAFRWRGGAQSAFVRYAKSL |
Ga0335084_105920891 | 3300033004 | Soil | VNFIAVLAAIGLEQWRAFRWRAGLEHAFIAYAHWLEEKLDGGTTRQGVVALIA |
Ga0334722_109649652 | 3300033233 | Sediment | MNIIAILAALGLEQWRAFHWRAALERLFVRYARTVERKLNGG |
Ga0334722_111119041 | 3300033233 | Sediment | MNFLAVLAALGLEQWRALRWRTALERLFVRYARAVERRLNGGTAQQGVVA |
Ga0316603_106006971 | 3300033413 | Soil | MNFLVILAALGLEQWRAFRFRAGVERAFVRYTRWLESKLNG |
Ga0316619_111909211 | 3300033414 | Soil | MSFAAILVALGLEQWRAFDWRGAVERAFVRFVRSLERKFN |
Ga0316619_114111102 | 3300033414 | Soil | MNLIAVLAALGLEQWRAFHWRATLEGLFVRYARAVEQKLNGGTAQQGLIAT |
Ga0316625_1007654292 | 3300033418 | Soil | VNFLAILIALGVEQWRTFGWRDAIARSFVRYARDLERKLNGGRPEQALL |
Ga0316625_1026295302 | 3300033418 | Soil | MNLIAVLAALALEQWRAFRWRASLERTFVRYARMLERRLNGGTVQQGVIAAVIA |
Ga0316601_1019822201 | 3300033419 | Soil | MNFIVILAALGLEQWRAFEWRASVERAFVRYVRTI |
Ga0316613_109971202 | 3300033434 | Soil | VNFLAILIALGVEQWRTFGWRDAIARSFVRYARDLERKLNGGRPEQAL |
Ga0316626_106510033 | 3300033485 | Soil | VNFLAILIALGVEQWRTFGWRDAIARSFVRYARDLERKLNGGRPEQALLA |
Ga0316628_1016023762 | 3300033513 | Soil | MNLIAVLAALALEQWRAFRWRASLERTFVRYARMLERRLNGGTVQQ |
Ga0316616_1033141771 | 3300033521 | Soil | VNFIAVVVALALEQWRAFRWRVALERIFVRYARALE |
Ga0370493_0003922_3916_4035 | 3300034129 | Untreated Peat Soil | VSFLALLAALGLEQWRAFSWRAGVERAFVRYARWIEGRWN |
Ga0370506_085019_2_142 | 3300034157 | Untreated Peat Soil | MSFLALLAALGLEQWRAFSWRAGVERAFVRYARWIERKWNGGTTQHG |
Ga0364943_0389076_1_126 | 3300034354 | Sediment | MSFLALLAALGLEQWRAFSWRAGVERAFVRYARWIERKWNGG |
Ga0370485_0149770_2_175 | 3300034358 | Untreated Peat Soil | MSFLAILAALGLEQWQAFRWRPALERALARYARGIERRLNGGAPQHGVLAAALALGPL |
⦗Top⦘ |