| Basic Information | |
|---|---|
| Family ID | F035099 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 173 |
| Average Sequence Length | 39 residues |
| Representative Sequence | ALGALTAYLMESGRGHELNLPKGAKLELELERALYLVKE |
| Number of Associated Samples | 151 |
| Number of Associated Scaffolds | 173 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.33 % |
| % of genes near scaffold ends (potentially truncated) | 96.53 % |
| % of genes from short scaffolds (< 2000 bps) | 86.13 % |
| Associated GOLD sequencing projects | 142 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.173 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.387 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.855 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.023 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.84% β-sheet: 0.00% Coil/Unstructured: 67.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 173 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 26.01 |
| PF00158 | Sigma54_activat | 11.56 |
| PF02954 | HTH_8 | 4.05 |
| PF13426 | PAS_9 | 3.47 |
| PF00480 | ROK | 2.89 |
| PF00753 | Lactamase_B | 2.89 |
| PF10996 | Beta-Casp | 2.31 |
| PF08837 | DUF1810 | 1.73 |
| PF01850 | PIN | 1.16 |
| PF01266 | DAO | 1.16 |
| PF00441 | Acyl-CoA_dh_1 | 1.16 |
| PF00581 | Rhodanese | 1.16 |
| PF00459 | Inositol_P | 0.58 |
| PF10417 | 1-cysPrx_C | 0.58 |
| PF07883 | Cupin_2 | 0.58 |
| PF00069 | Pkinase | 0.58 |
| PF07297 | DPM2 | 0.58 |
| PF13520 | AA_permease_2 | 0.58 |
| PF13650 | Asp_protease_2 | 0.58 |
| PF08448 | PAS_4 | 0.58 |
| PF13714 | PEP_mutase | 0.58 |
| PF05163 | DinB | 0.58 |
| PF02371 | Transposase_20 | 0.58 |
| PF01966 | HD | 0.58 |
| PF01156 | IU_nuc_hydro | 0.58 |
| PF00989 | PAS | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 173 Family Scaffolds |
|---|---|---|---|
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 5.78 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.31 |
| COG5579 | Uncharacterized conserved protein, DUF1810 family | Function unknown [S] | 1.73 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 1.16 |
| COG1957 | Inosine-uridine nucleoside N-ribohydrolase | Nucleotide transport and metabolism [F] | 0.58 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.58 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.75 % |
| Unclassified | root | N/A | 9.25 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908007|FWIRElOz_GKZ9IRQ02GAE5I | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 512 | Open in IMG/M |
| 2170459022|GZEQPF102HCLIU | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300001593|JGI12635J15846_10283657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1045 | Open in IMG/M |
| 3300001686|C688J18823_10343532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 973 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100294515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1507 | Open in IMG/M |
| 3300002558|JGI25385J37094_10157506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300004082|Ga0062384_100032084 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2383 | Open in IMG/M |
| 3300004152|Ga0062386_100817617 | Not Available | 768 | Open in IMG/M |
| 3300004156|Ga0062589_100892246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300004479|Ga0062595_100284715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1101 | Open in IMG/M |
| 3300004635|Ga0062388_101621619 | Not Available | 658 | Open in IMG/M |
| 3300005445|Ga0070708_100052576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3613 | Open in IMG/M |
| 3300005533|Ga0070734_10505332 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300005541|Ga0070733_10570127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
| 3300005561|Ga0066699_10475202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 894 | Open in IMG/M |
| 3300005713|Ga0066905_101384206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300005764|Ga0066903_103186138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
| 3300005842|Ga0068858_101424325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_60_7 | 683 | Open in IMG/M |
| 3300006047|Ga0075024_100470157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300006163|Ga0070715_10388670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300006176|Ga0070765_101196929 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300007076|Ga0075435_101873890 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300007265|Ga0099794_10033406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2419 | Open in IMG/M |
