| Basic Information | |
|---|---|
| Family ID | F035280 |
| Family Type | Metagenome |
| Number of Sequences | 172 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MEKKIGKYWFAWGRKSGFGIGFNISKYGWDIDLGFWYIGQEF |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 172 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 82.08 % |
| % of genes near scaffold ends (potentially truncated) | 23.26 % |
| % of genes from short scaffolds (< 2000 bps) | 69.77 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (62.209 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (17.442 % of family members) |
| Environment Ontology (ENVO) | Unclassified (62.209 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (72.093 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 31.43% Coil/Unstructured: 68.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 172 Family Scaffolds |
|---|---|---|
| PF02195 | ParBc | 12.21 |
| PF02467 | Whib | 9.88 |
| PF00145 | DNA_methylase | 2.33 |
| PF09723 | Zn-ribbon_8 | 2.33 |
| PF00227 | Proteasome | 2.33 |
| PF13384 | HTH_23 | 1.74 |
| PF04545 | Sigma70_r4 | 1.74 |
| PF01930 | Cas_Cas4 | 1.16 |
| PF03796 | DnaB_C | 1.16 |
| PF01807 | zf-CHC2 | 1.16 |
| PF00850 | Hist_deacetyl | 1.16 |
| PF04232 | SpoVS | 0.58 |
| PF01844 | HNH | 0.58 |
| PF05063 | MT-A70 | 0.58 |
| PF14025 | DUF4241 | 0.58 |
| PF08241 | Methyltransf_11 | 0.58 |
| PF03837 | RecT | 0.58 |
| PF02675 | AdoMet_dc | 0.58 |
| PF07659 | DUF1599 | 0.58 |
| PF06414 | Zeta_toxin | 0.58 |
| PF07275 | ArdA | 0.58 |
| PF13207 | AAA_17 | 0.58 |
| PF12705 | PDDEXK_1 | 0.58 |
| PF07352 | Phage_Mu_Gam | 0.58 |
| PF01050 | MannoseP_isomer | 0.58 |
| PF08281 | Sigma70_r4_2 | 0.58 |
| PF13392 | HNH_3 | 0.58 |
| PF13362 | Toprim_3 | 0.58 |
| PF13481 | AAA_25 | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 172 Family Scaffolds |
|---|---|---|---|
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.33 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 2.33 |
| COG0638 | 20S proteasome, alpha and beta subunits | Posttranslational modification, protein turnover, chaperones [O] | 2.33 |
| COG3484 | Predicted proteasome-type protease | Posttranslational modification, protein turnover, chaperones [O] | 2.33 |
| COG5405 | ATP-dependent protease HslVU (ClpYQ), peptidase subunit | Posttranslational modification, protein turnover, chaperones [O] | 2.33 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 1.16 |
| COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 1.16 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 1.16 |
| COG1468 | CRISPR/Cas system-associated exonuclease Cas4, RecB family | Defense mechanisms [V] | 1.16 |
| COG4725 | N6-adenosine-specific RNA methylase IME4 | Translation, ribosomal structure and biogenesis [J] | 1.16 |
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 0.58 |
| COG2359 | Stage V sporulation protein SpoVS, predicted DNA-binding, AlbA superfamily | Function unknown [S] | 0.58 |
| COG3723 | Recombinational DNA repair protein RecT | Replication, recombination and repair [L] | 0.58 |
| COG4396 | Mu-like prophage host-nuclease inhibitor protein Gam | Mobilome: prophages, transposons [X] | 0.58 |
| COG4734 | Antirestriction protein ArdA | Defense mechanisms [V] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.12 % |
| Unclassified | root | N/A | 9.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000756|JGI12421J11937_10005551 | All Organisms → Viruses → Predicted Viral | 4978 | Open in IMG/M |
| 3300002091|JGI24028J26656_1005034 | All Organisms → Viruses → Predicted Viral | 2010 | Open in IMG/M |
| 3300003490|JGI25926J51410_1068724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
| 3300004096|Ga0066177_10375557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 614 | Open in IMG/M |
| 3300004125|Ga0066182_10130063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
| 3300004125|Ga0066182_10165220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
| 3300004448|Ga0065861_1034933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1473 | Open in IMG/M |
| 3300005581|Ga0049081_10022767 | All Organisms → Viruses → Predicted Viral | 2379 | Open in IMG/M |
| 3300005581|Ga0049081_10043838 | All Organisms → Viruses → Predicted Viral | 1697 | Open in IMG/M |
| 3300005581|Ga0049081_10083285 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300005581|Ga0049081_10102960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1063 | Open in IMG/M |
| 3300005581|Ga0049081_10229453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 657 | Open in IMG/M |
| 3300005581|Ga0049081_10284720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 572 | Open in IMG/M |
| 3300005582|Ga0049080_10225417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 616 | Open in IMG/M |
| 3300005582|Ga0049080_10265729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 557 | Open in IMG/M |
| 3300005583|Ga0049085_10111920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 937 | Open in IMG/M |
