Basic Information | |
---|---|
Family ID | F035090 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 173 |
Average Sequence Length | 41 residues |
Representative Sequence | MAPDTKHLEVTLETQVESVNLAEEMCLRVAEAAGFGEDDCY |
Number of Associated Samples | 142 |
Number of Associated Scaffolds | 172 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 46.24 % |
% of genes near scaffold ends (potentially truncated) | 98.27 % |
% of genes from short scaffolds (< 2000 bps) | 87.86 % |
Associated GOLD sequencing projects | 136 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.33 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (83.237 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (27.168 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.480 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.509 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.64% β-sheet: 0.00% Coil/Unstructured: 75.36% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 172 Family Scaffolds |
---|---|---|
PF13335 | Mg_chelatase_C | 48.26 |
PF04011 | LemA | 6.40 |
PF13541 | ChlI | 1.74 |
PF07676 | PD40 | 1.74 |
PF08530 | PepX_C | 1.16 |
PF01797 | Y1_Tnp | 1.16 |
PF13193 | AMP-binding_C | 1.16 |
PF13231 | PMT_2 | 1.16 |
PF08241 | Methyltransf_11 | 1.16 |
PF00654 | Voltage_CLC | 1.16 |
PF00535 | Glycos_transf_2 | 1.16 |
PF12802 | MarR_2 | 1.16 |
PF01078 | Mg_chelatase | 1.16 |
PF06827 | zf-FPG_IleRS | 0.58 |
PF16657 | Malt_amylase_C | 0.58 |
PF05711 | TylF | 0.58 |
PF12704 | MacB_PCD | 0.58 |
PF13508 | Acetyltransf_7 | 0.58 |
PF07719 | TPR_2 | 0.58 |
PF00324 | AA_permease | 0.58 |
PF13414 | TPR_11 | 0.58 |
PF09972 | DUF2207 | 0.58 |
PF14559 | TPR_19 | 0.58 |
PF02566 | OsmC | 0.58 |
PF01522 | Polysacc_deac_1 | 0.58 |
PF00571 | CBS | 0.58 |
PF05235 | CHAD | 0.58 |
PF00583 | Acetyltransf_1 | 0.58 |
PF03551 | PadR | 0.58 |
PF06877 | RraB | 0.58 |
COG ID | Name | Functional Category | % Frequency in 172 Family Scaffolds |
---|---|---|---|
COG1704 | Magnetosome formation protein MamQ, lipoprotein antigen LemA family | Cell wall/membrane/envelope biogenesis [M] | 6.40 |
COG2936 | Predicted acyl esterase | General function prediction only [R] | 1.16 |
COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 1.16 |
COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 1.16 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.58 |
COG5607 | CHAD domain, binds inorganic polyphosphates | Function unknown [S] | 0.58 |
COG3076 | Regulator of RNase E activity RraB | Translation, ribosomal structure and biogenesis [J] | 0.58 |
COG3025 | Inorganic triphosphatase YgiF, contains CYTH and CHAD domains | Inorganic ion transport and metabolism [P] | 0.58 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.58 |
COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.58 |
COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.58 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.58 |
COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 0.58 |
COG1113 | L-asparagine transporter or related permease | Amino acid transport and metabolism [E] | 0.58 |
COG0833 | Amino acid permease | Amino acid transport and metabolism [E] | 0.58 |
COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
COG0531 | Serine transporter YbeC, amino acid:H+ symporter family | Amino acid transport and metabolism [E] | 0.58 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 83.24 % |
Unclassified | root | N/A | 16.76 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005176|Ga0066679_10007540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 5199 | Open in IMG/M |
3300005180|Ga0066685_10433215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 913 | Open in IMG/M |
3300005467|Ga0070706_100322422 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
3300005467|Ga0070706_100823779 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
3300005537|Ga0070730_10191404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1368 | Open in IMG/M |
3300005541|Ga0070733_10572682 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
3300005549|Ga0070704_101890170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
3300005576|Ga0066708_10639528 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300005591|Ga0070761_10473975 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300005617|Ga0068859_101384122 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 776 | Open in IMG/M |
3300005712|Ga0070764_10922225 | Not Available | 548 | Open in IMG/M |
3300005995|Ga0066790_10533006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 502 | Open in IMG/M |
3300006163|Ga0070715_10723229 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300006797|Ga0066659_10718648 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300007076|Ga0075435_100069757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis → Granulicella mallensis MP5ACTX8 | 2867 | Open in IMG/M |
3300007788|Ga0099795_10345202 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300009012|Ga0066710_100107206 | All Organisms → cellular organisms → Bacteria | 3760 | Open in IMG/M |
3300009038|Ga0099829_10719134 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300009088|Ga0099830_10041978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3177 | Open in IMG/M |