| 3300009038|Ga0099829_11383529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300009089|Ga0099828_10406872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1227 | Open in IMG/M |
| 3300009089|Ga0099828_10552978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1037 | Open in IMG/M |
| 3300009089|Ga0099828_11925991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_60_7 | 518 | Open in IMG/M |
| 3300009090|Ga0099827_11820070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300009174|Ga0105241_12203247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300009523|Ga0116221_1330316 | Not Available | 661 | Open in IMG/M |
| 3300009645|Ga0116106_1063389 | Not Available | 1220 | Open in IMG/M |
| 3300009759|Ga0116101_1188995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300010043|Ga0126380_10041113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2426 | Open in IMG/M |
| 3300010358|Ga0126370_11694957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300010358|Ga0126370_12566929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300010359|Ga0126376_11415085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300010360|Ga0126372_10854218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
| 3300010360|Ga0126372_10941568 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300010361|Ga0126378_11342519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
| 3300010366|Ga0126379_10615782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1173 | Open in IMG/M |
| 3300010366|Ga0126379_11198363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 866 | Open in IMG/M |
| 3300010376|Ga0126381_102631155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300010396|Ga0134126_11858882 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300010398|Ga0126383_11428612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300011270|Ga0137391_11453227 | Not Available | 531 | Open in IMG/M |
| 3300011271|Ga0137393_10431205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1130 | Open in IMG/M |
| 3300012096|Ga0137389_11243820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300012096|Ga0137389_11717251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300012189|Ga0137388_10763554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 897 | Open in IMG/M |
| 3300012189|Ga0137388_11800335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300012199|Ga0137383_11189732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300012205|Ga0137362_10190804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1762 | Open in IMG/M |
| 3300012205|Ga0137362_11523609 | Not Available | 555 | Open in IMG/M |
| 3300012207|Ga0137381_11405747 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300012361|Ga0137360_10819276 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300012361|Ga0137360_11623158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300012362|Ga0137361_11747616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300012363|Ga0137390_11898298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300012388|Ga0134031_1021458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300012685|Ga0137397_10024277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4289 | Open in IMG/M |
| 3300012685|Ga0137397_11061026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300012922|Ga0137394_10265115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1469 | Open in IMG/M |
| 3300012923|Ga0137359_10897879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
| 3300012923|Ga0137359_11101811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| 3300012925|Ga0137419_10903634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300012927|Ga0137416_11592545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300012929|Ga0137404_11253794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300012930|Ga0137407_10901311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
| 3300012961|Ga0164302_11085286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300012971|Ga0126369_10327450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1545 | Open in IMG/M |
| 3300014151|Ga0181539_1105522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1179 | Open in IMG/M |
| 3300014199|Ga0181535_10728669 | Not Available | 563 | Open in IMG/M |
| 3300015052|Ga0137411_1233914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3644 | Open in IMG/M |
| 3300015241|Ga0137418_10288816 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
| 3300015371|Ga0132258_11134863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1976 | Open in IMG/M |
| 3300015374|Ga0132255_100097113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3988 | Open in IMG/M |
