| Basic Information | |
|---|---|
| Family ID | F035229 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 172 |
| Average Sequence Length | 46 residues |
| Representative Sequence | IGCHGPGAPPGIFEGIATTKGYTTYYNVPDPVPGVDAGRTNFHVR |
| Number of Associated Samples | 135 |
| Number of Associated Scaffolds | 172 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.76 % |
| % of genes near scaffold ends (potentially truncated) | 93.02 % |
| % of genes from short scaffolds (< 2000 bps) | 94.77 % |
| Associated GOLD sequencing projects | 128 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.930 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.605 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.977 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.349 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 6.85% β-sheet: 0.00% Coil/Unstructured: 93.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 172 Family Scaffolds |
|---|---|---|
| PF10518 | TAT_signal | 9.88 |
| PF00196 | GerE | 1.16 |
| PF08240 | ADH_N | 1.16 |
| PF10604 | Polyketide_cyc2 | 1.16 |
| PF00005 | ABC_tran | 0.58 |
| PF01458 | SUFBD | 0.58 |
| PF02782 | FGGY_C | 0.58 |
| PF14534 | DUF4440 | 0.58 |
| PF12681 | Glyoxalase_2 | 0.58 |
| PF13683 | rve_3 | 0.58 |
| PF02518 | HATPase_c | 0.58 |
| PF00069 | Pkinase | 0.58 |
| PF07883 | Cupin_2 | 0.58 |
| PF07690 | MFS_1 | 0.58 |
| PF07508 | Recombinase | 0.58 |
| PF04545 | Sigma70_r4 | 0.58 |
| PF04962 | KduI | 0.58 |
| PF00211 | Guanylate_cyc | 0.58 |
| PF13565 | HTH_32 | 0.58 |
| PF01761 | DHQ_synthase | 0.58 |
| PF00571 | CBS | 0.58 |
| PF12680 | SnoaL_2 | 0.58 |
| PF13576 | Pentapeptide_3 | 0.58 |
| PF00583 | Acetyltransf_1 | 0.58 |
| PF08281 | Sigma70_r4_2 | 0.58 |
| PF04209 | HgmA_C | 0.58 |
| PF17164 | DUF5122 | 0.58 |
| PF00206 | Lyase_1 | 0.58 |
| PF09678 | Caa3_CtaG | 0.58 |
| PF00106 | adh_short | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 172 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.33 |
| COG0719 | Fe-S cluster assembly scaffold protein SufB | Posttranslational modification, protein turnover, chaperones [O] | 0.58 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.58 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.58 |
| COG3508 | Homogentisate 1,2-dioxygenase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.58 |
| COG3717 | 5-keto 4-deoxyuronate isomerase | Carbohydrate transport and metabolism [G] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.93 % |
| Unclassified | root | N/A | 4.07 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig849326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
| 2166559005|cont_contig13038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1426 | Open in IMG/M |
| 3300000955|JGI1027J12803_109116927 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300000956|JGI10216J12902_117555016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 527 | Open in IMG/M |
| 3300004479|Ga0062595_101898125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 570 | Open in IMG/M |
| 3300004479|Ga0062595_102293561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 532 | Open in IMG/M |
| 3300004633|Ga0066395_10417651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 759 | Open in IMG/M |
| 3300005172|Ga0066683_10583820 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300005176|Ga0066679_10453824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 839 | Open in IMG/M |
| 3300005176|Ga0066679_10782084 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300005181|Ga0066678_10982134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 548 | Open in IMG/M |
| 3300005186|Ga0066676_10779234 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300005187|Ga0066675_11372031 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005336|Ga0070680_100502630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1037 | Open in IMG/M |
| 3300005365|Ga0070688_100085274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2053 | Open in IMG/M |
| 3300005406|Ga0070703_10136286 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300005434|Ga0070709_11140825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 625 | Open in IMG/M |
| 3300005436|Ga0070713_100123423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2274 | Open in IMG/M |
| 3300005455|Ga0070663_102149256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans flavus | 503 | Open in IMG/M |
| 3300005471|Ga0070698_102003616 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005547|Ga0070693_101583210 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005555|Ga0066692_10539145 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300005556|Ga0066707_10083620 | All Organisms → cellular organisms → Bacteria | 1931 | Open in IMG/M |