| 3300005583|Ga0049085_10174341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
| 3300005584|Ga0049082_10023967 | Not Available | 2122 | Open in IMG/M |
| 3300005662|Ga0078894_10888213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 774 | Open in IMG/M |
| 3300005805|Ga0079957_1212616 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300005805|Ga0079957_1335417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 668 | Open in IMG/M |
| 3300006030|Ga0075470_10035866 | All Organisms → Viruses → Predicted Viral | 1532 | Open in IMG/M |
| 3300006639|Ga0079301_1091112 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300006641|Ga0075471_10064045 | All Organisms → Viruses → Predicted Viral | 2021 | Open in IMG/M |
| 3300006805|Ga0075464_10069924 | All Organisms → Viruses → Predicted Viral | 1975 | Open in IMG/M |
| 3300006805|Ga0075464_10315625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 942 | Open in IMG/M |
| 3300006805|Ga0075464_10363879 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300006805|Ga0075464_10464400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 773 | Open in IMG/M |
| 3300006805|Ga0075464_10516570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
| 3300006805|Ga0075464_10784388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 592 | Open in IMG/M |
| 3300007708|Ga0102859_1282326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300007735|Ga0104988_10314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 13378 | Open in IMG/M |
| 3300007973|Ga0105746_1313689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 545 | Open in IMG/M |
| 3300007973|Ga0105746_1317287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 542 | Open in IMG/M |
| 3300008055|Ga0108970_11233022 | All Organisms → Viruses → Predicted Viral | 1756 | Open in IMG/M |
| 3300008107|Ga0114340_1012683 | All Organisms → Viruses → Predicted Viral | 4668 | Open in IMG/M |
| 3300008107|Ga0114340_1022920 | All Organisms → Viruses → Predicted Viral | 2923 | Open in IMG/M |
| 3300008107|Ga0114340_1073403 | All Organisms → Viruses → Predicted Viral | 1434 | Open in IMG/M |
| 3300008107|Ga0114340_1210005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
| 3300008107|Ga0114340_1220016 | Not Available | 613 | Open in IMG/M |
| 3300008110|Ga0114343_1141203 | Not Available | 780 | Open in IMG/M |
| 3300008113|Ga0114346_1036463 | All Organisms → Viruses → Predicted Viral | 2996 | Open in IMG/M |
| 3300008116|Ga0114350_1057998 | All Organisms → Viruses → Predicted Viral | 1373 | Open in IMG/M |
| 3300008116|Ga0114350_1166181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 590 | Open in IMG/M |
| 3300008267|Ga0114364_1006205 | All Organisms → cellular organisms → Bacteria | 5956 | Open in IMG/M |
| 3300008448|Ga0114876_1043203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2095 | Open in IMG/M |
| 3300008448|Ga0114876_1096916 | Not Available | 1185 | Open in IMG/M |
| 3300008448|Ga0114876_1172100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
| 3300008450|Ga0114880_1123689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 968 | Open in IMG/M |
| 3300009056|Ga0102860_1187030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
| 3300009068|Ga0114973_10001585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 16831 | Open in IMG/M |
| 3300009068|Ga0114973_10150863 | All Organisms → Viruses → Predicted Viral | 1292 | Open in IMG/M |
| 3300009151|Ga0114962_10000354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 40086 | Open in IMG/M |
| 3300009155|Ga0114968_10017637 | Not Available | 4963 | Open in IMG/M |
| 3300009158|Ga0114977_10608547 | Not Available | 589 | Open in IMG/M |
| 3300009159|Ga0114978_10026283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 4206 | Open in IMG/M |
| 3300009159|Ga0114978_10101465 | All Organisms → cellular organisms → Bacteria | 1900 | Open in IMG/M |
| 3300009159|Ga0114978_10124959 | All Organisms → Viruses → Predicted Viral | 1676 | Open in IMG/M |
| 3300009159|Ga0114978_10167637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1405 | Open in IMG/M |
| 3300009161|Ga0114966_10407128 | Not Available | 795 | Open in IMG/M |
| 3300009161|Ga0114966_10694022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
| 3300009163|Ga0114970_10168639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 1306 | Open in IMG/M |
| 3300009181|Ga0114969_10010970 | All Organisms → cellular organisms → Bacteria | 6676 | Open in IMG/M |
| 3300009182|Ga0114959_10071950 | All Organisms → Viruses → Predicted Viral | 1945 | Open in IMG/M |
| 3300009183|Ga0114974_10035639 | All Organisms → Viruses → Predicted Viral | 3408 | Open in IMG/M |
| 3300009183|Ga0114974_10076791 | All Organisms → Viruses → Predicted Viral | 2181 | Open in IMG/M |
| 3300009184|Ga0114976_10269554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 918 | Open in IMG/M |