| 3300016270|Ga0182036_11077971 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300016294|Ga0182041_10268061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1399 | Open in IMG/M |
| 3300016387|Ga0182040_11715988 | Not Available | 536 | Open in IMG/M |
| 3300017823|Ga0187818_10199830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 872 | Open in IMG/M |
| 3300017935|Ga0187848_10406103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300017959|Ga0187779_10767291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300017961|Ga0187778_10013164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5118 | Open in IMG/M |
| 3300017973|Ga0187780_10006860 | All Organisms → cellular organisms → Bacteria | 8465 | Open in IMG/M |
| 3300017974|Ga0187777_11344923 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300017975|Ga0187782_10208986 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300017975|Ga0187782_11403657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300018012|Ga0187810_10120674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1040 | Open in IMG/M |
| 3300018060|Ga0187765_10788703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300018062|Ga0187784_10808993 | Not Available | 748 | Open in IMG/M |
| 3300020199|Ga0179592_10476874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300020579|Ga0210407_10033858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3801 | Open in IMG/M |
| 3300020579|Ga0210407_10083215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2414 | Open in IMG/M |
| 3300020580|Ga0210403_10358830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1192 | Open in IMG/M |
| 3300020580|Ga0210403_10542035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella rosea | 943 | Open in IMG/M |
| 3300020581|Ga0210399_10331788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1270 | Open in IMG/M |
| 3300020582|Ga0210395_10946030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300021178|Ga0210408_10201773 | All Organisms → cellular organisms → Bacteria | 1582 | Open in IMG/M |
| 3300021401|Ga0210393_10002876 | All Organisms → cellular organisms → Bacteria | 14031 | Open in IMG/M |
| 3300021402|Ga0210385_11112763 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300021402|Ga0210385_11463140 | Not Available | 522 | Open in IMG/M |
| 3300021404|Ga0210389_10259629 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300021405|Ga0210387_10052762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3278 | Open in IMG/M |
| 3300021407|Ga0210383_10355315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1263 | Open in IMG/M |
| 3300021432|Ga0210384_10602831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 986 | Open in IMG/M |
| 3300021444|Ga0213878_10248961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300021474|Ga0210390_10438240 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300021474|Ga0210390_11499482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300021476|Ga0187846_10153428 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300021559|Ga0210409_10387155 | Not Available | 1253 | Open in IMG/M |
| 3300022840|Ga0224549_1020064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis | 925 | Open in IMG/M |
| 3300024347|Ga0179591_1053758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2642 | Open in IMG/M |
| 3300025910|Ga0207684_10391806 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300025928|Ga0207700_11804320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300025939|Ga0207665_10601572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 858 | Open in IMG/M |
| 3300025961|Ga0207712_10639687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 923 | Open in IMG/M |
| 3300025961|Ga0207712_11332175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300026297|Ga0209237_1235636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300026304|Ga0209240_1167028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300026309|Ga0209055_1273474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300026319|Ga0209647_1241134 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300026322|Ga0209687_1059507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1240 | Open in IMG/M |
| 3300026335|Ga0209804_1011934 | All Organisms → cellular organisms → Bacteria | 4684 | Open in IMG/M |
| 3300026356|Ga0257150_1073513 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300026361|Ga0257176_1091278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300026537|Ga0209157_1114679 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300026557|Ga0179587_10505574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 793 | Open in IMG/M |