| 3300005568|Ga0066703_10823996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 530 | Open in IMG/M |
| 3300005578|Ga0068854_101918573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 545 | Open in IMG/M |
| 3300005587|Ga0066654_10438351 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300005614|Ga0068856_100599373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1123 | Open in IMG/M |
| 3300005764|Ga0066903_102938762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 924 | Open in IMG/M |
| 3300005834|Ga0068851_10598184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 671 | Open in IMG/M |
| 3300006046|Ga0066652_100675936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 981 | Open in IMG/M |
| 3300006049|Ga0075417_10188859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 972 | Open in IMG/M |
| 3300006049|Ga0075417_10218668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 906 | Open in IMG/M |
| 3300006797|Ga0066659_10823290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 770 | Open in IMG/M |
| 3300006845|Ga0075421_101318586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 798 | Open in IMG/M |
| 3300006845|Ga0075421_101913553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 634 | Open in IMG/M |
| 3300006845|Ga0075421_102598390 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300006847|Ga0075431_101766067 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300006854|Ga0075425_101083594 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300006854|Ga0075425_101655065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes palleronii | 721 | Open in IMG/M |
| 3300006871|Ga0075434_101681876 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300006880|Ga0075429_100834862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 807 | Open in IMG/M |
| 3300006903|Ga0075426_10312416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1151 | Open in IMG/M |
| 3300006904|Ga0075424_101263230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 785 | Open in IMG/M |
| 3300007076|Ga0075435_101211931 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300009012|Ga0066710_103282445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 618 | Open in IMG/M |
| 3300009101|Ga0105247_10166677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1462 | Open in IMG/M |
| 3300009137|Ga0066709_100907835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 1284 | Open in IMG/M |
| 3300009137|Ga0066709_103781546 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300009137|Ga0066709_103820786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 547 | Open in IMG/M |
| 3300009147|Ga0114129_11811712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 742 | Open in IMG/M |
| 3300009156|Ga0111538_10443440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1645 | Open in IMG/M |
| 3300009156|Ga0111538_12529723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Blastococcus → Candidatus Blastococcus massiliensis | 644 | Open in IMG/M |
| 3300009162|Ga0075423_12295713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 587 | Open in IMG/M |
| 3300009162|Ga0075423_12738192 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300009174|Ga0105241_10694855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 928 | Open in IMG/M |
| 3300009553|Ga0105249_12890288 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300009792|Ga0126374_10370532 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300009808|Ga0105071_1026685 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300009837|Ga0105058_1134897 | Not Available | 593 | Open in IMG/M |
| 3300009840|Ga0126313_10481592 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300010038|Ga0126315_10204893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1190 | Open in IMG/M |
| 3300010042|Ga0126314_10961686 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300010045|Ga0126311_11613213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
| 3300010100|Ga0127440_1060666 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300010322|Ga0134084_10307823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 591 | Open in IMG/M |
| 3300010325|Ga0134064_10256919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300010333|Ga0134080_10581520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
| 3300010335|Ga0134063_10089069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1391 | Open in IMG/M |
| 3300010335|Ga0134063_10551190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 582 | Open in IMG/M |
| 3300010359|Ga0126376_12034709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 617 | Open in IMG/M |
| 3300010360|Ga0126372_11763978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 661 | Open in IMG/M |