| 3300009184|Ga0114976_10600828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
| 3300009466|Ga0126448_1002907 | All Organisms → Viruses → Predicted Viral | 4742 | Open in IMG/M |
| 3300010885|Ga0133913_13070037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1110 | Open in IMG/M |
| 3300010885|Ga0133913_13329318 | All Organisms → Viruses → Predicted Viral | 1056 | Open in IMG/M |
| 3300011339|Ga0153700_10595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17616 | Open in IMG/M |
| 3300011995|Ga0153800_1003892 | All Organisms → Viruses → Predicted Viral | 1389 | Open in IMG/M |
| 3300012012|Ga0153799_1012449 | All Organisms → Viruses → Predicted Viral | 1833 | Open in IMG/M |
| 3300012013|Ga0153805_1034179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 863 | Open in IMG/M |
| 3300012017|Ga0153801_1004062 | All Organisms → Viruses → Predicted Viral | 2805 | Open in IMG/M |
| 3300012352|Ga0157138_1003846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2557 | Open in IMG/M |
| 3300012352|Ga0157138_1012275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1404 | Open in IMG/M |
| 3300012663|Ga0157203_1062088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300013004|Ga0164293_10020720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 5488 | Open in IMG/M |
| 3300013005|Ga0164292_10710389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
| 3300013372|Ga0177922_10686480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 626 | Open in IMG/M |
| 3300013372|Ga0177922_11275814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 656 | Open in IMG/M |
| 3300017723|Ga0181362_1086341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 630 | Open in IMG/M |
| 3300017736|Ga0181365_1057096 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 970 | Open in IMG/M |
| 3300017774|Ga0181358_1096705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1062 | Open in IMG/M |
| 3300017774|Ga0181358_1184059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
| 3300017778|Ga0181349_1041449 | All Organisms → Viruses → Predicted Viral | 1824 | Open in IMG/M |
| 3300017778|Ga0181349_1133941 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 903 | Open in IMG/M |
| 3300017780|Ga0181346_1234961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
| 3300017784|Ga0181348_1113167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1048 | Open in IMG/M |
| 3300017784|Ga0181348_1221254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 668 | Open in IMG/M |
| 3300017784|Ga0181348_1271761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
| 3300017785|Ga0181355_1032924 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 2235 | Open in IMG/M |
| 3300019784|Ga0181359_1006260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 3957 | Open in IMG/M |
| 3300019784|Ga0181359_1012809 | All Organisms → Viruses → Predicted Viral | 3041 | Open in IMG/M |
| 3300019784|Ga0181359_1075238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1273 | Open in IMG/M |
| 3300019784|Ga0181359_1152750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 790 | Open in IMG/M |
| 3300019784|Ga0181359_1191319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 667 | Open in IMG/M |
| 3300019784|Ga0181359_1224922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 587 | Open in IMG/M |
| 3300019784|Ga0181359_1228055 | Not Available | 581 | Open in IMG/M |
| 3300020160|Ga0211733_11172990 | Not Available | 880 | Open in IMG/M |
| 3300020160|Ga0211733_11183560 | Not Available | 3224 | Open in IMG/M |
| 3300020161|Ga0211726_10036119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 683 | Open in IMG/M |
| 3300020162|Ga0211735_10564707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1887 | Open in IMG/M |
| 3300020172|Ga0211729_11464002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 595 | Open in IMG/M |
| 3300021961|Ga0222714_10053791 | All Organisms → Viruses → Predicted Viral | 2769 | Open in IMG/M |
| 3300021962|Ga0222713_10187647 | All Organisms → Viruses → Predicted Viral | 1394 | Open in IMG/M |
| 3300021963|Ga0222712_10053381 | All Organisms → Viruses → Predicted Viral | 3005 | Open in IMG/M |
| 3300021963|Ga0222712_10276822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1062 | Open in IMG/M |
| 3300022190|Ga0181354_1110736 | Not Available | 888 | Open in IMG/M |
| 3300022407|Ga0181351_1138608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 890 | Open in IMG/M |
| 3300022407|Ga0181351_1168301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 769 | Open in IMG/M |
| 3300022553|Ga0212124_10508597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300022752|Ga0214917_10001174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 34018 | Open in IMG/M |
| 3300022752|Ga0214917_10003192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 19200 | Open in IMG/M |
| 3300022752|Ga0214917_10010748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8544 | Open in IMG/M |