| 3300027024|Ga0207819_1013105 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300027047|Ga0208730_1010543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 988 | Open in IMG/M |
| 3300027049|Ga0207806_1043235 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300027313|Ga0207780_1062906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300027562|Ga0209735_1085182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300027643|Ga0209076_1085136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 899 | Open in IMG/M |
| 3300027651|Ga0209217_1050342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1258 | Open in IMG/M |
| 3300027651|Ga0209217_1052034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1232 | Open in IMG/M |
| 3300027737|Ga0209038_10213787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300027787|Ga0209074_10174159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 791 | Open in IMG/M |
| 3300027787|Ga0209074_10270082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
| 3300027795|Ga0209139_10256284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 618 | Open in IMG/M |
| 3300027875|Ga0209283_10051985 | All Organisms → cellular organisms → Bacteria | 2612 | Open in IMG/M |
| 3300027884|Ga0209275_10006683 | All Organisms → cellular organisms → Bacteria | 4832 | Open in IMG/M |
| 3300027911|Ga0209698_11115966 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300028047|Ga0209526_10390121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 926 | Open in IMG/M |
| 3300028536|Ga0137415_10077300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3187 | Open in IMG/M |
| 3300028759|Ga0302224_10028957 | All Organisms → cellular organisms → Bacteria | 2042 | Open in IMG/M |
| 3300028906|Ga0308309_11018271 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300030399|Ga0311353_10938294 | Not Available | 729 | Open in IMG/M |
| 3300031057|Ga0170834_107828319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300031057|Ga0170834_110308553 | Not Available | 811 | Open in IMG/M |
| 3300031231|Ga0170824_125863549 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → Pezizomycetes → Pezizales → Pyronemataceae → Wilcoxina → Wilcoxina mikolae | 1295 | Open in IMG/M |
| 3300031234|Ga0302325_10208560 | All Organisms → cellular organisms → Bacteria | 3346 | Open in IMG/M |
| 3300031236|Ga0302324_101486740 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 881 | Open in IMG/M |
| 3300031446|Ga0170820_12041354 | Not Available | 724 | Open in IMG/M |
| 3300031545|Ga0318541_10257723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
| 3300031682|Ga0318560_10771987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300031720|Ga0307469_10269799 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
| 3300031720|Ga0307469_10437286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1128 | Open in IMG/M |
| 3300031753|Ga0307477_10913681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300031754|Ga0307475_10782655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300031754|Ga0307475_10904950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300031795|Ga0318557_10471666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300031820|Ga0307473_10473061 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300031821|Ga0318567_10599756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300031890|Ga0306925_10171456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 2338 | Open in IMG/M |
| 3300031962|Ga0307479_10006932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10431 | Open in IMG/M |
| 3300032010|Ga0318569_10399441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300032067|Ga0318524_10614060 | Not Available | 573 | Open in IMG/M |
| 3300032261|Ga0306920_100797187 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
| 3300032893|Ga0335069_10379797 | All Organisms → cellular organisms → Bacteria | 1662 | Open in IMG/M |
| 3300032897|Ga0335071_10016965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7385 | Open in IMG/M |
| 3300033158|Ga0335077_10273010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1863 | Open in IMG/M |