| 3300010366|Ga0126379_11632675 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300010376|Ga0126381_104639236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 529 | Open in IMG/M |
| 3300011270|Ga0137391_11515030 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300012199|Ga0137383_11229536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
| 3300012199|Ga0137383_11279644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 524 | Open in IMG/M |
| 3300012204|Ga0137374_10918003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 641 | Open in IMG/M |
| 3300012207|Ga0137381_11380618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 597 | Open in IMG/M |
| 3300012207|Ga0137381_11748331 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012208|Ga0137376_10173369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1861 | Open in IMG/M |
| 3300012208|Ga0137376_10658078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 905 | Open in IMG/M |
| 3300012209|Ga0137379_10902758 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300012210|Ga0137378_10548345 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300012211|Ga0137377_10443066 | Not Available | 1237 | Open in IMG/M |
| 3300012211|Ga0137377_11480355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 605 | Open in IMG/M |
| 3300012285|Ga0137370_10698951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
| 3300012349|Ga0137387_10677836 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300012349|Ga0137387_11250060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
| 3300012350|Ga0137372_10059299 | All Organisms → cellular organisms → Bacteria | 3340 | Open in IMG/M |
| 3300012350|Ga0137372_10090832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2580 | Open in IMG/M |
| 3300012350|Ga0137372_10307357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1227 | Open in IMG/M |
| 3300012353|Ga0137367_10140740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1764 | Open in IMG/M |
| 3300012355|Ga0137369_10439338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 933 | Open in IMG/M |
| 3300012355|Ga0137369_10944423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 576 | Open in IMG/M |
| 3300012355|Ga0137369_11070626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 529 | Open in IMG/M |
| 3300012356|Ga0137371_10056934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3026 | Open in IMG/M |
| 3300012356|Ga0137371_11401191 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300012358|Ga0137368_10242913 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300012358|Ga0137368_10930369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 527 | Open in IMG/M |
| 3300012360|Ga0137375_10271031 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
| 3300012360|Ga0137375_10500673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1034 | Open in IMG/M |
| 3300012360|Ga0137375_10521670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1006 | Open in IMG/M |
| 3300012360|Ga0137375_10578858 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300012360|Ga0137375_11015363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 652 | Open in IMG/M |
| 3300012960|Ga0164301_11641213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
| 3300012975|Ga0134110_10528966 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300012989|Ga0164305_10652218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 853 | Open in IMG/M |
| 3300014150|Ga0134081_10198231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 681 | Open in IMG/M |
| 3300014157|Ga0134078_10049996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1444 | Open in IMG/M |
| 3300015264|Ga0137403_11521782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 520 | Open in IMG/M |
| 3300015356|Ga0134073_10393132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 521 | Open in IMG/M |
| 3300016341|Ga0182035_11838934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 549 | Open in IMG/M |
| 3300016445|Ga0182038_11514854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 602 | Open in IMG/M |
| 3300018031|Ga0184634_10538160 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300018063|Ga0184637_10643328 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300018063|Ga0184637_10656362 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300018079|Ga0184627_10583023 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300018082|Ga0184639_10150408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1236 | Open in IMG/M |
| 3300018433|Ga0066667_10576599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 936 | Open in IMG/M |
| 3300018468|Ga0066662_11363201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 731 | Open in IMG/M |