| 3300023174|Ga0214921_10000881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 53416 | Open in IMG/M |
| 3300023179|Ga0214923_10164405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1364 | Open in IMG/M |
| 3300023184|Ga0214919_10708609 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
| 3300025872|Ga0208783_10368662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 559 | Open in IMG/M |
| 3300025889|Ga0208644_1220083 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 808 | Open in IMG/M |
| 3300025896|Ga0208916_10173114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 931 | Open in IMG/M |
| 3300025896|Ga0208916_10267585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 743 | Open in IMG/M |
| 3300025896|Ga0208916_10396884 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 602 | Open in IMG/M |
| 3300027132|Ga0255110_1056822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
| 3300027145|Ga0255114_1063300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
| 3300027146|Ga0255104_1029959 | Not Available | 969 | Open in IMG/M |
| 3300027499|Ga0208788_1042430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1261 | Open in IMG/M |
| 3300027608|Ga0208974_1002691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 6567 | Open in IMG/M |
| 3300027608|Ga0208974_1053287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1157 | Open in IMG/M |
| 3300027627|Ga0208942_1131817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
| 3300027659|Ga0208975_1028905 | All Organisms → Viruses → Predicted Viral | 1781 | Open in IMG/M |
| 3300027659|Ga0208975_1069365 | All Organisms → Viruses → Predicted Viral | 1055 | Open in IMG/M |
| 3300027708|Ga0209188_1014826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4198 | Open in IMG/M |
| 3300027708|Ga0209188_1107558 | All Organisms → Viruses → Predicted Viral | 1108 | Open in IMG/M |
| 3300027733|Ga0209297_1350579 | Not Available | 535 | Open in IMG/M |
| 3300027736|Ga0209190_1133359 | All Organisms → Viruses → Predicted Viral | 1098 | Open in IMG/M |
| 3300027754|Ga0209596_1029815 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3103 | Open in IMG/M |
| 3300027763|Ga0209088_10325675 | Not Available | 615 | Open in IMG/M |
| 3300027770|Ga0209086_10087880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1621 | Open in IMG/M |
| 3300027782|Ga0209500_10286634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 703 | Open in IMG/M |
| 3300027797|Ga0209107_10005346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7194 | Open in IMG/M |
| 3300027797|Ga0209107_10039050 | All Organisms → Viruses → Predicted Viral | 2708 | Open in IMG/M |
| 3300027797|Ga0209107_10338016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 699 | Open in IMG/M |
| 3300027804|Ga0209358_10324928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 748 | Open in IMG/M |
| 3300027836|Ga0209230_10624430 | Not Available | 601 | Open in IMG/M |
| 3300027963|Ga0209400_1005222 | All Organisms → cellular organisms → Bacteria | 8969 | Open in IMG/M |
| 3300027971|Ga0209401_1000068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 70638 | Open in IMG/M |
| 3300028025|Ga0247723_1000072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 58854 | Open in IMG/M |
| 3300028025|Ga0247723_1000178 | Not Available | 40473 | Open in IMG/M |
| 3300028025|Ga0247723_1002801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9037 | Open in IMG/M |
| 3300028025|Ga0247723_1004092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 7049 | Open in IMG/M |
| 3300028025|Ga0247723_1012863 | All Organisms → cellular organisms → Bacteria | 3129 | Open in IMG/M |
| 3300028025|Ga0247723_1041147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1374 | Open in IMG/M |
| 3300028025|Ga0247723_1109608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 686 | Open in IMG/M |
| 3300031857|Ga0315909_10029703 | Not Available | 5327 | Open in IMG/M |
| 3300031951|Ga0315904_11371761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 529 | Open in IMG/M |
| 3300031999|Ga0315274_10131900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3199 | Open in IMG/M |
| 3300031999|Ga0315274_10295331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1938 | Open in IMG/M |
| 3300033979|Ga0334978_0342509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 711 | Open in IMG/M |
| 3300033993|Ga0334994_0566179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 516 | Open in IMG/M |
| 3300033996|Ga0334979_0006716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 8040 | Open in IMG/M |
| 3300034012|Ga0334986_0029126 | All Organisms → Viruses → Predicted Viral | 3665 | Open in IMG/M |
| 3300034019|Ga0334998_0465636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 712 | Open in IMG/M |
| 3300034021|Ga0335004_0042371 | All Organisms → Viruses → Predicted Viral | 3223 | Open in IMG/M |
