NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F035131

Metagenome Family F035131

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F035131
Family Type Metagenome
Number of Sequences 173
Average Sequence Length 54 residues
Representative Sequence MNIQTQLCTFKTADNERLHGLLFTPAGELSDLALVFVHGVAMNFYLPPLAIFGQ
Number of Associated Samples 142
Number of Associated Scaffolds 173

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 35.26 %
% of genes near scaffold ends (potentially truncated) 94.80 %
% of genes from short scaffolds (< 2000 bps) 91.33 %
Associated GOLD sequencing projects 135
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.798 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(16.185 % of family members)
Environment Ontology (ENVO) Unclassified
(29.480 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(41.040 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 36.59%    Coil/Unstructured: 63.41%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 173 Family Scaffolds
PF09084NMT1 14.45
PF12697Abhydrolase_6 10.40
PF02082Rrf2 8.67
PF03460NIR_SIR_ferr 4.05
PF01381HTH_3 2.31
PF05973Gp49 2.31
PF03401TctC 1.16
PF01797Y1_Tnp 1.16
PF00296Bac_luciferase 0.58
PF13560HTH_31 0.58
PF00034Cytochrom_C 0.58
PF01965DJ-1_PfpI 0.58
PF13278Obsolete Pfam Family 0.58
PF13578Methyltransf_24 0.58
PF01844HNH 0.58
PF13495Phage_int_SAM_4 0.58

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 173 Family Scaffolds
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 14.45
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 14.45
COG0640DNA-binding transcriptional regulator, ArsR familyTranscription [K] 8.67
COG1414DNA-binding transcriptional regulator, IclR familyTranscription [K] 8.67
COG1725DNA-binding transcriptional regulator YhcF, GntR familyTranscription [K] 8.67
COG1959DNA-binding transcriptional regulator, IscR familyTranscription [K] 8.67
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 8.67
COG2188DNA-binding transcriptional regulator, GntR familyTranscription [K] 8.67
COG2378Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domainsTranscription [K] 8.67
COG2524Predicted transcriptional regulator, contains C-terminal CBS domainsTranscription [K] 8.67
COG3657Putative component of the toxin-antitoxin plasmid stabilization moduleDefense mechanisms [V] 2.31
COG4679Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin systemDefense mechanisms [V] 2.31
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 1.16
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 1.16
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.58


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.95 %
UnclassifiedrootN/A4.05 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_19145All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2346Open in IMG/M
3300001372|YBBDRAFT_1256671All Organisms → cellular organisms → Bacteria1431Open in IMG/M
3300004011|Ga0055460_10038772All Organisms → cellular organisms → Bacteria1178Open in IMG/M
3300004019|Ga0055439_10195934All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium645Open in IMG/M
3300004114|Ga0062593_101227700All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300004145|Ga0055489_10100150All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300004145|Ga0055489_10261783All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium550Open in IMG/M
3300004156|Ga0062589_101614853All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium643Open in IMG/M
3300004480|Ga0062592_100698899All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium881Open in IMG/M
3300004480|Ga0062592_101880755All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria588Open in IMG/M
3300004480|Ga0062592_102179699All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium551Open in IMG/M
3300005180|Ga0066685_10706338All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium691Open in IMG/M
3300005186|Ga0066676_11122655All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium517Open in IMG/M
3300005187|Ga0066675_10590700All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium834Open in IMG/M
3300005289|Ga0065704_10030835All Organisms → cellular organisms → Bacteria → Proteobacteria1035Open in IMG/M
3300005345|Ga0070692_11417278All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium502Open in IMG/M
3300005353|Ga0070669_100563756All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium951Open in IMG/M
3300005364|Ga0070673_101310040All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium680Open in IMG/M
3300005437|Ga0070710_11091960All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium585Open in IMG/M
3300005444|Ga0070694_100393355All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1083Open in IMG/M
3300005456|Ga0070678_100285433All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1397Open in IMG/M
3300005457|Ga0070662_100933072All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium741Open in IMG/M
3300005458|Ga0070681_10024381All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria6089Open in IMG/M
3300005471|Ga0070698_100653430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Chroococcidiopsidales → Chroococcidiopsidaceae → Chroococcidiopsis → Chroococcidiopsis cubana → Chroococcidiopsis cubana SAG 39.79993Open in IMG/M
3300005471|Ga0070698_100983844All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium790Open in IMG/M