| 3300018468|Ga0066662_12275972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 569 | Open in IMG/M |
| 3300018482|Ga0066669_10888348 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300018482|Ga0066669_10956510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 771 | Open in IMG/M |
| 3300019259|Ga0184646_1591723 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300020069|Ga0197907_10528675 | Not Available | 528 | Open in IMG/M |
| 3300020069|Ga0197907_10808177 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300021073|Ga0210378_10006548 | All Organisms → cellular organisms → Bacteria | 5218 | Open in IMG/M |
| 3300025327|Ga0209751_10445966 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300025898|Ga0207692_10620730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 696 | Open in IMG/M |
| 3300025910|Ga0207684_11262451 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300025910|Ga0207684_11577268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 532 | Open in IMG/M |
| 3300025911|Ga0207654_10835118 | Not Available | 666 | Open in IMG/M |
| 3300025928|Ga0207700_10215751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes palleronii | 1624 | Open in IMG/M |
| 3300025928|Ga0207700_10458227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1125 | Open in IMG/M |
| 3300025949|Ga0207667_11444352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 660 | Open in IMG/M |
| 3300025981|Ga0207640_10631592 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300025981|Ga0207640_11541765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 598 | Open in IMG/M |
| 3300026067|Ga0207678_10422978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes palleronii | 1155 | Open in IMG/M |
| 3300026067|Ga0207678_12011783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans flavus | 503 | Open in IMG/M |
| 3300026121|Ga0207683_10424199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1225 | Open in IMG/M |
| 3300026295|Ga0209234_1236181 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 600 | Open in IMG/M |
| 3300026326|Ga0209801_1297930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 576 | Open in IMG/M |
| 3300027490|Ga0209899_1018182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1582 | Open in IMG/M |
| 3300027511|Ga0209843_1017140 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300028878|Ga0307278_10278720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 740 | Open in IMG/M |
| 3300031092|Ga0308204_10348700 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300031114|Ga0308187_10221237 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300031546|Ga0318538_10160602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1191 | Open in IMG/M |
| 3300031547|Ga0310887_11017758 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300031573|Ga0310915_10188824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1438 | Open in IMG/M |
| 3300031680|Ga0318574_10226951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1077 | Open in IMG/M |
| 3300031713|Ga0318496_10064081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1926 | Open in IMG/M |
| 3300031744|Ga0306918_11492586 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300031747|Ga0318502_10690010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 617 | Open in IMG/M |
| 3300031779|Ga0318566_10538637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 571 | Open in IMG/M |
| 3300031795|Ga0318557_10153324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1042 | Open in IMG/M |
| 3300031821|Ga0318567_10488774 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300031833|Ga0310917_10620970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 734 | Open in IMG/M |
| 3300031879|Ga0306919_10242271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1354 | Open in IMG/M |
| 3300031890|Ga0306925_10687985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1071 | Open in IMG/M |
| 3300031910|Ga0306923_10557843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1290 | Open in IMG/M |
| 3300031910|Ga0306923_11288187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 776 | Open in IMG/M |
| 3300031912|Ga0306921_11068158 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300032041|Ga0318549_10378760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 638 | Open in IMG/M |
| 3300032076|Ga0306924_12554704 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300032126|Ga0307415_101641404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 618 | Open in IMG/M |
| 3300032174|Ga0307470_10371873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1000 | Open in IMG/M |
| 3300032261|Ga0306920_103332121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 598 | Open in IMG/M |
| 3300033412|Ga0310810_10018897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8271 | Open in IMG/M |