| 3300034066|Ga0335019_0371387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 881 | Open in IMG/M |
| 3300034101|Ga0335027_0002570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 15851 | Open in IMG/M |
| 3300034101|Ga0335027_0310328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1061 | Open in IMG/M |
| 3300034283|Ga0335007_0021139 | All Organisms → cellular organisms → Bacteria | 5131 | Open in IMG/M |
| 3300034283|Ga0335007_0719068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 555 | Open in IMG/M |
| 3300034355|Ga0335039_0150630 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 17.44% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 15.70% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 12.21% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 9.30% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.40% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.81% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 4.07% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 2.33% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.33% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 2.33% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.33% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.74% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.16% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.16% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.16% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.16% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.16% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.16% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.58% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.58% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.58% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.58% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.58% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004125 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009466 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011339 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Hannam | Environmental | Open in IMG/M |
| 3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022553 | Powell_combined assembly | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027132 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepC_8h | Environmental | Open in IMG/M |
| 3300027145 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8h | Environmental | Open in IMG/M |
| 3300027146 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034355 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12421J11937_100055516 | 3300000756 | Freshwater And Sediment | MSEKKIGKHWFCWGRTSGFALGFSFDRYHWSIDLGFWYIGQEFYANV* |
| JGI24028J26656_10050345 | 3300002091 | Lentic | MEKKLGKYWYARGRKSGFGIGFDISKYGVQLDLGFWYVGVEF* |
| JGI25926J51410_10687241 | 3300003490 | Freshwater Lake | MSERKIGKYWFCWGRTSGFALGFNISKYNWGIELGFWYIGQEF* |
| Ga0066177_103755572 | 3300004096 | Freshwater Lake | MEKKIGKYWFYFGRKSGFGIGFNVSKYGWDMDLGFWFIGQELPLWQRQ* |
| Ga0066182_101300631 | 3300004125 | Freshwater Lake | MPEKKVGKFWISWGRTSGFSLGFAIDKYHWSIDLGFWYIGQE |
| Ga0066182_101652202 | 3300004125 | Freshwater Lake | SMSERKIGKYWFCWGRTSGFALGFNISKYNWGIELGFWYIGQEF* |
| Ga0065861_10349332 | 3300004448 | Marine | MEKKIKGYWFTWGRKSGFGIGFDVSKYGWSLDLGFWYLGQEF* |
| Ga0049081_100227676 | 3300005581 | Freshwater Lentic | MEKKIGKYWFVWGRTSGFALGFAIDKYHWSIDLGFWYMGQEF* |
| Ga0049081_100438383 | 3300005581 | Freshwater Lentic | MEKKIGKYWVALGRKSGFGIGFNISKYGLDIDLGLWYIGIEF* |
| Ga0049081_100832851 | 3300005581 | Freshwater Lentic | MEKKIGRFWFAWGRKSGFGIGFNVSKYGLDFDLGFWYIGVEF* |
| Ga0049081_101029603 | 3300005581 | Freshwater Lentic | IGKYWFYFGRKSGFGIGFNVSKYGWDMDLGFWFIGVEF* |
| Ga0049081_102294532 | 3300005581 | Freshwater Lentic | VRKHMEKRLGKYWFYFGRKSGFGIGFDVSKYGWDIDLGFWYFGQEFPLWQRQ* |
| Ga0049081_102847202 | 3300005581 | Freshwater Lentic | MEKKIGKYWFACGRKSGFGIGFNVSKYGLDMDLGFWYIGVEF* |
| Ga0049080_102254173 | 3300005582 | Freshwater Lentic | MEKKIGRYWFAWGRVSGFALGFSIDKYHWTIDLGFWYIGQEF* |
| Ga0049080_102657292 | 3300005582 | Freshwater Lentic | KPMEKKIGKYWFYFGRKSGFGIGFNVSKYGWDMDLGFWFIGVEF* |
| Ga0049085_101119202 | 3300005583 | Freshwater Lentic | MEKKIGKYWFCWGRTSGFALGFNISKYNWGIELGFWYIGQDF* |
| Ga0049085_101743412 | 3300005583 | Freshwater Lentic | MEKKIGKYWFAWGRKSGFGLGFNISKYGWDLDLGFWYVGQEWHW* |
| Ga0049082_100239673 | 3300005584 | Freshwater Lentic | MQKKVGKYWFNFGRKNGFGIGFDISKHFWSVELGFWYIGQEF* |
| Ga0078894_108882131 | 3300005662 | Freshwater Lake | KDMEKKIGRYWFAWGRVSGFALGFSIDKYHWSIDLGFWYIGQEF* |
| Ga0079957_12126161 | 3300005805 | Lake | KIGRYWFACGRKSGFGIGFNVSKYGLDMDLGFWYIGVEF* |
| Ga0079957_13354171 | 3300005805 | Lake | MEKKIGRYWLAWGRKSGFGIGFNISKYGIDIDLGFWYIGV |
| Ga0075470_100358663 | 3300006030 | Aqueous | MEKKIGRYWLACGRRLGFGIGFSISSYGIDIDLGFWYIGVEF* |
| Ga0079301_10911121 | 3300006639 | Deep Subsurface | MEKKVGKYWFTCGRKSGFGIGFEFSKYGWSIDLGFWYIGQEF* |