3300005471|Ga0070698_101113292All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium738Open in IMG/M
3300005549|Ga0070704_102176740All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage515Open in IMG/M
3300005568|Ga0066703_10049274All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2354Open in IMG/M
3300005598|Ga0066706_11017014All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium638Open in IMG/M
3300005617|Ga0068859_100693404All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1109Open in IMG/M
3300005718|Ga0068866_10826544All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium646Open in IMG/M
3300005719|Ga0068861_101246493All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium721Open in IMG/M
3300005833|Ga0074472_11426835All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium553Open in IMG/M
3300005904|Ga0075280_10087655All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300005937|Ga0081455_10429385All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium909Open in IMG/M
3300006049|Ga0075417_10521414All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium599Open in IMG/M
3300006358|Ga0068871_101707794All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium597Open in IMG/M
3300006844|Ga0075428_100501536All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1299Open in IMG/M
3300006845|Ga0075421_100134244All Organisms → cellular organisms → Bacteria3100Open in IMG/M
3300006845|Ga0075421_100944393All Organisms → cellular organisms → Bacteria980Open in IMG/M
3300006845|Ga0075421_100945729Not Available980Open in IMG/M
3300006847|Ga0075431_102238417All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300006852|Ga0075433_10053171All Organisms → cellular organisms → Bacteria3530Open in IMG/M
3300006852|Ga0075433_10104820All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2505Open in IMG/M
3300006852|Ga0075433_10818215All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300006852|Ga0075433_11404706All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium604Open in IMG/M
3300006854|Ga0075425_100418727All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1543Open in IMG/M
3300006880|Ga0075429_100290981All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1430Open in IMG/M
3300006880|Ga0075429_100587308All Organisms → cellular organisms → Bacteria976Open in IMG/M
3300006880|Ga0075429_101097551All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium695Open in IMG/M
3300006894|Ga0079215_10079078All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1380Open in IMG/M
3300006903|Ga0075426_10384296All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1035Open in IMG/M
3300006904|Ga0075424_102029957All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium607Open in IMG/M
3300006914|Ga0075436_100211275All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1375Open in IMG/M
3300007076|Ga0075435_100259254All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1481Open in IMG/M
3300009053|Ga0105095_10548568Not Available642Open in IMG/M
3300009091|Ga0102851_12257774All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium620Open in IMG/M
3300009147|Ga0114129_10052633All Organisms → cellular organisms → Bacteria5714Open in IMG/M
3300009147|Ga0114129_10409330All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1786Open in IMG/M
3300009147|Ga0114129_11002426All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1052Open in IMG/M
3300009147|Ga0114129_11221303All Organisms → cellular organisms → Bacteria935Open in IMG/M
3300009147|Ga0114129_11550003All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium813Open in IMG/M
3300009167|Ga0113563_12880641All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium583Open in IMG/M
3300009609|Ga0105347_1008584All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3551Open in IMG/M
3300009609|Ga0105347_1239802All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon742Open in IMG/M
3300009610|Ga0105340_1012263All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3380Open in IMG/M
3300009610|Ga0105340_1430736Not Available589Open in IMG/M
3300009610|Ga0105340_1577717All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium501Open in IMG/M
3300009810|Ga0105088_1002411All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2390Open in IMG/M
3300009816|Ga0105076_1104659All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium552Open in IMG/M
3300009818|Ga0105072_1062707Not Available717Open in IMG/M
3300009836|Ga0105068_1001694All Organisms → cellular organisms → Bacteria3127Open in IMG/M
3300010037|Ga0126304_10965721All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium580Open in IMG/M
3300010043|Ga0126380_11638427All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium576Open in IMG/M
3300010047|Ga0126382_10421476All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1048Open in IMG/M
3300010047|Ga0126382_11018155All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium727Open in IMG/M
3300010362|Ga0126377_11483533All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium752Open in IMG/M
3300010362|Ga0126377_12971712All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium547Open in IMG/M
3300010403|Ga0134123_12409163All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria591Open in IMG/M
3300011119|Ga0105246_10774745All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium848Open in IMG/M