| 3300033977|Ga0314861_0105291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1434 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.94% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.62% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.05% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.47% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.31% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.31% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.31% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.73% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.73% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.16% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.16% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.16% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.16% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.16% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.16% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.16% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.16% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.58% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.58% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.58% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.58% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.58% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.58% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.58% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.58% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908007 | Soil microbial communities from sample at FACE Site Metagenome WIR_ElevOz2 | Environmental | Open in IMG/M |
| 2170459022 | Grass soil microbial communities from Rothamsted Park, UK - FA2 (control condition) | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012388 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027024 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes) | Environmental | Open in IMG/M |
| 3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
| 3300027049 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 72 (SPAdes) | Environmental | Open in IMG/M |
| 3300027313 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FWIRElOz_09485900 | 2124908007 | Soil | EGAAAGAIAAYLMESGRGHELDLPKGAKLELELERALYLVKE |
| FA2_07015530 | 2170459022 | Grass Soil | LEAYLMEAGRGQEIELPKGVKLELELERTLYLVRE |
| JGI12635J15846_102836572 | 3300001593 | Forest Soil | EGAAAAAIAAYLIESGRGHEIDLPKGAKLELELERALYLLKE* |
| C688J18823_103435323 | 3300001686 | Soil | AIAAYLMESGRGHELDLPKGAKLELELERALYLVK* |
| JGIcombinedJ26739_1002945152 | 3300002245 | Forest Soil | IAAYLMESGRGHEIDLPKGAKLELELERSLYLLKE* |
| JGI25385J37094_101575062 | 3300002558 | Grasslands Soil | TAEGAALGALTAYLMESGRGHELNLPKGAKLELELERALYLVKE* |
| Ga0062384_1000320844 | 3300004082 | Bog Forest Soil | EAAAMAAFAAYLAESGRGHEISFQHGVKFELELERALYLLKE* |
| Ga0062386_1008176171 | 3300004152 | Bog Forest Soil | ALCALEAYLAEAGRGQELDMPKGAKLELELGRALYLVKE* |
| Ga0062589_1008922461 | 3300004156 | Soil | AVAALEAYLMESGRGHEMNLPKGSKLELELERALYLVKE* |
| Ga0062595_1002847151 | 3300004479 | Soil | AAVAALEAYLMEAGRGHEMNLPKGAKLELELERALYLVRE* |
| Ga0062388_1016216192 | 3300004635 | Bog Forest Soil | AMAAFAAYLAESGRGHELNFERGVKFELELARALYLLKE* |
| Ga0070708_1000525761 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GAAEAALAAYLMEAGRGHELQLVKGSKLEIELDRALYLLRE* |
| Ga0070734_105053322 | 3300005533 | Surface Soil | AEGAMAAAIAAYLVESGRGHEVDLPRGAKLEVELERALYLVRN* |
| Ga0070733_105701272 | 3300005541 | Surface Soil | MAALTAYLIESGRGHELELPKGVKLELELERALYLVKE* |
| Ga0066699_104752021 | 3300005561 | Soil | VTRAAESALAAYLMESGRGHEIVLPKGAKLELELERALYLVKE* |
| Ga0066905_1013842062 | 3300005713 | Tropical Forest Soil | AVGALEAYLMESGRGHEMNLPKGSKLELELERALYLVKE* |
| Ga0066903_1031861381 | 3300005764 | Tropical Forest Soil | LEAYLMESGRGHEMNLPKGAKLELELERALYLVKD* |
| Ga0068858_1014243251 | 3300005842 | Switchgrass Rhizosphere | EAAEYAAVAALEAYLMESGRGHEMNLPKGSKLELELERALYLVKE* |
| Ga0075024_1004701572 | 3300006047 | Watersheds | GAAMGALEAYLMEAGRGQELNLPKGAKLELELERALYLVRE* |
| Ga0070715_103886702 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | EGAALGALAAYLVEAGRGQEIELPKGSKLELELERALYLVRE* |
| Ga0070765_1011969293 | 3300006176 | Soil | EVAEGAMAAAIAAYLVESGRGHEVDLPRGAKLEVELERALYLVRD* |
| Ga0075435_1018738901 | 3300007076 | Populus Rhizosphere | EYAAVAALEAYLMEAGRGHEMNLPKGSKLELELERNLYLVKE* |
| Ga0099794_100334064 | 3300007265 | Vadose Zone Soil | GALTAYLMESGRGHELNLPKGAKLELELERALYLVKE* |
| Ga0099829_113835291 | 3300009038 | Vadose Zone Soil | GAALGALTAYLMESGRGHELNLPKGAKLELELERALYLVKE* |
| Ga0099828_104068721 | 3300009089 | Vadose Zone Soil | ALTAYLMESGRGHELNLPKGAKLELELERALYLVKE* |
| Ga0099828_105529783 | 3300009089 | Vadose Zone Soil | LGALTAYLMESGRGHELNLPKGAKLELELERALYLVKE* |
| Ga0099828_119259912 | 3300009089 | Vadose Zone Soil | EGAALGALTAYLMESGRGHELNLPKGAKLELELERALYLVKE* |
| Ga0099827_118200702 | 3300009090 | Vadose Zone Soil | LGAITAYLMESGRGHELNLPKGAKLELELERALYLVKE* |