3300009088|Ga0099830_11876588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300009089|Ga0099828_10088245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2661 | Open in IMG/M |
3300009089|Ga0099828_11268093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
3300009137|Ga0066709_101488422 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
3300009174|Ga0105241_12700514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
3300009621|Ga0116116_1067382 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1034 | Open in IMG/M |
3300009629|Ga0116119_1128540 | Not Available | 633 | Open in IMG/M |
3300010048|Ga0126373_10526041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1228 | Open in IMG/M |
3300010048|Ga0126373_11838215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
3300010303|Ga0134082_10327410 | Not Available | 645 | Open in IMG/M |
3300010343|Ga0074044_10444479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 848 | Open in IMG/M |
3300010359|Ga0126376_11428365 | Not Available | 718 | Open in IMG/M |
3300010359|Ga0126376_11484813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
3300010359|Ga0126376_11646792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
3300010359|Ga0126376_12096325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
3300010361|Ga0126378_10662682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1156 | Open in IMG/M |
3300010361|Ga0126378_11564604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 748 | Open in IMG/M |
3300011269|Ga0137392_10639507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 882 | Open in IMG/M |
3300011270|Ga0137391_10075886 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2892 | Open in IMG/M |
3300011271|Ga0137393_10132909 | All Organisms → cellular organisms → Bacteria | 2062 | Open in IMG/M |
3300011271|Ga0137393_10405957 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
3300011271|Ga0137393_10711914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 860 | Open in IMG/M |
3300012096|Ga0137389_10013811 | All Organisms → cellular organisms → Bacteria | 5483 | Open in IMG/M |
3300012096|Ga0137389_11496039 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300012189|Ga0137388_11735232 | Not Available | 558 | Open in IMG/M |
3300012202|Ga0137363_11389578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
3300012203|Ga0137399_10201451 | Not Available | 1616 | Open in IMG/M |
3300012203|Ga0137399_11272659 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300012207|Ga0137381_11568892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
3300012207|Ga0137381_11775737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
3300012209|Ga0137379_10350572 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
3300012209|Ga0137379_11380212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
3300012210|Ga0137378_11493759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
3300012349|Ga0137387_10701126 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300012356|Ga0137371_10236741 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
3300012357|Ga0137384_10386115 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
3300012361|Ga0137360_10007363 | All Organisms → cellular organisms → Bacteria | 6825 | Open in IMG/M |
3300012582|Ga0137358_10630518 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300012683|Ga0137398_10670429 | Not Available | 720 | Open in IMG/M |
3300012917|Ga0137395_10169894 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
3300012923|Ga0137359_11125001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
3300012924|Ga0137413_11494724 | Not Available | 549 | Open in IMG/M |
3300012925|Ga0137419_11125982 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300012929|Ga0137404_11291307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
3300012929|Ga0137404_11670478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
3300012930|Ga0137407_10819073 | Not Available | 879 | Open in IMG/M |
3300012931|Ga0153915_13497856 | Not Available | 508 | Open in IMG/M |
3300012948|Ga0126375_11604045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
3300012957|Ga0164303_10194440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1117 | Open in IMG/M |
3300012964|Ga0153916_13168373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
3300012972|Ga0134077_10484492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
3300013503|Ga0120127_10092464 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300014151|Ga0181539_1046404 | All Organisms → cellular organisms → Bacteria | 2079 | Open in IMG/M |
3300014166|Ga0134079_10289417 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300015052|Ga0137411_1295149 | All Organisms → cellular organisms → Bacteria | 8932 | Open in IMG/M |
3300015052|Ga0137411_1295149 | All Organisms → cellular organisms → Bacteria | 8932 | Open in IMG/M |
3300015054|Ga0137420_1427957 | All Organisms → cellular organisms → Bacteria | 3679 | Open in IMG/M |
3300015264|Ga0137403_10136787 | All Organisms → cellular organisms → Bacteria | 2428 | Open in IMG/M |
3300015264|Ga0137403_11213002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
3300015371|Ga0132258_13184504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1132 | Open in IMG/M |