3300011412|Ga0137424_1058107All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium725Open in IMG/M
3300011420|Ga0137314_1147843All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium574Open in IMG/M
3300011427|Ga0137448_1210591All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300012041|Ga0137430_1055533All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1078Open in IMG/M
3300012160|Ga0137349_1048040All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium745Open in IMG/M
3300012189|Ga0137388_11710099All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium563Open in IMG/M
3300012202|Ga0137363_11272914All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium623Open in IMG/M
3300012205|Ga0137362_10089909All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2572Open in IMG/M
3300012232|Ga0137435_1116744All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300012501|Ga0157351_1003915All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1125Open in IMG/M
3300012515|Ga0157338_1007840All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1021Open in IMG/M
3300012582|Ga0137358_10412569All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium913Open in IMG/M
3300012922|Ga0137394_10672318All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium873Open in IMG/M
3300012922|Ga0137394_11335221All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium579Open in IMG/M
3300012925|Ga0137419_10295808All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1236Open in IMG/M
3300012948|Ga0126375_10733732All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium773Open in IMG/M
3300012985|Ga0164308_10135460All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1795Open in IMG/M
3300013297|Ga0157378_13210854All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria508Open in IMG/M
3300013308|Ga0157375_11194464All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium892Open in IMG/M
3300013308|Ga0157375_11984100All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria692Open in IMG/M
3300014150|Ga0134081_10346675All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium544Open in IMG/M
3300014262|Ga0075301_1158160Not Available532Open in IMG/M
3300014326|Ga0157380_11133738All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium823Open in IMG/M
3300014326|Ga0157380_12773017All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium557Open in IMG/M
3300014872|Ga0180087_1049997All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium785Open in IMG/M
3300014873|Ga0180066_1101785All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium592Open in IMG/M
3300014875|Ga0180083_1103672All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium624Open in IMG/M
3300014881|Ga0180094_1111578All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium635Open in IMG/M
3300014881|Ga0180094_1167060All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium516Open in IMG/M
3300015374|Ga0132255_101928785All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium898Open in IMG/M
3300016270|Ga0182036_10343317All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1148Open in IMG/M
3300017792|Ga0163161_11162494All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium666Open in IMG/M
3300017944|Ga0187786_10257355All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium695Open in IMG/M
3300018027|Ga0184605_10184610All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium944Open in IMG/M
3300018052|Ga0184638_1129798All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium918Open in IMG/M
3300018053|Ga0184626_10165007All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium941Open in IMG/M
3300018053|Ga0184626_10180659All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium896Open in IMG/M
3300018059|Ga0184615_10444451All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium705Open in IMG/M
3300018067|Ga0184611_1059925All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1282Open in IMG/M
3300018074|Ga0184640_10029644All Organisms → cellular organisms → Bacteria2162Open in IMG/M
3300018081|Ga0184625_10659732All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium506Open in IMG/M
3300018082|Ga0184639_10610144All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium534Open in IMG/M
3300018083|Ga0184628_10488766All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300018422|Ga0190265_10978074All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium968Open in IMG/M
3300018432|Ga0190275_12681375All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria575Open in IMG/M
3300018432|Ga0190275_13534797All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium506Open in IMG/M
3300018469|Ga0190270_10076726All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2458Open in IMG/M
3300019878|Ga0193715_1011821All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1872Open in IMG/M
3300020060|Ga0193717_1010883All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium4346Open in IMG/M
3300021081|Ga0210379_10341931All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300021560|Ga0126371_13597991All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium523Open in IMG/M
3300022756|Ga0222622_10149597All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1504Open in IMG/M
3300025289|Ga0209002_10268102All Organisms → cellular organisms → Bacteria1019Open in IMG/M
3300025322|Ga0209641_11031383All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium531Open in IMG/M