| Ga0105241_122032471 | 3300009174 | Corn Rhizosphere | VAALEAYLMEAGRGHEMNLPKGAKLELELERALYLVRE* |
| Ga0116221_13303161 | 3300009523 | Peatlands Soil | EAYLMEAGRGQELDLAKGAKLELELGRALYLVKE* |
| Ga0116106_10633891 | 3300009645 | Peatland | LGALEAYLMEAGRGQELDLAKGAKLELELGRALYLVKE* |
| Ga0116101_11889952 | 3300009759 | Peatland | EGAAMGALTAYLAEIGRGQEMNLPKGTKLELELERALYLVKE* |
| Ga0126380_100411131 | 3300010043 | Tropical Forest Soil | TKAAEAALAAYLMESGRGHEIVLPKGSKLELELERALYLVKE* |
| Ga0126370_116949571 | 3300010358 | Tropical Forest Soil | ITAYLMESGRGHELNLPKGAKLELELERALYLVKE* |
| Ga0126370_125669292 | 3300010358 | Tropical Forest Soil | TKAAESALAAYLMESGRGHEIILPKGAKLELELERALYLVKE* |
| Ga0126376_114150851 | 3300010359 | Tropical Forest Soil | AALGALTAYLMESGRGHELNLPKGAKLELELERALYLLKE* |
| Ga0126372_108542182 | 3300010360 | Tropical Forest Soil | EAYLMEAGRGHELQLPRGAKLELELERALYLVKP* |
| Ga0126372_109415682 | 3300010360 | Tropical Forest Soil | EAAAIAALEAYLMEAGRGEELDLPKGTKLELELGRALYLVKE* |
| Ga0126378_113425192 | 3300010361 | Tropical Forest Soil | AALGAITAYLMESGRGHELNLPKGAKLELELERALYLVKD* |
| Ga0126379_106157822 | 3300010366 | Tropical Forest Soil | GAALAALEAYLTEAGRGQEIELARGTKLELELERSLYLIRE* |
| Ga0126379_111983631 | 3300010366 | Tropical Forest Soil | AAVAALEAYLMESGRGHEMNLPKGAKLELELERALYLVKD* |
| Ga0126381_1026311551 | 3300010376 | Tropical Forest Soil | AIAAYLMESGRGHELDLPKGAKLELELERALYLVKE* |
| Ga0134126_118588821 | 3300010396 | Terrestrial Soil | GAMAAAIAAYLVESGRGHEVDLPRGAKLEVELERALYLVRN* |
| Ga0126383_114286121 | 3300010398 | Tropical Forest Soil | ALEAYLMESGRGQEIDLPHGAKLELELERALYLVKD* |
| Ga0137391_114532271 | 3300011270 | Vadose Zone Soil | EAAEGAAEAALAAYLMEAGRGHELELVKGSKLEIELERALYLLRE* |
| Ga0137393_104312051 | 3300011271 | Vadose Zone Soil | LGALTAYLMESGRGQELNLPKGAKLELELERALYLVKE* |
| Ga0137389_112438201 | 3300012096 | Vadose Zone Soil | GAAVGAIAAYLMESGRGHEIDLPKGAKLELELERALYLLKE* |
| Ga0137389_117172512 | 3300012096 | Vadose Zone Soil | AAYLMESGRGHEIDLPKGAKLELELERALYLLKE* |
| Ga0137388_107635542 | 3300012189 | Vadose Zone Soil | EGAAVGASAAYLMESGRGHEIDLPKGAKLELELERSLYLLKE* |
| Ga0137388_118003352 | 3300012189 | Vadose Zone Soil | GAITAYLMESGRGHELNLPKGAKLELELERALYLVKE* |
| Ga0137383_111897321 | 3300012199 | Vadose Zone Soil | IGAITAYLMESGRGHELNLPKGAKLELELERSLYLVKE* |
| Ga0137362_101908042 | 3300012205 | Vadose Zone Soil | AALGAITAYLMESGRGHELNLPKGAKLELELERALYLVKE* |
| Ga0137362_115236092 | 3300012205 | Vadose Zone Soil | AAEAALAAYLMEAGRGHELELVKGSKLEIELERALYLLRE* |
| Ga0137381_114057471 | 3300012207 | Vadose Zone Soil | GAAEAALAAYLMEAGRGHELQLPKGAKLEIELERALYLVKE* |
| Ga0137360_108192762 | 3300012361 | Vadose Zone Soil | AAYLMEAGRGHELELVKGSKLEIELDRALYLLRE* |
| Ga0137360_116231582 | 3300012361 | Vadose Zone Soil | YLMESGRGHELNLPKGAKLELELERALYLVKEKVCDGYS* |
| Ga0137361_117476162 | 3300012362 | Vadose Zone Soil | AAAAALAAYLMESGRGHEIDLPKGAKLELELERALYLLKE* |
| Ga0137390_118982982 | 3300012363 | Vadose Zone Soil | AITAYLMESGRGHELNLPKGAKLELELERALYLVKE* |
| Ga0134031_10214582 | 3300012388 | Grasslands Soil | AEGAALGALTAYLMEVGRGHELNLPKGAKLELELERALYLVKE* |
| Ga0137397_100242771 | 3300012685 | Vadose Zone Soil | SAALGALTAYLMESGRGHELNLPKGAKLELELERALYLVKE* |
| Ga0137397_110610261 | 3300012685 | Vadose Zone Soil | LAAYLMESGRGHEIDLPKGAKLELELERALYLLKE* |
| Ga0137394_102651151 | 3300012922 | Vadose Zone Soil | RAAESALAAYLLETGRGHEIVLPKGAKLELELERALYLVKE* |
| Ga0137359_108978792 | 3300012923 | Vadose Zone Soil | EAALAAYLMEAGRGHESQLAKGSKLEIELERALYLLKE* |
| Ga0137359_111018112 | 3300012923 | Vadose Zone Soil | AEGAAVGAIAAYLMESGRGHEIDLPKGAKLELELERALYLLKE* |
| Ga0137419_109036341 | 3300012925 | Vadose Zone Soil | GALAGAIAAYLMESGRGHELNLLKGAKLELELERALYLVKE* |
| Ga0137416_115925451 | 3300012927 | Vadose Zone Soil | LTAYLMESGRGRELNLPKGAKLELELERALYLVKE* |
| Ga0137404_112537943 | 3300012929 | Vadose Zone Soil | AEAALAAYLMEAGRGHELQLPKGSKLEIELERALYLVKE* |
| Ga0137407_109013111 | 3300012930 | Vadose Zone Soil | GAALGALEAYLMDAGRGQEIDLPKGAKLELELERALYLTRE* |
| Ga0164302_110852863 | 3300012961 | Soil | IAAYLMESGRGHELDLPKGAKLELELERALYLLKE* |
| Ga0126369_103274501 | 3300012971 | Tropical Forest Soil | EAALAAYLMETGRGHEIDLPKGAKLELELERALYLVRD* |
| Ga0181539_11055224 | 3300014151 | Bog | EAYLAEAGRGQELDLPKGAKLELELGRALYLVKE* |
| Ga0181535_107286691 | 3300014199 | Bog | AALGALEAYLAEAGRGQELDLPKGSKVELELGRALYLVKE* |
| Ga0137411_12339141 | 3300015052 | Vadose Zone Soil | AVTRAAEAALAAYLTESGRGHEIVLPKGAKLELELERALYLVKE* |
| Ga0137418_102888162 | 3300015241 | Vadose Zone Soil | GAAEAALAAYLMEAGRGHELELVRGSKLEIELERTLYLLRE* |
| Ga0132258_111348633 | 3300015371 | Arabidopsis Rhizosphere | AAYLMETGRGHELDLPKGAKLELELERALYLVKE* |