| Ga0075471_100640453 | 3300006641 | Aqueous | MEKKIGRYWFAWGRNSGFALGFSIDKYHWTIDLGFWYIGQEF* |
| Ga0075464_100699242 | 3300006805 | Aqueous | MSEKKVGELWFYWGRTSGFALGFSINKYHWTIDLGFWYVGQEF* |
| Ga0075464_103156252 | 3300006805 | Aqueous | MEKKIGRYWFAWGRNSGFALGFSIDKHHWTIDLGFWYIGQEF* |
| Ga0075464_103638792 | 3300006805 | Aqueous | MEKKIGKYWFDWGRKSGFGLGFEVSKYGWSLDLGFWYIGQEFAW* |
| Ga0075464_104644001 | 3300006805 | Aqueous | MEKKIGKYWYYYGLKSGFGVGFDVSKYFWNIDLGFWYIGQE |
| Ga0075464_105165701 | 3300006805 | Aqueous | MEKKIGKYWFYCGRKCGFGIGFEISKYSWTIDLGFWYIGQEF* |
| Ga0075464_107843882 | 3300006805 | Aqueous | MEKKIGRYWFNWGRKCGFGIGFDIDKYHWSLDLGFWYIGQEF* |
| Ga0102859_12823262 | 3300007708 | Estuarine | MSEKKIGKYWFAWGRKSGFGIGFSLSKYGWDIDLGFWYVGQEF* |
| Ga0104988_1031416 | 3300007735 | Freshwater | MERKIGRYWFAWGRTSGFALGFSIDKYHWTIDLGFWYIGQEF* |
| Ga0105746_13136891 | 3300007973 | Estuary Water | MEKKIGKYWFCWGRTSGFALGFNISKYNWGIELGFWYIGQE |
| Ga0105746_13172872 | 3300007973 | Estuary Water | MEKKIGKYWFAWGRKSGFGIGFNISKYGWDIDLGFWYIGQEF* |
| Ga0108970_112330222 | 3300008055 | Estuary | MTEKKIGKIWFCWGRTSGFALGFSFDRYHWSIDLGFWYIGQEFYANV* |
| Ga0114340_10126833 | 3300008107 | Freshwater, Plankton | MEKRVGKYWFVYGRKSGFGIGFDVSKYFWTIDLGFWYIGQEF* |
| Ga0114340_10229202 | 3300008107 | Freshwater, Plankton | MEKRVGKTWFYYGRKSGFGIGFEFNKYGWSIDLGFWYIGQDF* |
| Ga0114340_10734035 | 3300008107 | Freshwater, Plankton | MEKKIGRYWFYYGRKSGFGIGFNISKHSIDLDLGVWYLAVEL* |
| Ga0114340_12100052 | 3300008107 | Freshwater, Plankton | MEKKISKYWFSAGRKSGFGIGFNISKYFIEIELGFWYVGLEF* |
| Ga0114340_12200162 | 3300008107 | Freshwater, Plankton | MEKKIGRYWFCYGRKSGFGIGFNISKHSIDLDLGVWYLAVEL* |
| Ga0114343_11412034 | 3300008110 | Freshwater, Plankton | RTMSEKKIAGFWWAYGRKRGFGIGFDISDYHWNIDLGFWYFGQEF* |
| Ga0114346_10364633 | 3300008113 | Freshwater, Plankton | MEKKIGRYWYYYGRKSGFGIGFNISKYSIDLDLGLWYLAVEL* |
| Ga0114350_10579982 | 3300008116 | Freshwater, Plankton | MEKKIGKYWFAWGRKSGFGIGFNVSKYGLDMDLGFWYIGVEF* |
| Ga0114350_11661811 | 3300008116 | Freshwater, Plankton | MEKKIGKYWFYFGRKSGFGIGFNVSKYGWDMDLGFWYIGVEF* |
| Ga0114364_10062054 | 3300008267 | Freshwater, Plankton | MSEKKIAGFWWAYGRKRGFGIGFDISDYHWNIDLGFWYFGQEF* |
| Ga0114876_10432031 | 3300008448 | Freshwater Lake | MEKKIGRYWFAWGRKSGFGIGFNISKYGWDIDLGFWYI |
| Ga0114876_10969162 | 3300008448 | Freshwater Lake | MSEKKIAGHWWSYGRKSGFGIGFDISKYHWNIDLGFWYFGQEF* |
| Ga0114876_11721003 | 3300008448 | Freshwater Lake | MERKIGRYWYYYGRKSGFGIGFNISKYSIDLDLGLWYLAVEL* |
| Ga0114880_11236891 | 3300008450 | Freshwater Lake | MEKKIGKYWFAWGRKSGFGIGFNVSKYGLDMDLGFWFIGVEF* |
| Ga0102860_11870301 | 3300009056 | Estuarine | KKIGKYWFCWGRTSGFALGFAVDKYHWSIDLGFWYMGQEF* |
| Ga0114973_1000158530 | 3300009068 | Freshwater Lake | MEKKIGKYWFNWGRTSGFALGFNISKYNWGIELGFWYVGMEF* |
| Ga0114973_101508634 | 3300009068 | Freshwater Lake | MSEKKVAGFWWAYGRKRGFGIGFDISDYHWNIDLGFWYFGQEF* |
| Ga0114962_1000035443 | 3300009151 | Freshwater Lake | MNKEKKIGKYWFTWGRKSGFGFGFNISKYGWDIDLGLWYFGQEF* |
| Ga0114968_1001763714 | 3300009155 | Freshwater Lake | MSEKKIAGHWWNYGRKSGFGIGFDISTYHWNIDLGFWYFGQEF* |
| Ga0114977_106085473 | 3300009158 | Freshwater Lake | MSEKKIAGHWWNYGRKSGFGIGFDVSTYHWNIDLGFWYFGQEF* |
| Ga0114978_100262836 | 3300009159 | Freshwater Lake | MSEKKIGKYWFCWGRTSGFALGFNISKYNWGIELGFWYIGQEF* |
| Ga0114978_101014653 | 3300009159 | Freshwater Lake | KMEKQVGKFWFSWGRKCGFGIGFEFSRYGWGLDLGFWYIGQEF* |
| Ga0114978_101249592 | 3300009159 | Freshwater Lake | MSEKKIAGHWWNYGRKSGFGIGFDVSTYHWNIDIGFWYFGQEF* |
| Ga0114978_101676373 | 3300009159 | Freshwater Lake | MEKQIGKYWFAWGRTSGFALGFNISKYNWGIELGFWYIGQEF* |
| Ga0114966_104071282 | 3300009161 | Freshwater Lake | MSEKKVAGFWWSYGRKRGFGIGFDISDYHWNIDLGFWYFGQEF* |
| Ga0114966_106940222 | 3300009161 | Freshwater Lake | MEKKIGKYWFNWGRKSGFGLGFDVSKYGWSIDFGFWYIGQEFAW* |
| Ga0114970_101686392 | 3300009163 | Freshwater Lake | MGEKKLGTLWLNWGRKGGFGIGFNISKYDWSIDLGFWYIGQEWQW* |
| Ga0114969_1001097013 | 3300009181 | Freshwater Lake | MEKKIGKYWFNWGRKSGFGLGFDVSKYGWSIDFGFWYI |
| Ga0114959_100719503 | 3300009182 | Freshwater Lake | MEKKIGNYWFYVGRKCGFGIGFEISKYAWNIDLGFWYIGQEF* |
| Ga0114974_100356392 | 3300009183 | Freshwater Lake | MEKKIGRYWFAWGRKSGFGIGFNISKYGWDIDLGFWYIGQEF* |
| Ga0114974_100767911 | 3300009183 | Freshwater Lake | MSEKKIAGFWWAYGRKRGFGIGFDISDYHWNIDLG |
| Ga0114976_102695542 | 3300009184 | Freshwater Lake | MEKKIGKYWFCWGRTSGFALGFNISKYNWGIELGFWYIGQEF* |
| Ga0114976_106008281 | 3300009184 | Freshwater Lake | MEKKIGKYWFYVGRKCGFGIGFEISKYAWNIDLGFWYIGQE |
| Ga0126448_10029075 | 3300009466 | Meromictic Pond | MEKKIGKYWFSWGRTSGFALGFNISKYNWGIELGFWYIGQEFEWRAR* |
| Ga0133913_130700372 | 3300010885 | Freshwater Lake | MEKKIGKYWFYVGRKCGFGIGFEISKYAWNIDLGFWYIGQEF* |
| Ga0133913_133293182 | 3300010885 | Freshwater Lake | MEKKIGRYWFAWGRKSGFGIGFNISKYGWDIDLGFWYIGQE |
| Ga0153700_1059514 | 3300011339 | Freshwater | MEKKIGRYWFCYGRKSGFGIGLNISKYSIDLDLGVWYLAVEL* |
| Ga0153800_10038922 | 3300011995 | Freshwater | MEKKIGKYWFAWGRKSGFGIGFNVSKYGWDMDLGFWYIGVEF* |