3300025792|Ga0210143_1073615Not Available618Open in IMG/M
3300025911|Ga0207654_11107634All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium577Open in IMG/M
3300025912|Ga0207707_11172210All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium623Open in IMG/M
3300025937|Ga0207669_11855771All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium515Open in IMG/M
3300026535|Ga0256867_10176972All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium789Open in IMG/M
3300026540|Ga0209376_1416009All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium502Open in IMG/M
3300027379|Ga0209842_1091838All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300027639|Ga0209387_1025061All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1182Open in IMG/M
3300027722|Ga0209819_10046353All Organisms → cellular organisms → Bacteria1488Open in IMG/M
3300027722|Ga0209819_10293450All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium560Open in IMG/M
3300027815|Ga0209726_10530256All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300027843|Ga0209798_10194675All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300027873|Ga0209814_10448655All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium569Open in IMG/M
3300027907|Ga0207428_10935025All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium611Open in IMG/M
3300027909|Ga0209382_10627441All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Zambryskibacteria → Candidatus Zambryskibacteria bacterium RIFCSPLOWO2_01_FULL_35_191166Open in IMG/M
3300027909|Ga0209382_11748695All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium608Open in IMG/M
3300027909|Ga0209382_12055206Not Available546Open in IMG/M
3300027979|Ga0209705_10567070All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium546Open in IMG/M
3300028536|Ga0137415_10386625All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1203Open in IMG/M
3300028828|Ga0307312_10931933All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium575Open in IMG/M
3300031200|Ga0307496_10139661All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium508Open in IMG/M
3300031716|Ga0310813_10445801All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1122Open in IMG/M
3300031740|Ga0307468_101181759All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium688Open in IMG/M
3300031820|Ga0307473_10130250All Organisms → cellular organisms → Bacteria1397Open in IMG/M
3300031820|Ga0307473_10519652All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium807Open in IMG/M
3300031912|Ga0306921_10669424All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1195Open in IMG/M
3300031949|Ga0214473_11721968All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium623Open in IMG/M
3300031962|Ga0307479_10799304All Organisms → cellular organisms → Bacteria919Open in IMG/M
3300032012|Ga0310902_10647892All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium706Open in IMG/M
3300032017|Ga0310899_10467743All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax615Open in IMG/M
3300032180|Ga0307471_103960186All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium523Open in IMG/M
3300032205|Ga0307472_101895315All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium594Open in IMG/M
3300032211|Ga0310896_10878038All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium518Open in IMG/M
3300032421|Ga0310812_10241881All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium792Open in IMG/M
3300033486|Ga0316624_10557949All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium989Open in IMG/M
3300034115|Ga0364945_0258699All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium538Open in IMG/M
3300034150|Ga0364933_038583All Organisms → cellular organisms → Bacteria1172Open in IMG/M
3300034178|Ga0364934_0416813All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium508Open in IMG/M
3300034354|Ga0364943_0234374All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium682Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere16.18%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil9.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.94%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment5.78%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.62%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.05%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.47%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.47%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.89%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand2.89%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.31%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment2.