| 3300033412|Ga0310810_10549641 | Not Available | 1129 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.60% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.30% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.07% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.49% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.33% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.91% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.74% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.16% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.16% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.16% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.16% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.16% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.58% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.58% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.58% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010100 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_03940490 | 2124908045 | Soil | APPGIFEGIATTKGYKTYYNVPAPAPGVDAGRTLFHVR |
| cont_0038.00001460 | 2166559005 | Simulated | MTIGCHGPGAPPGIFEGIATTKGFTTYYNVPDPVPGVDAGRTNFHVVSTRK |
| JGI1027J12803_1091169272 | 3300000955 | Soil | APPGIFEGVATTKGFKTYYTVPAPVAGVDFGRTLFHVR* |
| JGI10216J12902_1175550162 | 3300000956 | Soil | VLTVGCHGPGAPPGIFEGIATTKGFKTYYNVPAPAPGVDAGRTLFHVR* |
| Ga0062595_1018981253 | 3300004479 | Soil | DGSSGTLTVGCHGPGAPPGIFEGIATTKGFKTYYTVPAPAPGVDAGRTIFHVR* |
| Ga0062595_1022935611 | 3300004479 | Soil | GAPPGIFEGIATTKGYTTYYTVPAPVPGVDAGRTNFHVR* |
| Ga0066395_104176512 | 3300004633 | Tropical Forest Soil | DGSEGVLTLGCHGTGAPPGIFEGIATTKGFKTYYEVPDVVPGVDAGRTNFHVR* |
| Ga0066683_105838201 | 3300005172 | Soil | GVLTVGCHGPGAPPGIFEGIATTKGFKTYYAVQPPVPGVDANRTLYHVR* |
| Ga0066679_104538242 | 3300005176 | Soil | CHGPAAPAGIFEGIATTKGYKTYYSVEDPKGGVDANRTIFHILSP* |
| Ga0066679_107820841 | 3300005176 | Soil | GVLTVGCHGPGAPAGIFEGIAVTKGYVTYYNVAAPTGGVDANRTIFHVRR* |
| Ga0066678_109821341 | 3300005181 | Soil | LTIGCHGPGAPPGIFEGIATTKGYKTYYTVQPPTNGVDANRTIFHVR* |
| Ga0066676_107792342 | 3300005186 | Soil | PGAPPGIFEGIATTKGFKTYYAVQPPVPGVDANRTLYHVR* |
| Ga0066675_113720312 | 3300005187 | Soil | YSDGSSGVLTVGCHGPGAPPGIFEGIATTKGYVTYYNVAAPTGGVDANRTIFHVLR* |
| Ga0070680_1005026301 | 3300005336 | Corn Rhizosphere | GQSGVLTVGCHGPGAPAGIFEGIATTKGYKTYYNVPAPLGNVDAGRTLFHVH* |
| Ga0070688_1000852743 | 3300005365 | Switchgrass Rhizosphere | HGTGAPPGIFEGIATTKGYTTYYTVPAPVPGVDAGRTNFHVR* |
| Ga0070703_101362863 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | DGSSGVLTVGCHGPGAPNGIFEGIAVTKGYLTYYTVAAPTGGVDANRTIFHVRR* |
| Ga0070709_111408251 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | GVLTIGCHGPGAPPGIFEGIATTKGYTTYYNVPDPVPGVDAGRTNFHVR* |
| Ga0070713_1001234231 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | SQGVLTVGCHGPGAPPGIFEGIATTKGFTTYYEVPDPVPGVDAGRTNFHVR* |
| Ga0070663_1021492562 | 3300005455 | Corn Rhizosphere | GSTGVLTVGCHGPGAPPGIFEGIATTKGFKTYYSVPTPVPGVDAGRTLFHVR* |
| Ga0070698_1020036161 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LTVGCHGPGAPPGIFEGIAVTKGFKTYYTVEPPAAGVDANRTLFHVR* |
| Ga0070693_1015832102 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | HGPGAPAGIFEGIATTKGYKTYYNVPAPLANVDAGRTLFHVD* |
| Ga0066692_105391453 | 3300005555 | Soil | SGVLTVGCHGPGAPNGIFEGIAVTKGYLTYYNVAAPTGGVDANRTIFHVLG* |
| Ga0066707_100836201 | 3300005556 | Soil | GPGAPPGIFEGIATTKGYKTYYNVPAPVPGVDAGRTIFHVR* |
| Ga0066703_108239962 | 3300005568 | Soil | GSQGVLTVGCHGPGAPAGIFEGIATTKGYKTYYNVSPPVAGVDANRTTFHVR* |
| Ga0068854_1019185732 | 3300005578 | Corn Rhizosphere | APPGIFEGIATTKGYTTYYTVPAPVPGVDAGRTNFHVR* |
| Ga0066654_104383511 | 3300005587 | Soil | GVLTVGCHGPAAPNGIFEGIAVTKGFVTYYNVAAPAGGVDANRTIFHVRR* |
| Ga0068856_1005993734 | 3300005614 | Corn Rhizosphere | PGIFEGIATTKGYTTYYEVPDVVPGVDAGRTNFHVR* |
| Ga0066903_1029387623 | 3300005764 | Tropical Forest Soil | FSDGKSGVLTVGCHGPGAPPGIFEGIATTKGYTTYYAVQPPVPGVDANRTVFHVR* |
| Ga0068851_105981842 | 3300005834 | Corn Rhizosphere | HGPGAPPGIFEGIATTKGYTTYYTVPAPVPGVDAGRTNFHVR* |
| Ga0066652_1006759362 | 3300006046 | Soil | TGVLTVGCHGPGAPPGIFEGIATTKGFKTYYSVPAPVGGVDAGRTLFHVE* |
| Ga0075417_101888591 | 3300006049 | Populus Rhizosphere | PGIFEGIATTKGFTTYYNVPDPVPGVDAGRTNFHVR* |
| Ga0075417_102186682 | 3300006049 | Populus Rhizosphere | GVLTVGCHGPGAPPGIFEGIATTKGFKTYYNVQDPAAGVDANRTNFHILR* |
| Ga0066659_108232902 | 3300006797 | Soil | VLTVGCHGPGAPPGIFEGIATTKGYKTYYNVPAPVSGVDAGRTIFHVR* |
| Ga0075421_1013185861 | 3300006845 | Populus Rhizosphere | PGIFEGIATTKGFKTYYNVQDPAAGVDANRTNFHILR* |
| Ga0075421_1019135532 | 3300006845 | Populus Rhizosphere | APPGIFEGIATTKGFKTYYNVQDPAAGVDANRTNFHILR* |