| Ga0153799_10124492 | 3300012012 | Freshwater | MEKKIGKYWFYFGRKSGFGIGFNISKYGWDMDLGFWFIGQELPLWQRQ* |
| Ga0153805_10341791 | 3300012013 | Surface Ice | YWFACGRKSGFGIGFNVSKYGLDMDLGFWFIGVEF* |
| Ga0153801_10040624 | 3300012017 | Freshwater | MEKKIGKYWFACGRKSGFGIGFNVSKYGLDMDLGFWYLGVEF* |
| Ga0157138_10038463 | 3300012352 | Freshwater | MEKKIGKYWFAWGRKSGFGIGFDIDKYHWSLDLGFWYIGQEF* |
| Ga0157138_10122751 | 3300012352 | Freshwater | MAEHKIGKYWFSWGRKSGFGIGFDVSKYAWYVDLGFWYIGQEF* |
| Ga0157203_10620881 | 3300012663 | Freshwater | MEKKIGRYWISWGRVSGFAVGFSISKYGFNLDLAFWYLGIEF* |
| Ga0164293_100207209 | 3300013004 | Freshwater | MEKRIGKYWFSWGVKAGFGIGFEINKYHWSLDLGFWYVSQEF* |
| Ga0164292_107103892 | 3300013005 | Freshwater | MEKKIGKYWFNWGRKHGFGIGFHIDSYHWSLDLGLWYVGQEF* |
| Ga0177922_106864802 | 3300013372 | Freshwater | MEKKIGKYWFYFGRKSGFGIGFNISKYGWDMDLGFWFIGVEF* |
| Ga0177922_112758142 | 3300013372 | Freshwater | MEKKIGKYWFSWGRTSGFALGFNISKYNWGIELGFWYIGQDF* |
| Ga0181362_10863412 | 3300017723 | Freshwater Lake | MEKKIGKYWFAWGRTSGFALGFSISKYQWTIELGFWYIGQ |
| Ga0181365_10570962 | 3300017736 | Freshwater Lake | MEVEMEKKIGKYWFAWGRKSGFGLGFNISRYGWDLDLGFWYVGQEWHW |
| Ga0181358_10967051 | 3300017774 | Freshwater Lake | KKIGKYWFCWGRTSGFALGFNISKYNWGIELGFWYIGQEF |
| Ga0181358_11840592 | 3300017774 | Freshwater Lake | MEKKIGKYWFNWGRKSGFGIGFSISKYGIDFDLVFWYIGVEF |
| Ga0181349_10414495 | 3300017778 | Freshwater Lake | ILFNGRVNGKKIGKYWFVWGKTSGFALGFAINKYHWSIDLGFWYIGQEF |
| Ga0181349_11339413 | 3300017778 | Freshwater Lake | VTMEKKVGRFWFYSGRTNGFALGFAVNKYHWTIELGFWYIGQEF |
| Ga0181346_12349612 | 3300017780 | Freshwater Lake | MSEKKIAGHWWNYGRKSGFGIGFDVSTYHWNVDLGFWYFGQEF |
| Ga0181348_11131672 | 3300017784 | Freshwater Lake | MEKKIGPYWFVWGRVCGFALGFSISKYGFNLDLGLWYIGMEF |
| Ga0181348_12212541 | 3300017784 | Freshwater Lake | MEKKIGKYWFAWGRKSGFGIGFSISKYGMDFDLVFWYIGVEF |
| Ga0181348_12717611 | 3300017784 | Freshwater Lake | RKLGKYWFCWGRTSGFALGFNISKYNSGIELGFWYIGQEF |
| Ga0181355_10329244 | 3300017785 | Freshwater Lake | MGEKKLGTLWVNWGRKSGFGIGFEVSKYGWSIDLGFWYIGQEWQW |
| Ga0181359_10062602 | 3300019784 | Freshwater Lake | MSERKIGKYWFCWGRTSGFALGFNISKYNWGIELGFWYIGQEF |
| Ga0181359_10128095 | 3300019784 | Freshwater Lake | MPEKKVGKFWISWGRTSGFSLGFAIDKYHWSIDLGFWYIGQEY |
| Ga0181359_10752382 | 3300019784 | Freshwater Lake | MEKKIGKYWFACGRKSGFGIGFNISKYGWDMDLGFWFIGVEF |
| Ga0181359_11527503 | 3300019784 | Freshwater Lake | MSEKRIGKYWFAWGRKSGFGIGFSISKYGWDIELGFWYIGQEF |
| Ga0181359_11913192 | 3300019784 | Freshwater Lake | MEKKIGKYWFTCGRKSGFGIGFNISKYGIDLDLVYWYIGLEF |
| Ga0181359_12249222 | 3300019784 | Freshwater Lake | MEKKIGKYWFNWGRKSGFGIGFSISKYGIDLDLVFWYIGVEF |
| Ga0181359_12280552 | 3300019784 | Freshwater Lake | MSEKKIGKYWFIWGRKSGFGIGFSLSKYGWDIDLGFWYIGQEF |
| Ga0211733_111729901 | 3300020160 | Freshwater | MEKKVGKYWFSYGRKNGFGIGFDISKHFWSVELGFWYIGQEF |
| Ga0211733_111835601 | 3300020160 | Freshwater | MEKQIGKYWFAWGRKSGFGIGFDIDRYHWSLDLGFWYIGQEF |
| Ga0211726_100361192 | 3300020161 | Freshwater | MEKKIGKYWFSWGRTSGFALGFNISKYNWGIELGFWYIGQEF |
| Ga0211735_105647074 | 3300020162 | Freshwater | MEKQIGKYWFAWGRKSGFGIGFDIDRYHWSLDLGFWYMGQEF |
| Ga0211729_114640021 | 3300020172 | Freshwater | MEKKIGKYWFAWGRTSGFALGFNISKYNWGIELGFWYIGQEF |
| Ga0222714_1005379110 | 3300021961 | Estuarine Water | MSEKKIGKYWFAWGRKSGFGIGFSLSKYGWDIDLGFWYIAQEF |
| Ga0222713_101876471 | 3300021962 | Estuarine Water | MEVEMEKKIGKYWFAWGRKSGFGLGFNISKYGWDLDLGFWYVGQELHW |
| Ga0222712_100533813 | 3300021963 | Estuarine Water | MEKKIGKYWFAWGRKSGFGLGFNISKYGWDLDLGFWYVGQELHW |
| Ga0222712_102768224 | 3300021963 | Estuarine Water | MEKKIGSQWYYAGRKAGFGIGFNISRYCIDIDLGFWFVAVEL |
| Ga0181354_11107362 | 3300022190 | Freshwater Lake | MSEKKIAGHWWNYGRKSGFGIGFDVSTYHWNIDLGFWYFGQEF |
| Ga0181351_11386082 | 3300022407 | Freshwater Lake | MEKRIGKYWFYWGRKCGFGIGFEISKYSWTIDLGFWYIGQEFN |
| Ga0181351_11683013 | 3300022407 | Freshwater Lake | MSEKRIGKYWFAWGRKSGFGIGFSLSKYGWDIDLGFWYIGQEF |
| Ga0212124_105085971 | 3300022553 | Freshwater | MEKKIGKYWFAWGRKSGFGLGFNISKYGWDLDLGFWYVGQEWHW |
| Ga0214917_1000117439 | 3300022752 | Freshwater | MEKKIGRYWFAWGRTSGFALGLSIDKHHWTIDLGFWYIGQEF |
| Ga0214917_1000319238 | 3300022752 | Freshwater | MEKKIGRYWLAWGRRLGFGIGFSISSYGIDLDLGFWFIGVEF |
| Ga0214917_100107483 | 3300022752 | Freshwater | MEKKIGKYWFCWGRTSGFALGFNISKYNWGIELGFWYIGQEF |
| Ga0214921_1000088132 | 3300023174 | Freshwater | MEKQIGKYWFCCGRKSGFGIGFDVSKYFWTIDLGFWYIGQEF |
| Ga0214923_101644051 | 3300023179 | Freshwater | MEKKIGKYWFCWGRTSGFAIGFNISKYNWGIELGFW |
| Ga0214919_107086091 | 3300023184 | Freshwater | IGKYWFAWGRKTGFGLGFNISRYGWDLDLGFWYVGQEWHW |
| Ga0208783_103686622 | 3300025872 | Aqueous | MEKKIGRYWFAWGRNSGFALGFSIDKYHWTIDLGFWY |
| Ga0208644_12200831 | 3300025889 | Aqueous | MEKKIGRFWFAWGRKSGFGIGFNVSKYGLDFDLGFWYIGVE |
| Ga0208916_101731144 | 3300025896 | Aqueous | MSEKKVGELWFYWGRTSGFALGFSINKYHWTIDLGFWYIGQEFYANV |