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.73%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.73%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.16%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.16%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.16%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.16%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.16%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.16%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.58%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.58%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.58%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine0.58%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.58%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.58%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.58%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.58%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.58%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.58%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.58%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.58%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.58%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.58%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.58%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.58%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.58%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.58%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.58%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.58%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.58%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.58%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.58%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.58%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.58%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300001372YB-Back-sedEnvironmentalOpen in IMG/M
3300004011Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004019Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004145Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005833Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBKEnvironmentalOpen in IMG/M
3300005904Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_404EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009810Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30EnvironmentalOpen in IMG/M
3300009816Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10EnvironmentalOpen in IMG/M
3300009818Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40EnvironmentalOpen in IMG/M
3300009836Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011412Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2EnvironmentalOpen in IMG/M
3300011420Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2EnvironmentalOpen in IMG/M
3300011427Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2EnvironmentalOpen in IMG/M
3300012041Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2EnvironmentalOpen in IMG/M
3300012160Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT630_2EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012232Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2EnvironmentalOpen in IMG/M
3300012501Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610EnvironmentalOpen in IMG/M
3300012515Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610Host-AssociatedOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014262Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014872Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10DEnvironmentalOpen in IMG/M
3300014873Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10DEnvironmentalOpen in IMG/M
3300014875Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10DEnvironmentalOpen in IMG/M
3300014881Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1DaEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019878Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2EnvironmentalOpen in IMG/M
3300020060Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2EnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025289Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2EnvironmentalOpen in IMG/M
3300025322Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025792Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300027379Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027639Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)EnvironmentalOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027815Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027843Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027979Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300031200Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_SEnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M
3300034150Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17EnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_033059402199352025SoilMNFQTEICTFKTADNERLHGALFTPPERPADLALLFVHGVAMNF
YBBDRAFT_125667123300001372Marine EstuarineMNYQTQIHTFKTADNERLHGALLTPPDGASDLGLIFVHGVAMNFYLPPLFNFGQILRSELGDLQSWAE*
Ga0055460_1003877243300004011Natural And Restored WetlandsMNYHTQIHTFKTADNERLHGALLTPPSGTSDLGLIFVHGVAMNFYLPPLFNFGQALA
Ga0055439_1019593413300004019Natural And Restored WetlandsMKYQTQIVTFKTADNERLHGALLTPPNKKSDTALIFVHGVAMNFYLPPLFNFGQELSERGHHCFVIN
Ga0062593_10122770013300004114SoilMNYHTHIHTFKTADNERLHGALLTPPHGASDLGLIFVHGVAMNFYLPPLFNFGQAL
Ga0055489_1010015013300004145Natural And Restored WetlandsMTIETQLCTFKTADNERLHGLFFTPPGDGSDLALVFVHGVAMNFYLPPLVIFGQELAKRGKHCFVTNTRG
Ga0055489_1026178323300004145Natural And Restored WetlandsMNCQTQIHTFKTADNERLHGALLTPPDGASDLGLILVHGVAMNFYLPPLFSFGQELALRGYHGFVINTR
Ga0062589_10161485313300004156SoilMSFHTRLCTFKTDDNERLHGLLFASQTQHTDLALLFVHGVAMNFY
Ga0062592_10069889923300004480SoilMNYQTQIHSFKTADNERLHGALLTPSDRKSDIALIFVHGVA
Ga0062592_10188075533300004480SoilMNYHTQIHTFKTADNERLHGALLTPPSGVSDLGLIFVHGVAMNFYLPPL
Ga0062592_10217969913300004480SoilMIIETRLLNFKTSDKETLHGLLFTPREKKSDLALLLVHGVAMNFYLPPLATFGQALAQQG