| Ga0132255_1000971131 | 3300015374 | Arabidopsis Rhizosphere | ALEAYLMEAGRGHEMNLPKGAKLELELERALYLVRE* |
| Ga0182036_110779712 | 3300016270 | Soil | GAALGALQAYLTEAGRGQELDLPKGAKLELELERALYLVRE |
| Ga0182041_102680612 | 3300016294 | Soil | LGALEAYLLETGRGQELDLPKGAKLELELERTLYLVKP |
| Ga0182040_117159881 | 3300016387 | Soil | AAEGAAMGALEAYLMEAGRGQELELPKGAKLELELERALYLVKE |
| Ga0187818_101998301 | 3300017823 | Freshwater Sediment | EGAALAALTAYLAESGRGHELNLPKGAKLELELERALYLVKE |
| Ga0187848_104061031 | 3300017935 | Peatland | ALCALEAYLAEAGRGQELNLPKGAKLELELGRALYLVKE |
| Ga0187779_107672912 | 3300017959 | Tropical Peatland | LEAYLREAGRGEELNLPRGAKLELELERALYLVKE |
| Ga0187778_100131641 | 3300017961 | Tropical Peatland | IGALEAYLMEAGRGQELDLPKGAKMELELERALYLVKD |
| Ga0187780_100068601 | 3300017973 | Tropical Peatland | AAALGALTAYLMESGRGHELNLPKGAKLELELERALYLVKE |
| Ga0187777_113449231 | 3300017974 | Tropical Peatland | EGAALGALTAYLMESGRGHELNLPKGAKLELELERALYLVKE |
| Ga0187782_102089862 | 3300017975 | Tropical Peatland | ALEAYLMEAGRGEVLDLPKGAKLELELERALYLVKD |
| Ga0187782_114036571 | 3300017975 | Tropical Peatland | IAAYLMESGRGHELDLPKGAKLELELERALYLVKE |
| Ga0187810_101206741 | 3300018012 | Freshwater Sediment | AEGAAMGALEAYLMEEGRGQELNLPKGAKVELELERALYLVRE |
| Ga0187765_107887031 | 3300018060 | Tropical Peatland | AALEAYLMEAGRGQEIELERGTKLELELERSLYLVKE |
| Ga0187784_108089931 | 3300018062 | Tropical Peatland | AQGAAIGALEAYLTEAGRGQELDLPKGAKLELELERALYLVKD |
| Ga0179592_104768742 | 3300020199 | Vadose Zone Soil | GAALGALTAYLMESGRGHELNLPKGAKLELELERALYLVKE |
| Ga0210407_100338581 | 3300020579 | Soil | EGALAGAIAAYLMESGRGHELDLPKGTKLELELERALYLVRE |
| Ga0210407_100832151 | 3300020579 | Soil | LGALTAYLVESGRGHELDLPKGVKLELELERALYLVKE |
| Ga0210403_103588302 | 3300020580 | Soil | ITAYLVESGRGRELELPKGVKLELELERALFLVKE |
| Ga0210403_105420351 | 3300020580 | Soil | AGAAAAAIAAYLMESGRGHEIDLPKGAKMELELERALYLLKE |
| Ga0210399_103317881 | 3300020581 | Soil | AAAGAIAAYLMESGRGHELDLPKGAKLELELERALYLIKD |
| Ga0210395_109460301 | 3300020582 | Soil | AITAYLLESGRGRELELPKGVKLELELERALYLVKE |
| Ga0210408_102017732 | 3300021178 | Soil | EVAEGAMAAAIAAYLVESGRGHEVDLPRGAKLEVELERALYLVRN |
| Ga0210393_1000287613 | 3300021401 | Soil | EGAMAAAIAAYLVESGRGHEVDLPRGAKLEVELERALYLVRD |
| Ga0210385_111127631 | 3300021402 | Soil | GAMAAAIAAYLVESGRGHEVDLPRGAKLEVELERALYLVKD |
| Ga0210385_114631401 | 3300021402 | Soil | EVAEGAMAAASAAYLVESGRGHEVDLPRGAKLEVELERALYLVRD |
| Ga0210389_102596292 | 3300021404 | Soil | AAIAAYLAESGRGHEVDLPRGAKLEVELERALYLVRD |
| Ga0210387_100527621 | 3300021405 | Soil | IGALTAYLVESGRGHELDLQKGAKLELELERALYLVKE |
| Ga0210383_103553151 | 3300021407 | Soil | LEAYLMEAGRGQELELPKGAKLELELERALYLVKE |
| Ga0210384_106028311 | 3300021432 | Soil | AALGALEAYLMDAGRGQEIDLPKGAKLELELERALYLTRE |
| Ga0213878_102489612 | 3300021444 | Bulk Soil | ALGALEAYLAEAGRGQEIELGKGTKLELELERALYLLRE |
| Ga0210390_104382401 | 3300021474 | Soil | EAAEEAAMGALEAYLMEAGRGQELDLPKGAKLELELERALYLVRE |
| Ga0210390_114994821 | 3300021474 | Soil | AALGALEAYLVEAGRGQEIDLPKGAKLELELERALYLVRE |
| Ga0187846_101534282 | 3300021476 | Biofilm | ALGALTAYLMESGRGHELNLPKGAKLELELERTLYLVRE |
| Ga0210409_103871552 | 3300021559 | Soil | ALGALEAYLMEAGRGQEIELPKGAKLELELERALYLVKE |
| Ga0224549_10200641 | 3300022840 | Soil | AMASFAAYLAESGRGQEINLQHGIKFELELERALYLLKE |
| Ga0179591_10537582 | 3300024347 | Vadose Zone Soil | MGALTAYLVESGRGHELNLPKGAKLELELERALYLLKE |
| Ga0207684_103918063 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | AAEAALAAYLMEAGRGHELQLPKGSKLEIELERALYLVKE |
| Ga0207700_118043201 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | AAEYAAVAALEAYLMEAGRGHELNLPKGSKLELELVRALYLVRE |
| Ga0207665_106015723 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | AALAAYLMESGRGHEIDLPKGAKLELELERALYLLKE |
| Ga0207712_106396873 | 3300025961 | Switchgrass Rhizosphere | EAAEYAAVAALEAYLMESGRGHEMNLPKGSKLELELERALYLVKE |
| Ga0207712_113321751 | 3300025961 | Switchgrass Rhizosphere | AALEAYLMEAGRGHEMNLPKGAKLELELERALYLVRE |
| Ga0209237_12356361 | 3300026297 | Grasslands Soil | LTAYLMESGRGHELNLPKGAKLELELERALYLVKE |
| Ga0209240_11670282 | 3300026304 | Grasslands Soil | LAAYLMESGRGHEIDLPKGAKLELELERALYLLKE |
| Ga0209055_12734742 | 3300026309 | Soil | LGALTAYLMEVGRGHELNLPKGAKLELELERALYLVKE |
| Ga0209647_12411341 | 3300026319 | Grasslands Soil | TRAAESALAAYLTESGRGHEIVLPKGAKLELELGRALYLVRE |
| Ga0209687_10595072 | 3300026322 | Soil | GAITAYLMESGRGHELNLPKGAKLELELERALYLVKE |
| Ga0209804_10119345 | 3300026335 | Soil | AGAAVGALTAYLMESGRGHELKLPKGAKLELELERALYLVKE |
| Ga0257150_10735131 | 3300026356 | Soil | EGALAGAIAAYLMESGRGHELDLPKGAKLELELERALYLVKD |