| Ga0075421_1025983901 | 3300006845 | Populus Rhizosphere | GIFEGIATTKGFTTYYEVPDPVPGVDAGRTNFHVR* |
| Ga0075431_1017660671 | 3300006847 | Populus Rhizosphere | FSDGSEGVLTIGCHGTGAPPGIFEGIATTKGYTTYYEVPDVVPGVDAGRTNFHVR* |
| Ga0075425_1010835943 | 3300006854 | Populus Rhizosphere | GVLTIGCHGTGAPPGIFEGIATTKGYTTYYEVPDVVPGVDAGRTNFHVR* |
| Ga0075425_1016550651 | 3300006854 | Populus Rhizosphere | CHGPGAPPGIFEGIATTKGYTTYYTVPAPVPGVDAGRTNFHVR* |
| Ga0075434_1016818761 | 3300006871 | Populus Rhizosphere | IFEGIATTKGFTTYYEVPDPVPGVDAGRTNFHVR* |
| Ga0075429_1008348622 | 3300006880 | Populus Rhizosphere | HGPGAPPGIFEGIATTKGFKTYYTVQAPVAGVDANRTIFHILR* |
| Ga0075426_103124161 | 3300006903 | Populus Rhizosphere | GVLTIGCHGPGAPPGIFEGIATTKGYTTYYEVPDPVPGVDGGRTNFHVR* |
| Ga0075424_1012632302 | 3300006904 | Populus Rhizosphere | LTIGCHGTGAPPGIFEGIATTKGYTTYYEVPDVVPGVDAGRTNFHVR* |
| Ga0075435_1012119312 | 3300007076 | Populus Rhizosphere | PPGIFEGIATTKGFKTYYSVPTPVPGVDAGRTLFHVR* |
| Ga0066710_1032824451 | 3300009012 | Grasslands Soil | RGTLVIGCHGTGAPPGIFEGVTATKGYTTYDEPQEPAPGVDANRTVFHVEQ |
| Ga0105247_101666771 | 3300009101 | Switchgrass Rhizosphere | APPGIFEGIATTKGYTTYYEVPDVVPGVDAGRTNFHVR* |
| Ga0066709_1009078352 | 3300009137 | Grasslands Soil | TVGCHGPGAPPGIFEGIATTKGYKTYYNVQSPAPGVDANRTIFHVR* |
| Ga0066709_1037815462 | 3300009137 | Grasslands Soil | VGCHGPGATAGIFEGIAATKGYKTYYEVPEPLGAVNAGRTLFHVNK* |
| Ga0066709_1038207861 | 3300009137 | Grasslands Soil | DGQSGVLTVGCHGPGAPPGIIEGIATTKDFKTYYESEEPVGGVDANRTLFHVVK* |
| Ga0114129_118117121 | 3300009147 | Populus Rhizosphere | VVADAPPGIFEGIATTKRYKTYYDVQPPQAGVDANRTIFHVRG* |
| Ga0111538_104434403 | 3300009156 | Populus Rhizosphere | GCHGTGAPPGIFEGIATTKGYTTYYEVPDVVPGVDAGRTNFHVR* |
| Ga0111538_125297232 | 3300009156 | Populus Rhizosphere | AFSDGSQGVLTIGCHGPGAPPGIFEGIATTKGYTTYYEVPDPVPGVDAGRTNFHVR* |
| Ga0075423_122957132 | 3300009162 | Populus Rhizosphere | HGPGAPPGIFEGIATTKGYKTYYEAEEPAPRVDANRTLFHVR* |
| Ga0075423_127381921 | 3300009162 | Populus Rhizosphere | VGCHGPGAPPGIFEGIATTKGFTTYYEVPDPVPGVDGGRTNFHVR* |
| Ga0105241_106948551 | 3300009174 | Corn Rhizosphere | AGIFEGIATTKGHTTFYNVTAPPANGNTGRTLFHVRS* |
| Ga0105249_128902881 | 3300009553 | Switchgrass Rhizosphere | VLTVGCHGPGAPAGIFEGIATTKGYRTYYNVPAPLANVDAGRTLFHVH* |
| Ga0126374_103705321 | 3300009792 | Tropical Forest Soil | GVLTIGCHGPGAPPGIFEGIATTKGFTTYYTVPDPVPGVDAGRTNFHVR* |
| Ga0105071_10266851 | 3300009808 | Groundwater Sand | VGCHGPGSPPGIFEGIAVTKGFRTFYNVQAPVGGVDANRTIFHVSSDNGD* |
| Ga0105068_11162752 | 3300009836 | Groundwater Sand | PGAPPGIFEGIAVTKSFTTYYNVQPPVGGVDANRTLFHVSS* |
| Ga0105058_11348971 | 3300009837 | Groundwater Sand | QSGVLTVGCHGPGAPAGIFEGIAVTKGFTTYYNVPAPLPNVNSGRTLFHATG* |
| Ga0126313_104815921 | 3300009840 | Serpentine Soil | TVGCHGPGAPPGIFEGIAATRGFKTYYDVQAPVNGVDANRTIFHVRR* |
| Ga0126315_102048931 | 3300010038 | Serpentine Soil | APPGIFEGIATTKGFKTYYDVQAPVAGVDANRTIFHILG* |
| Ga0126314_109616862 | 3300010042 | Serpentine Soil | GVLTVGCHGPGAPPGIFEGIAVTRGFKTYYDVQAPVNGVDANRTIFHVRR* |
| Ga0126311_116132131 | 3300010045 | Serpentine Soil | PPGIFEGIATTKGFKTYYNVPAPVGGVDAGRTLFHVR* |
| Ga0127440_10606661 | 3300010100 | Grasslands Soil | GASGVLTVGCHGPAAPNGIFEGIAVTKGFVTYYNVAAPAGGVDANRTIFHVRR* |
| Ga0134084_103078232 | 3300010322 | Grasslands Soil | IKFSDGSTGVLTVGCHGPGAPPGIFEGIATTKGYKTYYTVPTPVPGVDAGRTLFHVR* |
| Ga0134064_102569192 | 3300010325 | Grasslands Soil | LTVGCHGPGAPAGIFEGIAVTKGFTTYYNVQPPAAGVDANRTLFHVVAGKNEDEQ* |
| Ga0134080_105815201 | 3300010333 | Grasslands Soil | PGIFEGIATTKGFKTYYNVQAPVAGVDANRTNFHILR* |
| Ga0134063_100890691 | 3300010335 | Grasslands Soil | DGSSGILTVGCHGPGAPPGIFEGIATTKGYKTYYNVQAPTPGVDANRTIFHVR* |
| Ga0134063_105511902 | 3300010335 | Grasslands Soil | AFSDGTQGVLTVGCHGPGAPPGIFEGIATTKGYNTYYSVGAPAGGVDANRTIFHVQ* |
| Ga0126376_120347092 | 3300010359 | Tropical Forest Soil | CHGPGAPPGIFEGIAVTKGFTTYYNVPAPVPGVDAGRTNFHVR* |
| Ga0126372_117639781 | 3300010360 | Tropical Forest Soil | LTIGCHGPGAPPGIFEGIATTKGFTTYYDVPAPVPGVDAGRTNFHVR* |
| Ga0126372_124032401 | 3300010360 | Tropical Forest Soil | DGSQGTLLVGCHGPGAPSGIFEGIVATKGFVTYWGNQAPVPGVNANRTIFHVM* |
| Ga0126379_116326751 | 3300010366 | Tropical Forest Soil | EGVLTIGCHGPGAPPGIFEGIATTKGSTTYYNVPAPVPGVNGGRTNFHVR* |
| Ga0126381_1046392362 | 3300010376 | Tropical Forest Soil | GCHGPGAPPGIFEGIATTKGFETYYEVPDVVPGVDAGRTNFHVR* |
| Ga0137391_115150301 | 3300011270 | Vadose Zone Soil | SGVLTVSCHGPGAPAGIFEGIAATKGYKTYYAVQAPVGGVDANRTSFHVFVH* |
| Ga0137383_112295361 | 3300012199 | Vadose Zone Soil | PPGIFEGIATTKGFKTYYDVQDPVGGVDANRTIFHVR* |
| Ga0137383_112796442 | 3300012199 | Vadose Zone Soil | CHGPGAPPGIFEGIATTKGYKTYYNVQAPASGVDANRTIFHVR* |
| Ga0137374_109180032 | 3300012204 | Vadose Zone Soil | IAFSDGSTGVLTVGCHGPGAPPGIFEGIATTKGYKTYYTVPTPVPGVDAGRTLFHVR* |
| Ga0137381_113806181 | 3300012207 | Vadose Zone Soil | ESGVLTVGCHGPGAPPGIFEGIATTKGYKTYYAVPVPVGGVDANRTLFHILK* |