Ga0066685_1070633813300005180SoilMSIDTQLCAFKTADNERLHGLLFTPPQSPSDLALIMVHGVAMNFYLPPLVIFG
Ga0066676_1112265513300005186SoilMNLHTEFFSFKTADNERLHGLLFTPPESQSDLALVFVHGVAMNFYLPPLVVFGQELAQR
Ga0066675_1059070023300005187SoilMAITTQLCNFKTSDSERLHGLLFTPENRQSDLALLFVHGVAMNFYLPPLSIFGQELAERG
Ga0065704_1003083523300005289Switchgrass RhizosphereMNYQTQILTFTTADNERLHGALLTPNENPSDLVLIFVHGVAMNFYLPPLFTFGQELA
Ga0070692_1141727813300005345Corn, Switchgrass And Miscanthus RhizosphereMRHQTQIVTFMTADNERLHGALLTPNEKPSELALIFVHGVAMNFYLPP
Ga0070669_10056375623300005353Switchgrass RhizosphereMSFHTRLCTFKTDDNERLHGLLFASQTQHTDLALLFVHGVAMNFYLP
Ga0070673_10131004023300005364Switchgrass RhizosphereMSFHTRLCTFKTDDNERLHGLLFASQTQHTDLALLFVHGVAMNFYLPPLSVFG
Ga0070710_1109196013300005437Corn, Switchgrass And Miscanthus RhizosphereMSIETQLCTFKTDDNERLHGLLFTPVEARSDLALLFVHGVAMNFYLP
Ga0070694_10039335523300005444Corn, Switchgrass And Miscanthus RhizosphereMTIETQLLDFTTSDNETLHGLLFSPREDKSDLALLLVHGVAMNFYLPPLPSFAQALAQQG
Ga0070678_10028543323300005456Miscanthus RhizosphereMSFHTRLCTFKTDDNERLHGLLFTPQDQQTDLALLFVHGVAMNFY
Ga0070662_10093307223300005457Corn RhizosphereMSFHTRLCTFKTDDNERLHGLLFTPQDQQTDLALLFVHGVAMNFYLPPLSVFG
Ga0070681_1002438113300005458Corn RhizosphereMDIDTQLCVFKTDDNERLHGLLLTPQNQPSDLALVFVHGVAMNFYLPPLVTFGQELAACGYHSFVI
Ga0070698_10065343023300005471Corn, Switchgrass And Miscanthus RhizosphereMNYQTQIYSFKTADNERLHGALLRPPNKESDMALIFVHGVA
Ga0070698_10098384423300005471Corn, Switchgrass And Miscanthus RhizosphereMTIETRLLNFKTSDKETLHGLLFTPRDRQSDLALLLVHGVAMNFYLPPL
Ga0070698_10111329213300005471Corn, Switchgrass And Miscanthus RhizosphereMNLHTEFFSFKTADNERLHGLLFTPPESQSDLALVFVHGVAMNFYLP
Ga0070704_10217674013300005549Corn, Switchgrass And Miscanthus RhizosphereMSIQTQLCTFKTADGERLHGLLFTPPNEPSDLALVFVHGVAMNFYL
Ga0066703_1004927413300005568SoilMKITTRLCNFKTSDNERLHGLLFTPIEVKSDLALLFVHGVAMNFYLPPLATLG
Ga0066706_1101701413300005598SoilMNLHTEFFSFKTADNERLHGLLFTPPESQSDLALVFVHGV
Ga0068859_10069340413300005617Switchgrass RhizosphereMNFQTEICTFKTADNERLHGALFTPPERPADLALLFVHGIAMNFYLPPLFPFGQDLASRG
Ga0068866_1082654413300005718Miscanthus RhizosphereMTLETQLLDFTTSDKETLHGLLFSPRERKSDLALLLVHGVAMNFYLPPLPSFAQALAQQGYHCFVINTR
Ga0068861_10124649323300005719Switchgrass RhizosphereMTLETQLLDFTTSDKETLHGLLFSPRERKSDLALLLVHGVAMNFYLPPLP
Ga0074472_1142683513300005833Sediment (Intertidal)MSIHTRLCSFKTADKERLHGLLFTPPDGESDLALIFVHGVAMNFY
Ga0075280_1008765513300005904Rice Paddy SoilMNLQTQLCTFKTADSERLHGLLFTPPQDQSDLALLFVHGVAMNFYLPPLVVFGEEL
Ga0081455_1042938513300005937Tabebuia Heterophylla RhizosphereMNIQTQLCTFKTADNERLHGLLFTPAGELSDLALVFVHGVAMNFYLPPLAIFGQ
Ga0075417_1052141423300006049Populus RhizosphereMNYRTQILTFTTADNERLHGALLTPPNKKSDTALIFVHGVAMNFYLPPLFN
Ga0068871_10170779423300006358Miscanthus RhizosphereMSIETQLLDFTTSDKETLHGLLFTPREKPSDLALLMVHGVAMNFYLP
Ga0075428_10050153623300006844Populus RhizosphereMSIQTQLCTFKTADNQRLHGLLFTPSGELSDLALVFVHGVAMNFYLPPLAIF
Ga0075421_10013424413300006845Populus RhizosphereMNFHTQIHSFKTADNERLHGALLIPPNKKSDTALIFVHG
Ga0075421_10094439333300006845Populus RhizosphereMNYQTQILTFTTADNERLHGALLTPPEKKSDTALIFVHGVAMNFYLPPLFTFGQALAARGFHSFVI
Ga0075421_10094572913300006845Populus RhizosphereMNYQTQIHSFKTADNERLHGALLTPRDKKSDTALIFVRGVAMTFLFAAAV*
Ga0075431_10223841723300006847Populus RhizosphereMNYLTHIYSFKTADNERLHGALLTPRDKKSDTALIFVHGVAMNFYLPPLFNFGQELTERGHHCFVINTR
Ga0075433_1005317113300006852Populus RhizosphereMNLHTEFFSFKTADNERLHGLLFTPPESQSDLALVFVH
Ga0075433_1010482013300006852Populus RhizosphereMSIQTQLCTFKTADNERLHGLFFTPPGELSDLALVFIHGVAMNFYLPPLAIFGQELAQR
Ga0075433_1081821513300006852Populus RhizosphereMSIQTQLCTFRTDDGERLHGLLFTPQNKKADLALVFVHGVAMNFYLPPFSVF
Ga0075433_1140470613300006852Populus RhizosphereMRFHTRLCTFKTQDNERLHGLLFTPQTQETDPALLFVHGVAM
Ga0075425_10041872733300006854Populus RhizosphereMKFQTEICTFRTSDNERLHGALLMPAKTPPDLALLFVHGVAMNFYLP
Ga0075429_10029098113300006880Populus RhizosphereMTTIHTQLLSFTTTDDETLHGLLFTPADELSDLALLFVHGVAMNFYLPPLA
Ga0075429_10058730813300006880Populus RhizosphereVTIETQLLSFKTSDNETLHGLLFTPRDRQSDLALLLVHGVAMNFYLPPLATFGPALAEQGYH
Ga0075429_10109755123300006880Populus RhizosphereMTIETQLLSFKTSDKETLHGLLFTPPERKSDLALLLVHGVAMNFYLPPLPTIGQALAERGYHCFVINT
Ga0079215_1007907813300006894Agricultural SoilMNFQTEICTFKTADNERLHGALFMPLERPSDLALLFVHGVAMNFYLPPLFTFGQDLAARGFHSFVI
Ga0075426_1038429623300006903Populus RhizosphereMRFHTRLCTFKTQDNERLHGLLFTPQTQETDPALLFVHGVAMNFY
Ga0075424_10202995723300006904Populus RhizosphereMNIDTQLCVFKTEDNERLHGLLFTPHNQPSDLALVFVHG
Ga0075436_10021127523300006914Populus RhizosphereMSIETQLCTFKTDDNERLHGLLFTPVEARSDLALLFVHGVAMNFYLPPLVVFGQELAQRG
Ga0075435_10025925423300007076Populus RhizosphereMSIQTQLCTFKTADNERLHGLFFTPPGELSDLALVFIHGVAMNFYLPPLAIFGQELAQRHYHCFVI
Ga0105095_1054856813300009053Freshwater SedimentMNFHTQIHAFKTADNERLHGALLTPPHGASDLGLIFVHGVAMNFYLPPLFNFGQALAHRGYHSFIINTR
Ga0102851_1225777423300009091Freshwater WetlandsMSIQTRLCAFRTADKERLHGLLFAPPDSESDLALIFVHGVAMNFYLPPLATFGQELAK
Ga0114129_1005263313300009147Populus RhizosphereMNYRTQILTFTTADNERLHGALLTPPNKKSDTALIFVHGVAMNFYLPPLFNFG
Ga0114129_1040933013300009147Populus RhizosphereMTIHTQLLSFKTADKETLHGLLFTAADKSSDLALLLVHGVAMNFYLPPLAVFGQAVA
Ga0114129_1100242623300009147Populus RhizosphereMNIETRLLSFKTSDRETLHGLLFTPRESKSDLALLLVHGVAMNFYLP
Ga0114129_1122130313300009147Populus RhizosphereVTIETQLLSFKTSDRETLHGLLFTPRDRQSDLALLLVHGVAMNFYLPPLPTFGQALAEQGYH
Ga0114129_1155000323300009147Populus RhizosphereMNYQTQIHSFKTADNERLHGALLTPPNKKSDTALIFVHGVAMNFYLPPLFNFGQE
Ga0113563_1288064123300009167Freshwater WetlandsMSIQTRLCTFKTADKERLHGLLFTPPDAESDLALIFVHGVAMNFYLPPL