| Ga0257176_10912781 | 3300026361 | Soil | GALTAYLMESGRGHELNLPKGAKLELELERALYLVKE |
| Ga0209157_11146791 | 3300026537 | Soil | ALGALTAYLMESGRGHELNLPKGAKLELELERALYLVKE |
| Ga0209577_101392801 | 3300026552 | Soil | ALTAYLMESGRGHELKLPKGAKLELELERPLYLVKE |
| Ga0179587_105055742 | 3300026557 | Vadose Zone Soil | GALTAYLMESGRGHELNLPKGAKLELELERALYLVRE |
| Ga0207819_10131052 | 3300027024 | Tropical Forest Soil | AEGAALGALEAYLAESGRGEELNLPRGAKLELELERALYLVKE |
| Ga0208730_10105432 | 3300027047 | Forest Soil | AEGAATAALAAYLIESGRGHELDLPKGAKLELELGRALYLVKE |
| Ga0207806_10432352 | 3300027049 | Tropical Forest Soil | LEAYLAESGRGEELNLPRGAKLELELERALYLVKE |
| Ga0207780_10629061 | 3300027313 | Tropical Forest Soil | AEGAAMAALEAYLMESGRGQELNLPKGAKLELELGRALYLLKE |
| Ga0209735_10851822 | 3300027562 | Forest Soil | EGAAAAAIAAYLIESGRGHEIDLPKGAKLELELERALYLVKE |
| Ga0209076_10851361 | 3300027643 | Vadose Zone Soil | AAVGAIAAYLMESGRGHEIDLPKGAKLELELERALYLLKE |
| Ga0209217_10503422 | 3300027651 | Forest Soil | LTAYLVESGRGHELNLPKGAKLELELERALYLLKE |
| Ga0209217_10520342 | 3300027651 | Forest Soil | GAAMGALQAYLMEVGRGQELNLPKGAKLELELERALYLVQE |
| Ga0209038_102137872 | 3300027737 | Bog Forest Soil | AFTAYLAESGRGHELTFQHGAKLELELERALYLLKE |
| Ga0209074_101741592 | 3300027787 | Agricultural Soil | EGAALGAITAYLMESGRGHELNLPKGAKLELELERALYLVKE |
| Ga0209074_102700821 | 3300027787 | Agricultural Soil | EGAALGAITAYLMESGRGHELNLPKGAKLELELERALYLLKE |
| Ga0209139_102562842 | 3300027795 | Bog Forest Soil | MGALEAYLMEAGRGQDLNLPKGAKLELELERALYLVRE |
| Ga0209283_100519853 | 3300027875 | Vadose Zone Soil | LGAITAYLMESGRGHELKLPKGAKLELELERALYLVKE |
| Ga0209275_100066835 | 3300027884 | Soil | ALGALEAYLMEAGRGQEIELPKGAKLELELERALYLVRE |
| Ga0209698_111159662 | 3300027911 | Watersheds | AEGAAIVALEAYLMEAGRGQELDLPKGAKLELELERALYLVKE |
| Ga0209526_103901212 | 3300028047 | Forest Soil | GAAAGAIAAYLMESGRGHELDLPKGAKLELELERALYLVKE |
| Ga0137415_100773003 | 3300028536 | Vadose Zone Soil | AITAYLMESGRGHELNLPKGAKLELELERALYLVKE |
| Ga0302224_100289574 | 3300028759 | Palsa | MAAFAAYLAESGRGQEINLQHGIKFELELERALYLLKE |
| Ga0308309_110182712 | 3300028906 | Soil | EVAEGAMAAAIAAYLVESGRGHEVDLPRGAKLEVELERALYLVRD |
| Ga0311353_109382941 | 3300030399 | Palsa | EAAAMAAFTAYLAESGRGHEITFQRGVKFELELERSLYLLKD |
| Ga0170834_1078283191 | 3300031057 | Forest Soil | GAAAAAIAAYLMESGRGHEIDLPKGAKMELELERALYLLKE |
| Ga0170834_1103085531 | 3300031057 | Forest Soil | LGALEAYLTEAGRGQEIELPKGAKLELELERALYLVRE |
| Ga0170824_1258635493 | 3300031231 | Forest Soil | AEGAALGALTAYLMESGRGHELNLPKGAKLELELERALYLVKE |
| Ga0302325_102085601 | 3300031234 | Palsa | AAMAAFTAYLAESGRGHEITFQRGVKFELELERSLYLLKD |
| Ga0302324_1014867401 | 3300031236 | Palsa | KAAAEAAAMAAFTAYLAESGRGHEITFQRGVKFELELERSLYLLKD |
| Ga0170820_120413541 | 3300031446 | Forest Soil | GAAEAALAAYLMEAGRGHELELAKGAKLEIELERALYLLKE |
| Ga0318541_102577232 | 3300031545 | Soil | GESAALGALEAYLLETGRGQELDLPKGAKLELELARTLYLVKP |
| Ga0318560_107719871 | 3300031682 | Soil | YAAVAALEAYLMEAGRGHEMSLPKGSKLELELERALYLVRE |
| Ga0307469_102697991 | 3300031720 | Hardwood Forest Soil | AEAAALGALTAYLMESGRGHELNLPKGAKLELELERALYLVKE |
| Ga0307469_104372862 | 3300031720 | Hardwood Forest Soil | GALEAYLMEAGRGQEIELPKGAKLELELERALYLTRE |
| Ga0307477_109136812 | 3300031753 | Hardwood Forest Soil | GAAAGAIAAYLMESGRGHEIDLPKGAKLELELERALYLLKE |
| Ga0307475_107826552 | 3300031754 | Hardwood Forest Soil | AALGALEAYLMEAGRGQEIELPKGAKLELELERALYLVRE |
| Ga0307475_109049501 | 3300031754 | Hardwood Forest Soil | EGAALGALEAYLMDAGRGQEIDLPKGAKLELELERALYLTRE |
| Ga0318557_104716661 | 3300031795 | Soil | YAAVAALEAYLMEAGRGHEMNLPKGSKLELELERALYLVRE |
| Ga0307473_104730613 | 3300031820 | Hardwood Forest Soil | AIAAYLMASGRGHELDLPKGAKLELELERALYLVKE |
| Ga0318567_105997561 | 3300031821 | Soil | AESAALGALEAYLLETGRGQELDLPKGAKLELELARTLYLVKP |
| Ga0306925_101714563 | 3300031890 | Soil | LGALEAYLMEAGRGQELDLPKGAKLELELERALYLVRE |
| Ga0307479_100069321 | 3300031962 | Hardwood Forest Soil | TAALAAYLIESGRGHELDLPKGAKLELELGRALYLVKE |
| Ga0318569_103994411 | 3300032010 | Soil | ALEAYLLETGRGQELDLPKGAKLELELERTLYLVKP |
| Ga0318524_106140601 | 3300032067 | Soil | SAALGALEAYLQETGRGQELDLPKGAKLELELERALYLVKE |
| Ga0306920_1007971871 | 3300032261 | Soil | GALEAYLMEAGCGEELNLPRGCKLELELERTLYLVKE |
| Ga0335069_103797971 | 3300032893 | Soil | AAAIAAYLVESGRGHEVDLPRGAKLEVELERALYLVRN |
| Ga0335071_100169651 | 3300032897 | Soil | AALGALEAYLMEAGRGEELSLARGCKLELELERALYLVKD |
| Ga0335077_102730101 | 3300033158 | Soil | GALEAYLTEAGRGQELELPKGAKLELELERALYLVRE |
| Ga0314861_0105291_1304_1420 | 3300033977 | Peatland | MGALEAYLTESGWGQELDLPKGAKLELELERALYLVRE |
| ⦗Top⦘ |