| Ga0137381_117483312 | 3300012207 | Vadose Zone Soil | VGCHGPGAPPGIFEGIATTKGFTTYYNVPAPVAGVNAGRTNFHVR* |
| Ga0137376_101733692 | 3300012208 | Vadose Zone Soil | TVGCHGPGAPPGIFEGIATTKGFKTYYNVQDPVGGVDANRTIFHVR* |
| Ga0137376_106580782 | 3300012208 | Vadose Zone Soil | GCHGPGAPPGIFEGIATTKGYKTYYTVRDPVGGVDANRTIFHVR* |
| Ga0137379_109027582 | 3300012209 | Vadose Zone Soil | VLTVGCHGPGAPAGIFEGIAVTKGFVTYYNVQAPTGGVDANRTLFHVRR* |
| Ga0137378_105483452 | 3300012210 | Vadose Zone Soil | SGVLTVGCHGPGAPPGIFEGIATTKGYKTYYNVPAPAPGVDAGRTIFHVR* |
| Ga0137377_104430662 | 3300012211 | Vadose Zone Soil | LTVGCHGPGAPPGIFEGIATTKGYKTYYNVQTPAPGVDANRTIFHVR* |
| Ga0137377_114803552 | 3300012211 | Vadose Zone Soil | AFSDGSEGVLTIGCHGPGAPPGIFEGIATTKGYTTYYNVPAPVPGVDAGRTNFHVR* |
| Ga0137370_106989511 | 3300012285 | Vadose Zone Soil | GSRGVLTIGCHGPGAPPGIFEGIATTKGFTTYYNVPDPVPGVDGGRTNFHVR* |
| Ga0137387_106778361 | 3300012349 | Vadose Zone Soil | VGCHRPGAPPGIFEGIATTQGYKTYYNVPAPVPGVDAGRTIFHVR* |
| Ga0137387_112500602 | 3300012349 | Vadose Zone Soil | PGAPPGIFEGIATTKGYTTYYNVPDPVPGVDAGRTNFHVR* |
| Ga0137372_100592991 | 3300012350 | Vadose Zone Soil | IFEGIATTKGYKTYYAVSAPAPGVDANRTLYHVR* |
| Ga0137372_100908324 | 3300012350 | Vadose Zone Soil | GAPPGIFEGIATTKGYKTYYNVPTPAPGVDAGRTLFHVR* |
| Ga0137372_103073573 | 3300012350 | Vadose Zone Soil | TGALTVGCHGPGAPLGIFEGIATTKGFKTYYTVAAPVGGVDANRTIFHVR* |
| Ga0137367_101407401 | 3300012353 | Vadose Zone Soil | PPGIFEGIATTKGFKTYYAVQPPAPGVDANRTLFHVR* |
| Ga0137369_104393382 | 3300012355 | Vadose Zone Soil | GSTGVLTVGCHGPGAPPGIFEGIATTKGFKTYYAVQPPAPGVDANRTLFHVG* |
| Ga0137369_109444231 | 3300012355 | Vadose Zone Soil | FSDGSTGVLTVGCHGPGAPPRIFEGIATTKGYKTYYTVPSPVPGVDANRTIFHVR* |
| Ga0137369_110706261 | 3300012355 | Vadose Zone Soil | GAPPGIFEGIATTKGFRTFYSVQPPAAGVDANRTLFHVG* |
| Ga0137371_100569347 | 3300012356 | Vadose Zone Soil | CHGPGAPPGIFEGIATTKGYKTYYNVQAPVPGVDGNRTIFHVR* |
| Ga0137371_114011912 | 3300012356 | Vadose Zone Soil | GCHGPGAPAGIFEGIAVTKGYVTYYDVQAPTGGVDANRTIFHVRR* |
| Ga0137368_102429132 | 3300012358 | Vadose Zone Soil | DGIFEGIATTKGYKTYYNVPAPLGTVDAGRTVFHVN* |
| Ga0137368_109303692 | 3300012358 | Vadose Zone Soil | GIFEGIATTKGYKTYYDVQPPQGGVDANRTIFHVRQ* |
| Ga0137375_102710313 | 3300012360 | Vadose Zone Soil | GPGAPPGIFEGIATTKGFKTYYDIQPPSPGVDANRTIFHVR* |
| Ga0137375_105006731 | 3300012360 | Vadose Zone Soil | TGVLTVGCHGPGAPPGIFEGIATTKGFKTYYAVQAPVPGVDANRTLFHVR* |
| Ga0137375_105216704 | 3300012360 | Vadose Zone Soil | GVLTVGCHGPGAPPGIFEGIATTKGFKTYYTVPAPVGGVDAGRTLFHVR* |
| Ga0137375_105788581 | 3300012360 | Vadose Zone Soil | KIAFSDGSTGVLTVGCHGPGAPPGIFEGIATTKGFKTYYTVPTPVAGVDAGRTLFHVR* |
| Ga0137375_110153633 | 3300012360 | Vadose Zone Soil | APPGIFEGIATTKGYKTYYTVPSPVPGVDANRTIFHVR* |
| Ga0164301_116412132 | 3300012960 | Soil | HGTGAPPGIFEGIATTKGYTTYYEVPDPVPGVDAGRTNFHVR* |
| Ga0134110_105289661 | 3300012975 | Grasslands Soil | GVLTVGCHGPGAPAGIFEGIATTKGYKTYYNVSPPVAGVDANRTTFHVR* |
| Ga0164305_106522181 | 3300012989 | Soil | GVLTIGCHGTGAPPGIFEGIATTKGYKTYYEVPDVVPGVDAGRTNFHVR* |
| Ga0134081_101982312 | 3300014150 | Grasslands Soil | PGAPPGIFEGIATTKGYKTYYNVPAPAPGVDAGRTIFHVR* |
| Ga0134078_100499961 | 3300014157 | Grasslands Soil | PGAPPGIFEGIATTKGYKTYYTVPTPVPGVDAGRTLFHVR* |
| Ga0137403_115217822 | 3300015264 | Vadose Zone Soil | VGCHGPGAPPGIFEGIATTKGYKTYYSVHDPVGGVDANRTIFHVL* |
| Ga0134073_103931322 | 3300015356 | Grasslands Soil | LTIGCHGPGAPPGIFEGIATTKGYKTYYTVQPPTAGVDANRTIFHVR* |
| Ga0182035_118389341 | 3300016341 | Soil | PPGIFEGIATTKGFTTYYDVPAPVPGVDAGRTNFHVR |
| Ga0182038_115148542 | 3300016445 | Soil | GSKGVLTIGCHGPSAPHGIFEGIATTKGYTTYYNVPNPALGVDAGRTNFHVR |
| Ga0184634_105381602 | 3300018031 | Groundwater Sediment | IFEGIATTKGFKTYYNVGGTPPGVPLPGLNTGRTLFHVG |
| Ga0184637_106433282 | 3300018063 | Groundwater Sediment | TVGCHGPGAPAGIFEGIATTKGFKTYYNVPAPPPGVNTGRTLFHVG |
| Ga0184637_106563622 | 3300018063 | Groundwater Sediment | CHGPNAPAGIFEGIATTKGFTTYYNVPAPLPTVNSGRTLFHVRS |
| Ga0184627_105830232 | 3300018079 | Groundwater Sediment | RIEFSGGQSGVLTVGCHGPGAPPGIFEGIAVTKGFKTYYNVAGTPPGVPLPGLNTGRTLFHVH |
| Ga0184639_101504081 | 3300018082 | Groundwater Sediment | GAPPGIFEGIATTKGFKTYYNVPAPLGNVDAGRTLFHVH |
| Ga0066667_105765991 | 3300018433 | Grasslands Soil | VGCHGPGAPAGIFEGIATTKGFTTYYNVPAPLGTVDAGRTIFHVR |
| Ga0066662_113632011 | 3300018468 | Grasslands Soil | GIFEGIAVTKGYKTYYNVSAPVAGLDANRTIFHVRVRARR |
| Ga0066662_122759722 | 3300018468 | Grasslands Soil | MTVGCHGPAAPPGIFEGIATTKAYKTYYTVQAPVGGVDANRTIFHVR |
| Ga0066669_108883483 | 3300018482 | Grasslands Soil | KIRFSDGTTGVLTVGCHGPGAPNGIFEGIATTKGYVTYYNVPAPVGGVDAGRTVFHVR |
| Ga0066669_109565102 | 3300018482 | Grasslands Soil | CHGPGAPPGIFEGIATTKAFKTYYTVPAPAPGVDAGRTIFHVR |