Ga0105347_100858413300009609SoilMNYHTQIHTFKTVDNERLHGALLTPPHGASDLGLIFVHGVAMNFYLPP
Ga0105347_123980223300009609SoilMNYQTQIHSFKTAHNERLHGALLTPPNKKSDTALIFVHGVAMNFLFAAAV*
Ga0105340_101226363300009610SoilMGIHTQLCTFKTADNERLHGLLFTPPNEQSDLALVFIHGVAMNFYLPPLAIF
Ga0105340_143073623300009610SoilMNYQTQIHTFKTADNERLHGALLTPPHGASDLGLIF
Ga0105340_157771713300009610SoilMSNDGSTDILTQLCTFKTADKERLHGLLFTPPGELSDLALVFIHGVAMNFYLPPLAIFGQEL
Ga0105088_100241113300009810Groundwater SandMNIQTQLCTFKTTDNERLHGLLFTPPNEQSDLALLFVHGVAMNFYLPPLAIFGQELAQR
Ga0105076_110465923300009816Groundwater SandMNYQTQIITFKTADNERLHGALLTPPNKKSDTALIFVHGVAMNFYLPPLFNFGQELSQRGHH
Ga0105072_106270713300009818Groundwater SandMSIHTQLCSFKTADKETLHGLLFTPPNKSSDLALLMVHGVAMNFYMTPLARSGC*
Ga0105068_100169443300009836Groundwater SandMNIQTQLCTFKTADNERLHGLLFTPPGELSDLALVFIHGVAMNFYLPPL
Ga0126304_1096572113300010037Serpentine SoilVTTIHTQLLSFRTADQETLHGLLFTPADKSSDLALLLVHGVAMNFYLPPLAVFGQAVAQRGYHAFV
Ga0126380_1163842733300010043Tropical Forest SoilMNYRTEICAFKTADNERLHGALLTPNKKSDIALILVHGVAMNFYLPPLFTFGQELAARGHHSFVIN
Ga0126382_1042147613300010047Tropical Forest SoilMNIQTQLCTFKTADNERLHGLLFTAPRDDSDMALVFIHGVAM
Ga0126382_1101815523300010047Tropical Forest SoilFLDFAFMNYQTEICAFKTADNERLHGALLTPSDKSDVALILIHGVAMNFYLPPLFTFGQELAARG*
Ga0126377_1148353323300010362Tropical Forest SoilMKSAKPSMNIQTQLCTFKTADNERLHGLLFTAPSDDSDMALVFIHGVAMNFYLPPLAIFGQELTQLRY
Ga0126377_1297171213300010362Tropical Forest SoilMSIHTQLCAFKSADNERLHGLLFTSPQAPADLALIMVHGVAMNFYLPPLANFGQVLAERG
Ga0134123_1240916323300010403Terrestrial SoilMTIETQLLDFTTSDNETLHGLLFSPREGKSDLALLLVHGVAMNFYLPPLPTFAQALAQQG
Ga0105246_1077474513300011119Miscanthus RhizosphereMSFHTRLCTFKTDDSERLHGLLFTPQDQQTDLALLFVHGVAMNFYLPPLSVFGQELAARGFHSFVIN
Ga0137424_105810713300011412SoilMDTETQLLSFKTSDRETLHGLLFTPREQKSDLALLLVHGVAMNFYLPPLATFGQALAER
Ga0137314_114784323300011420SoilMNYQTQIHSFKTADNERLHGALLMPPEKKSDTALIFVHGVAMNLYLPPLFNF
Ga0137448_121059123300011427SoilMKYQTQIVTFKTSDNERLHGALLTPPHGASDLGLVFVHGVAMNFYLPPLFNFGQ
Ga0137430_105553313300012041SoilMKYQTQIVTFKTSDNERLQGALLSPPNKKSDTALIFVHGVAMNFYLPPLFNFGQELSERGHHSF
Ga0137349_104804013300012160SoilMGIHTQLCTFKTADNERLHGLLFTPPNEQSDLALVFIHGVAMNFYLPPLAIFGQELAKRRYHCFVINTRG
Ga0137388_1171009913300012189Vadose Zone SoilMSIHTQLCTFKTDDNERLHGLLFTPPNQQSDLALVFVHGVAMSFYLPPFSV
Ga0137363_1127291413300012202Vadose Zone SoilMSIETQLCTFKTDDNERLHGLLFTPVEARSDLALLFVHGVAMNFYLPPLVVFG
Ga0137362_1008990913300012205Vadose Zone SoilMSIETQLCTFKTDDNERLHGLLFTPVEARSDLALLFVHG
Ga0137435_111674413300012232SoilMNIATQLLSFKTSDKETLHGLLFTPREHASDLALLMVHGVAMNFY
Ga0157351_100391523300012501Unplanted SoilMNFQTEICSFRTSDNERLHGALLTPAKTPPDLALLFVHGVAMNFYLPPLFVFGQEL
Ga0157338_100784023300012515Arabidopsis RhizosphereMSFHTRLCTFKTDDNERLHGLLFTSQTQHTDLALLFVHGVAMNFYLPPLSVFGQ
Ga0137358_1041256923300012582Vadose Zone SoilMNIDTQLCVFKTEDNERLHGLLFTPHNQPSDLALVFVHGVAMNFYLPPLS
Ga0137394_1067231813300012922Vadose Zone SoilMNLHTEFFSFKTADNERLHGLLFTPPESQSDLALVF
Ga0137394_1133522113300012922Vadose Zone SoilMTIHTQLCTFKTADNERLHGLLFTPPDEQSDLALVFVHGVAMNFYLPPFSIFGQKLAERGHHC
Ga0137419_1029580813300012925Vadose Zone SoilMNLHTEFFSFKTADNERLHGLLFTPPESQSDLALVFVHG
Ga0126375_1073373213300012948Tropical Forest SoilMNIQTQLCTFKTADNERLHGLLFTPPSDDSDMALVFIHGVAMNF
Ga0164308_1013546013300012985SoilMSFHTRLCTFKTDDNERLHGLLFASQTQHTDLALLFVHGVAMNFYLPPLSVFGQELAARGFHSL
Ga0157378_1321085413300013297Miscanthus RhizosphereMTIETQLLDFTTSDNETLHGLLFSPREGKSDLALLLVHGVAMNFYLPPLPSFAQALAQQ
Ga0157375_1119446413300013308Miscanthus RhizosphereMNFQTEICTFKTADNERLHGALFTPPERPPDLALLFVHGVAMNFYLAPLFTF
Ga0157375_1198410023300013308Miscanthus RhizosphereMTIETQLLDFTTSDNETLHGLLFSPREGKSDLALLLVHGVAMNFYLPPLPTFAQALAQQGYHCFVIN
Ga0134081_1034667513300014150Grasslands SoilMTTNFHTKFCSFKTIDNERLHGLLFTPPESPADLALVFVHGVAMNFYL
Ga0075301_115816023300014262Natural And Restored WetlandsMKYQTQIVTFKTADNERLHGALLTPPNKKSDTALIF
Ga0157380_1113373813300014326Switchgrass RhizosphereMNFQTEICTFKTADNERLHGALFTPPERPPDLALLFVHGVAMNFYLAPLFT
Ga0157380_1277301713300014326Switchgrass RhizosphereMTLETQLLDFTTSDKETLHGLLFSPRERKSDLALLLVHGVAMNFYLPPLPSFAQAL
Ga0180087_104999723300014872SoilMKYQTQIVTFKTSDNERLHGALLSPPNKKSDTALIFVHGVAMNFYLPPLFNFGKELTEHG
Ga0180066_110178513300014873SoilMTIQTEICIFKTSDSERLHGALLTPPNKKADTALIFVHGVAMNFYLPPLPTVGQALAERGHHCFV
Ga0180083_110367213300014875SoilMNCQTEICTFKTSDNERLHGALLTPPQSPADLALVFVHGVAMNFYLPPLFLFGQELAARGYHCFVI
Ga0180094_111157813300014881SoilMNCQTEICTFRTSDNERLHGALLTPPQSPADLALVFVHGVAMNFYLPPLF
Ga0180094_116706013300014881SoilLNCQTEICTFRTSDNERLHGALLTPPQSPADLALVFVHGVAMNFYLPPLF
Ga0132255_10192878533300015374Arabidopsis RhizosphereMSIHTKLCTFKTADNERLHGLLFTPPGELSDLALVFIHGVAMNFYLPPLAIFGQELAQ
Ga0182036_1034331723300016270SoilMSFHTRLCTFKTDDNERLHGLLFTPPTQQPDLALLFVHGVAMNFYLPPLSTFGQELA
Ga0163161_1116249423300017792Switchgrass RhizosphereMNFQTEICTFKTADNERLHGALFTPPERPPDLALLFVHG
Ga0187786_1025735523300017944Tropical PeatlandMKLCTEICSFRTVDHERLHGALLTPPDRKSDLTLILVHGVAMNFYLPP
Ga0184605_1018461023300018027Groundwater SedimentMTIETQLLSFKTSDKETLHGLLFTPRDRQSDLALLLVHGVAMNFYLPPLPT
Ga0184638_112979813300018052Groundwater SedimentMTIETQLLSFKTSDKETLHGLLFTPRERKSDLALLLVHGVAMNFYLPPLPTI
Ga0184626_1016500723300018053Groundwater SedimentMTIHTQLVSFKTSDNERLHGLLFTPLDKKSELALIMVHGVAMNFYLPPLPTLGQSLA
Ga0184626_1018065913300018053Groundwater SedimentMNCQTEICTFRTSDNERLHGALLTPPQSPADLALVFVHGVAMNFYLPPLFL
Ga0184615_1044445123300018059Groundwater SedimentLNCQTEICTFRTSDNERLHGALLTPPQSPDELALVFVHGVAMNFYLPPLFLFGQE