| Ga0208916_102675852 | 3300025896 | Aqueous | MEKKIGKYWFDWGRKSGFGLGFEVSKYGWSLDLGFWYIGQEFAW |
| Ga0208916_103968842 | 3300025896 | Aqueous | MEKKIGRYWFNWGRKCGFGIGFDIDKYHWSLDLGFWYIGQEF |
| Ga0255110_10568223 | 3300027132 | Freshwater | KKISKYWFSAGRKSGFGIGFNISKYFIEIELGFWYVGLEF |
| Ga0255114_10633001 | 3300027145 | Freshwater | MEKKISKYWFSAGRKSGFGIGFNISKYFIEIELGFWYVGLEF |
| Ga0255104_10299591 | 3300027146 | Freshwater | MEKKIGRYWFYYGRKSGFGIGFNISKHSIDLDLGVWYLAVEL |
| Ga0208788_10424302 | 3300027499 | Deep Subsurface | MEKKMGKYWFTYGRKSGFGIGFEFSQYGWSIDLGFWYIGQEF |
| Ga0208974_100269111 | 3300027608 | Freshwater Lentic | MEKRLGKYWFYFGRKSGFGIGFDVSKYGWDIDLGFWYFGQEFPLWQRQ |
| Ga0208974_10532872 | 3300027608 | Freshwater Lentic | MEKKIGKYWFACGRKSGFGIGFNVSKYGLDMDLGFWYIGVEF |
| Ga0208942_11318171 | 3300027627 | Freshwater Lentic | MQKKLGKHWFNFGRKNGFGIGFDISKHFWSVELGF |
| Ga0208975_10289052 | 3300027659 | Freshwater Lentic | MEKKIGKYWFVWGRTSGFALGFAIDKYHWSIDLGFWYMGQEF |
| Ga0208975_10693651 | 3300027659 | Freshwater Lentic | IGKYWFYFGRKSGFGIGFNVSKYGWDMDLGFWFIGVEF |
| Ga0209188_10148263 | 3300027708 | Freshwater Lake | MNKEKKIGKYWFTWGRKSGFGFGFNISKYGWDIDLGLWYFGQEF |
| Ga0209188_11075583 | 3300027708 | Freshwater Lake | MEKKIGNYWFYVGRKCGFGIGFEISKYAWNIDLGFWYIGQEF |
| Ga0209297_13505793 | 3300027733 | Freshwater Lake | EKKIAGHWWNYGRKSGFGIGFDVSTYHWNIDLGFWYFGQEF |
| Ga0209190_11333591 | 3300027736 | Freshwater Lake | MSEKKIAGFWWAYGRKRGFGIGFDISDYHWNIDLGFW |
| Ga0209596_10298155 | 3300027754 | Freshwater Lake | MEKKIGKYWFNWGRKSGFGLGFDVSKYGWSIDFGFWYIGQEFAW |
| Ga0209088_103256752 | 3300027763 | Freshwater Lake | MSEKKIAGHWWNYGRKSGFGIGFDVSTYHWNIDIGFWYFGQEF |
| Ga0209086_100878801 | 3300027770 | Freshwater Lake | MEKKIGKYWFCWGRTSGFALGFNISKYNWGIELGF |
| Ga0209500_102866342 | 3300027782 | Freshwater Lake | MEKQIGKYWFAWGRTSGFALGFNISKYNWGIELGFWYIGQEF |
| Ga0209107_100053462 | 3300027797 | Freshwater And Sediment | MSEKKIGKHWFCWGRTSGFALGFSFDRYHWSIDLGFWYIGQEFYANV |
| Ga0209107_100390503 | 3300027797 | Freshwater And Sediment | MEKKIGRYWFNWGRKCGFGFGFDIDKYHWSIDLGFWYIGQEF |
| Ga0209107_103380162 | 3300027797 | Freshwater And Sediment | MEKKIGKYWFSWGRVSGFALGFSVDKYHWTIDLGFWYIGQEF |
| Ga0209358_103249281 | 3300027804 | Freshwater Lake | IGKYWFACGRKSGFGIGFNVSKYGLDMDLGFWYIGVEF |
| Ga0209230_106244302 | 3300027836 | Freshwater And Sediment | MEKKIGKYWFSYGRMSGFGIGFVIDKYHWGLDLGFWYIGQEF |
| Ga0209400_100522226 | 3300027963 | Freshwater Lake | MSEKKIAGHWWNYGRKSGFGIGFDISTYHWNIDLGFWYFGQEF |
| Ga0209401_100006860 | 3300027971 | Freshwater Lake | MEKKIGKYWFNWGRTSGFALGFNISKYNWGIELGFWYVGMEF |
| Ga0247723_10000724 | 3300028025 | Deep Subsurface Sediment | MEKKVGRYWFACGRKSGFGIGFNISKYGWDIDLGFWYIGMEF |
| Ga0247723_100017818 | 3300028025 | Deep Subsurface Sediment | MSEKRIAGHWWQYGRKAGFGIGFDVSKYSWYVDIGFWYIGKEF |
| Ga0247723_10028012 | 3300028025 | Deep Subsurface Sediment | MEKKIGRFWFAWGRKSGFGIGFNVSKYGLDFDLGFWYIGVEF |
| Ga0247723_100409216 | 3300028025 | Deep Subsurface Sediment | MEKKIGKKIWFAYGRKSGFGIGFDVSRWYTTIDLGFWYIGVEY |
| Ga0247723_10128635 | 3300028025 | Deep Subsurface Sediment | MEKKIGKYWFSFGRQYGFGIGFYINRYSWSMNLGIWYFGVELEWHQR |
| Ga0247723_10411472 | 3300028025 | Deep Subsurface Sediment | MEKKVGKYWFSWGRTSGFALGFNISKYNWGIELGFWYIGQEF |
| Ga0247723_11096082 | 3300028025 | Deep Subsurface Sediment | MEKKIGKYWFSWGVKAGFGIGFEINKYHWSLDLGFWYVSQEF |
| Ga0315909_100297033 | 3300031857 | Freshwater | MERKIGRYWYYYGRKSGFGIGFNISKYSIDLDLGLWYLAVEL |
| Ga0315904_113717612 | 3300031951 | Freshwater | LGKYWFYFGRKSGFGIGFDVSKYGWDIDLGFWYFGQEFPLWQRQ |
| Ga0315274_101319003 | 3300031999 | Sediment | MEKKIGKYWFYWGRKSGFGIGFEISKYSWTIDLGFWYIGQEFN |
| Ga0315274_102953311 | 3300031999 | Sediment | KRIGKYWFAWGRKSGFGIGFSISKYGWDIELGFWYIGQEF |
| Ga0334978_0342509_449_577 | 3300033979 | Freshwater | MEKKIGRYWFNWGRKCGFGIGFDIDKYHWSIELGFWYIGQEF |
| Ga0334994_0566179_68_196 | 3300033993 | Freshwater | MEKQVGKFWFSWGRKSGFGIGFEFSRYGWGLDLGFWYIGQEF |
| Ga0334979_0006716_6793_6921 | 3300033996 | Freshwater | MEKRIGKYWFSWGVKAGFGIGFEINKYHWSLDLGFWYVSQEF |
| Ga0334986_0029126_3522_3650 | 3300034012 | Freshwater | MEKKIGRYWFAWGRVSGFALGFSIDKYHWSIDLGFWYIGQEF |
| Ga0334998_0465636_600_710 | 3300034019 | Freshwater | KTWFYYGRKSGFGIGFEFNKRGWSIDLGFWYIGQDF |
| Ga0335004_0042371_351_482 | 3300034021 | Freshwater | MAEKRVGKTWFYYGRKSGFGIGFEFNKRGWSIDLGFWYIGQDF |
| Ga0335019_0371387_744_881 | 3300034066 | Freshwater | NKDMEKKIGRYWFAWGRVSGFALGFSIDKYHWSIDLGFWYIGQEF |
| Ga0335027_0002570_14742_14870 | 3300034101 | Freshwater | MEKRVGKFWFSWGRKSGFGIGFEFSRYGWGLDLGFWYIGQEF |
| Ga0335027_0310328_895_1023 | 3300034101 | Freshwater | MEKKIGRFWFAWGRKSGFGIGFNVSKYGLEFDLGFWYIGMEF |
| Ga0335007_0021139_1759_1887 | 3300034283 | Freshwater | MEKKIGKYWFNWGRKHGFGIGFHIDSYHWSLDLGLWYVGQEF |
| Ga0335007_0719068_204_332 | 3300034283 | Freshwater | MEKKIGRYWLAWGRRLGFGIGFNISKYGIDIDLGFWYIGVEF |
| Ga0335039_0150630_383_511 | 3300034355 | Freshwater | MEKKLGKSWFYYGRKSGFGIGFEFNKRGWSIDLGFWYIGQDF |
| ⦗Top⦘ |