| Ga0184646_15917231 | 3300019259 | Groundwater Sediment | SGVLTVGCHGPGAPAGIFEGIATTKGYTTFYNVPVPPANVNTGRTLFHVRS |
| Ga0197907_105286751 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | IFEGIATTKGHTTFYNVTAPPANGNTGRTLFHVRS |
| Ga0197907_108081771 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | LTVGCHGPGAPAGIFEGIAVTKGYVTYYNVAAPTGGVDANRTIFHVLK |
| Ga0210378_100065486 | 3300021073 | Groundwater Sediment | GASGVLTVGCHGPGAPAGIFEGIATTKGFTTYYNVPAPPANANEGRTLFHVR |
| Ga0209751_104459662 | 3300025327 | Soil | AGIFEGIATTKGFTTYYNVPAPPPGVNTGRTLFHVG |
| Ga0207692_106207301 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | GSAGVLTIGCHGTGAPPGIFEGIATTKGYTTYYEVPDVVPGVDAGRTNFHVR |
| Ga0207684_112624512 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LTVGCHGPGAPAGIFEGIAVTKGYLTYYNVAAPAGGVDANRTIFHVLK |
| Ga0207684_115772681 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | APPGIIEGIATTKGFKTYYETEEPEPGVDANRTLFHILK |
| Ga0207654_108351182 | 3300025911 | Corn Rhizosphere | AGIFEGIATTKGHTTFYNVTAPPANGNTGRTLFHVRS |
| Ga0207700_102157512 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | HGPGAPPGIFEGIATTKGYTTYYTVPAPVPGVDAGRTNFHVR |
| Ga0207700_104582272 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | FSDGSDGVLTIGCHGTGAPPGIFEGIATTKGYTTYYEVPDVVPGVDAGRTKFHVR |
| Ga0207667_114443521 | 3300025949 | Corn Rhizosphere | APPGIFEGIATTKGYTTYYEVPDPVPGVDGGRTNFHVR |
| Ga0207640_106315923 | 3300025981 | Corn Rhizosphere | PAGIFEGIAVTKGYVTYYDVAAPTGGVDANRTIFHVLK |
| Ga0207640_115417652 | 3300025981 | Corn Rhizosphere | DGVLTIGCHGPGAPPGIFEGIATTKGYTTYYTVPAPVPGVDAGRTNFHVR |
| Ga0207678_104229781 | 3300026067 | Corn Rhizosphere | PGAPPGIFEGIATTKGYTTYYTVPAPVPGVDAGRTNFHVR |
| Ga0207678_120117832 | 3300026067 | Corn Rhizosphere | GSTGVLTVGCHGPGAPPGIFEGIATTKGFKTYYSVPTPVPGVDAGRTLFHVR |
| Ga0207683_104241991 | 3300026121 | Miscanthus Rhizosphere | GCHGTGAPPGIFEGIATTKGYTTYYEVPDVVPGVDAGRTNFHVR |
| Ga0209234_12361812 | 3300026295 | Grasslands Soil | LTLACHGPGAPPGIFEGIATTKGYKTYYEAEEPAPGVDANRTLFHVR |
| Ga0209801_12979302 | 3300026326 | Soil | GAQGVLTIGCHGPGAPPGIFEGIATTKGYKTYYTVQPPTNGVDANRTIFHVR |
| Ga0209899_10181822 | 3300027490 | Groundwater Sand | SGVLTVGCHGPGAPPGIFEGITVTKGYLTYYDPAPTLPGVDANRTLFHIQ |
| Ga0209843_10171401 | 3300027511 | Groundwater Sand | GPGAPPGIFEGIATTKGFKTYYTVQPPSPGVNANRTLFHVR |
| Ga0307278_102787201 | 3300028878 | Soil | PPGIFEGIATTKGYKTYYTVPTPVPGVDAGRTLFHVR |
| Ga0308204_103487001 | 3300031092 | Soil | APPGIFEGIAVTKGYVTYYNVAAPAMFVDANRTIFHVRR |
| Ga0308187_102212371 | 3300031114 | Soil | TVGCHGPGAPAGIFEGIATTKGYTTFYNVPAPPANANTGRTLFHVRS |
| Ga0318538_101606022 | 3300031546 | Soil | LTIGCHGPGAPPGIFEGIATTKGFTTYYDVPDPVPGVDVGRTNFHVR |
| Ga0310887_110177581 | 3300031547 | Soil | HGPGAPPGIFEGIATTKGYTTYYEVPDPVPGVDGGRTNFHVR |
| Ga0310915_101888241 | 3300031573 | Soil | VFSDGSKGVLTIGCHGPGAPHGIIEGIATTKGYMTYYNVLNPALGVDAGRTNFHVR |
| Ga0318574_102269512 | 3300031680 | Soil | SDGAQGVLTIGCHGPGAPPGIVEGIATTKNYKTYYSVEDPTAGVDANRSLFHVR |
| Ga0318496_100640812 | 3300031713 | Soil | VFSDGSKGVLTIGCHGPGAPHGIFEGIATTKGYMTYYNVPNPALGVDAGRTNFHVR |
| Ga0306918_114925861 | 3300031744 | Soil | APPGIFEGIATTKGYTTYYEVPDVVPGVDAGRTNFHVR |
| Ga0318502_106900102 | 3300031747 | Soil | GVLTIGCHGPGAPPGIFEGIAVTKGYTTYYNVPAPVPGVDAGRTNFHVR |
| Ga0318566_105386372 | 3300031779 | Soil | IGCHGPGASHGIFEGIATTKGYTTYYNVPNPALGVDAGRTNFHVR |
| Ga0318557_101533242 | 3300031795 | Soil | VFSDGSKGVLTIGCHGPGAPHGIFEGIATTKGYMTYYNVLNPALGVDAGRTNFH |
| Ga0318567_104887742 | 3300031821 | Soil | SDGSEGVLTIGCHGPGAPPGIFEGIATTKGYTTYYTVPAPVPGVNAGRTNFHVS |
| Ga0310917_106209701 | 3300031833 | Soil | IGCHGPGAPPGIFEGIATTKGYTTYYNVPDPVPGVDAGRTNFHVR |
| Ga0306919_102422711 | 3300031879 | Soil | IGCHGPGAPPGIFEGIATTKGFTTYYDVPDPVPGVDVGRTNFHVR |
| Ga0306925_106879852 | 3300031890 | Soil | GSNGALTIGCHGPGAPPGIFEGIATTKGFTTYYDVPDPVPGVDVGRTNFHVR |
| Ga0306923_105578432 | 3300031910 | Soil | DRTQGVLTIGCHGPGAPPGTFEGIATTKNYKTYYSVEDPSPGVDANRSLFHVR |
| Ga0306923_112881872 | 3300031910 | Soil | AFSDGTQGVLTIGCHGPGAPPGIFEGIAATKNFKTYYSVEDPSPGVDANRSLFHVR |
| Ga0306921_110681583 | 3300031912 | Soil | TGAPPGIFEGIATTKGYTTYYEVPDVVPGVDAGRTNFHVR |
| Ga0318549_103787601 | 3300032041 | Soil | VFSDGSKGVLTIGCHGPGASHGIFEGIATTKGYTTYYNVPNPALGVDAGRTNFHVR |
| Ga0306924_125547041 | 3300032076 | Soil | IAFSDGSEGVLTIGCHGPGAPPGIFEGIAVTKGFTTYYNVPAPVTGVDAGRTNFHVR |
| Ga0307415_1016414042 | 3300032126 | Rhizosphere | PGAPPGIFEGIATTKGFKTYYDVQAPVAGVDANRTIFHILG |
| Ga0307470_103718732 | 3300032174 | Hardwood Forest Soil | IGCHGTGAPPGIFEGIATTKGYTTYYEVPDVVPGVDAGRTNFHVR |
| Ga0306920_1033321212 | 3300032261 | Soil | GIFEGIAVTKGFTTYYNVPAPVTGVDAGRTNFHVR |
| Ga0310810_1001889713 | 3300033412 | Soil | VGCHGPGAPNGIFEGIAVTKGYLTYYTVAAPTGGVDANRTIFHVRR |
| Ga0310810_105496412 | 3300033412 | Soil | TVGCHGPGAPPGIFEGIATTKGFKTYYSVPTPVPGVDAGRTLFHVR |
| ⦗Top⦘ |