Ga0184611_105992533300018067Groundwater SedimentMNFQTEICTFKTADNERLHGALFTPQERPADLALLFVHGVAMNFYLAPLFTFGQDL
Ga0184640_1002964433300018074Groundwater SedimentMTIRTQLLSFKTSDNERLHGALLTPPQSPDELALVFVHGVAMNFYLPPLFLFGQELAARG
Ga0184625_1065973213300018081Groundwater SedimentMSIDTKLCTFKTADNERLHGLLFTPPDELSDLALVFIHGVAMNFYLPPLA
Ga0184639_1061014423300018082Groundwater SedimentMSIDTQLCTFKTADNERLHGLLFTPPQSPADLALIMVHGVAMNFYLPPLATFGQALAE
Ga0184628_1048876613300018083Groundwater SedimentMLIETRLLNFKTSDRETLHGLLFTPRARQSDLALLLVHGVAMNFYLPPLATFGQAL
Ga0190265_1097807423300018422SoilMNFQTEICTFKTADNERLHGALFTPTERPSDLALLFVHGVAM
Ga0190275_1268137513300018432SoilMTIETRLLTFKTNDNETLHGLLFTPRERKSEVALLLVHGVAMNFYLPPLATFGQALAERGHH
Ga0190275_1353479713300018432SoilMSYQTQIHTFKTADNERLHGALLTPPDSGSDLALIFVHGVAMNFYLPPLFSFGQEL
Ga0190270_1007672613300018469SoilMAYQTQILIFKTADNERLNGALLTPPEKKSDIVLIFVHGVAMNFYLPPLFNFGQELSE
Ga0193715_101182113300019878SoilMSIETQLCTFKTDDNERLHGLLFTPVEARSDLALLFVHGVAMNFYLPPLVVFGQ
Ga0193717_101088353300020060SoilMNVQTQLCTFKTDDNERLHGLFFTPPEAPSDLAYCLCTAWR
Ga0210379_1034193113300021081Groundwater SedimentMKYQTQIVTFKTADNERLHGALLTPPNKESDTALIFVHGVAMNFY
Ga0126371_1359799113300021560Tropical Forest SoilMNIQTQLCTFKTADNERLHGLLFTPPSDDSDMALVFIHGVAMNFYLPPLAIFGQELTQLRYHCFVINTRGRD
Ga0222622_1014959723300022756Groundwater SedimentMTLETQLLDFTTSDKETLHGLLFSPRERKSDLALLLVHGVAMNFYLPPLPSFAQALAQQGYHCFVINTRG
Ga0209002_1026810213300025289SoilMSIQTRLCAFKTTDKERLHGLLFTPPDAESDLALIFVHGVAMNFYLPPLATLGQELTER
Ga0209641_1103138313300025322SoilMSIQTRLCAFRTADKERLHGLLFTPPDAESDLALVLVHGVAM
Ga0210143_107361513300025792Natural And Restored WetlandsMSYRTEICTFKTFDGERLHGALLTPPNSPSELALVFVHGV
Ga0207654_1110763413300025911Corn RhizosphereMSFHTRLCTFKTDDNERLHGLLFTPQDQQTDLALLFVHGVAMNFYLPPLSVFGQE
Ga0207707_1117221013300025912Corn RhizosphereMGIDTQFCVFKTDDNERLHGLLFTPQNQPSDLALVFVHGVAMNFYLPP
Ga0207669_1185577113300025937Miscanthus RhizosphereMNFQTEICSFKTSDNERLHGALLTPPQASDIALIFIHGVAMNFYLPPMFNLGQGLSER
Ga0256867_1017697213300026535SoilVKFQTEICTFRTADHERLHGALLTPPESPADLALVFVHGVAMNFYLPPLFVFGQEL
Ga0209376_141600913300026540SoilMSIDTQLCAFKTADNERLHGLLFTPPQSPSDLALIMVHGVAMNFYLPPLVIFGQELAQRGYHCFV
Ga0209842_109183813300027379Groundwater SandMSIHTQLCSFKTADKETLHGLLFTPPNKSSDLALLMVHGVAMNFYMTPLARSGC
Ga0209387_102506123300027639Agricultural SoilMNFQTEICTFKTADNERLHGALFMPLERPSDLALLFVHGVAMNFYLPPLFTFGQDLAARGFHSF
Ga0209819_1004635313300027722Freshwater SedimentMSIHTQLCTYKTADKERLHGLFFTPSGEHSDLPLVFVHGVAIEFLSAT
Ga0209819_1029345013300027722Freshwater SedimentMSIQTQLCTFKTADNQRLHGLLFTPSGELSDLALVFVHGVAMNFYLPPLALFGQELAQRRYHCFVIIPAVTTGLLAQAI
Ga0209726_1053025623300027815GroundwaterMNYQTQIHTFKTADNERLHGALLTPVDDKSDLALIFVHGVAMNFYLPPLFTFGQQLSA
Ga0209798_1019467513300027843Wetland SedimentMNYHTHIHTFKTADNERLHGALLTPPHGRSDLGLIFVHGVAMNF
Ga0209814_1044865513300027873Populus RhizosphereMNYRTQILTFTTADNERLHGALLTPPNKKSDTALIFVHGVAMNFYLPPLFNFGLE
Ga0207428_1093502513300027907Populus RhizosphereMRFHTRLCTFKTQDNERLHGLLFTPQTQETDPALLFVH
Ga0209382_1062744133300027909Populus RhizosphereMNYLTHIYSFKTADNERLHGALLTPRDKKSVTALVFVHGVAMNFYLPPLFNFGQELSERGHHCFVINTRS
Ga0209382_1174869523300027909Populus RhizosphereMIIDTRLLNFKTSDKETLHGLLFTQHDRQSDLALLLVHGVAMNFYLPPLATFGQALAERG
Ga0209382_1205520623300027909Populus RhizosphereMNYQTQIHSFKTADNERLHGALLTPRDKKSDTALIFVRGVAMTFLFAAAV
Ga0209705_1056707013300027979Freshwater SedimentMNYQTHIHTFKTADNERLHGALLTPPNGTSDLALIFVHGVAMNFYL
Ga0137415_1038662513300028536Vadose Zone SoilMSIETQLCTFKTDDNERLHGLLFTPVEARSDLALLFVHGVAMN
Ga0307312_1093193323300028828SoilMNLHTEFFSFKTADNERLHGLLFTPPESQSDLALVFVHGVAMNFYLPPLVV
Ga0307496_1013966113300031200SoilMNFQTEICTFKTADNERLHGALFTPPERPPDLALLFVHGVAMNFYLAPLFTFGQDFASR
Ga0310813_1044580123300031716SoilMDIDTQLCIFKTDDNERLHGLLFTPQNRPSDLALVFVHGVAMNFYLPPLV
Ga0307468_10118175913300031740Hardwood Forest SoilMSIQTQLCTFKTDDAERLHGLLFTPLNEQSDLALVF
Ga0307473_1013025013300031820Hardwood Forest SoilMSIHTRLCTFKTADAERLHGLLFTPLNEPSDLALVFVHGVAMNFYLPP
Ga0307473_1051965223300031820Hardwood Forest SoilMNFQTEICTFRTSDNERLHGALLTPAKTPPDLALL
Ga0306921_1066942423300031912SoilMSFHTRLCTFKTDDNERLHGLLFTPPTQQPDLALLFVHGVAMNFYLPPLSTFGQELAARG
Ga0214473_1172196813300031949SoilMNCQTEICTFRTSDNERLHGALLTPPQSPADLALVFVHGVAMNFYLPPLFLFGQDLAAR
Ga0307479_1079930433300031962Hardwood Forest SoilMSIQTQLCTFRTADGERLHGLLFTPQNKKADLALVFVHGVAMNFYLPPFSVFGQELAQRGHHCF
Ga0310902_1064789213300032012SoilMSFHTRLCTFKTDDNERLHGLLFASQTQHTDLALLFVHGVAMNFYLPPLSVFGQELAARG
Ga0310899_1046774323300032017SoilMNYKTQILTFTTADNERLHGALLTPNERPSDLALIFVH
Ga0307471_10396018613300032180Hardwood Forest SoilMSIDTKLCTFKTADNERLHGLLFTPPGELSDLALLFIHGVAMNFYLPPLAIFGQELAQRR
Ga0307472_10189531513300032205Hardwood Forest SoilMSIETQLCTFKTDDNERLHGLLFTPVEARSDLALLFVHGVAMNFYLPPLV
Ga0310896_1087803813300032211SoilMNYQTQILTFTTADNERLHGALLTPNENPSDLVLIFVHGVAMNFYL
Ga0310812_1024188123300032421SoilMSFHTRLCTFKTDDNERLHGLLFASQTQHTDLALLFVHGVAMNF
Ga0316624_1055794913300033486SoilMNTQLCTFKTADNERLHGLLFAPEETHRDLALLFVHGVAMNFYLPPLSVFGQELTQR
Ga0364945_0258699_361_5373300034115SedimentMKLQAEICTFKTADNERLHGALFTPPERPPDLALLFVHGVAMNFYLAPLFTFGQDLASR
Ga0364933_038583_1_2013300034150SedimentMGIHTQLCTFKTADNERLHGLLFTPPSEQSDLALLFVHGVAMNFYLPPLAIFGQELAKRRYHCFVIN
Ga0364934_0416813_3_1883300034178SedimentMNYQTQIHSFKTTDNERLHGALLTPIEQKSELALIFVHGVAMNFYLPPLFNFGQELSQRGHH
Ga0364943_0234374_506_6823300034354SedimentMNFQTEICTFKTADNERLHGALFTPPERPPDLALLFVHGVAMNFYLAPLFTFGQDLASR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.