3300016294|Ga0182041_12049964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
3300016319|Ga0182033_11511913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
3300016357|Ga0182032_10772059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 811 | Open in IMG/M |
3300016445|Ga0182038_11364367 | Not Available | 635 | Open in IMG/M |
3300017823|Ga0187818_10298500 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300017823|Ga0187818_10581416 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300017929|Ga0187849_1062571 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1685 | Open in IMG/M |
3300017930|Ga0187825_10059309 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
3300017934|Ga0187803_10126629 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
3300017943|Ga0187819_10760430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
3300017947|Ga0187785_10083203 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
3300018007|Ga0187805_10428746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
3300018023|Ga0187889_10116041 | Not Available | 1304 | Open in IMG/M |
3300018030|Ga0187869_10377241 | Not Available | 677 | Open in IMG/M |
3300018032|Ga0187788_10146836 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
3300018058|Ga0187766_10296105 | Not Available | 1047 | Open in IMG/M |
3300018433|Ga0066667_10120438 | Not Available | 1792 | Open in IMG/M |
3300020580|Ga0210403_10259845 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
3300020581|Ga0210399_10260554 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
3300020581|Ga0210399_10887858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
3300020581|Ga0210399_11402032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
3300020582|Ga0210395_11366153 | Not Available | 517 | Open in IMG/M |
3300020583|Ga0210401_10683499 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
3300020583|Ga0210401_11430049 | Not Available | 549 | Open in IMG/M |
3300021088|Ga0210404_10368191 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300021168|Ga0210406_10591448 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
3300021168|Ga0210406_11022187 | Not Available | 614 | Open in IMG/M |
3300021180|Ga0210396_10719376 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
3300021180|Ga0210396_11635352 | Not Available | 525 | Open in IMG/M |
3300021432|Ga0210384_10059974 | Not Available | 3439 | Open in IMG/M |
3300021432|Ga0210384_11680604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
3300021475|Ga0210392_11426090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
3300021478|Ga0210402_10428162 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
3300021479|Ga0210410_10227329 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
3300022533|Ga0242662_10274098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
3300024288|Ga0179589_10230258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
3300024310|Ga0247681_1047138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
3300025469|Ga0208687_1025059 | All Organisms → cellular organisms → Bacteria | 1641 | Open in IMG/M |
3300025916|Ga0207663_11195573 | Not Available | 612 | Open in IMG/M |
3300025916|Ga0207663_11401712 | Not Available | 563 | Open in IMG/M |
3300026088|Ga0207641_11938988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
3300026285|Ga0209438_1139873 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300026319|Ga0209647_1195043 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300026374|Ga0257146_1079597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
3300026482|Ga0257172_1075188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
3300026515|Ga0257158_1050613 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300026548|Ga0209161_10032061 | All Organisms → cellular organisms → Bacteria | 3614 | Open in IMG/M |
3300026551|Ga0209648_10454642 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300026551|Ga0209648_10549756 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300026552|Ga0209577_10247975 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
3300026557|Ga0179587_10176791 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
3300026890|Ga0207781_1008987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1087 | Open in IMG/M |
3300026896|Ga0207730_1016747 | Not Available | 624 | Open in IMG/M |
3300026941|Ga0207741_1004453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1725 | Open in IMG/M |
3300027645|Ga0209117_1195607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
3300027674|Ga0209118_1092375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
3300027738|Ga0208989_10230594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
3300027846|Ga0209180_10742923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
3300027855|Ga0209693_10410887 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300027855|Ga0209693_10548491 | Not Available | 549 | Open in IMG/M |
3300027862|Ga0209701_10398930 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300027862|Ga0209701_10738585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
3300027875|Ga0209283_10912563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
3300027903|Ga0209488_11011651 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300027905|Ga0209415_10113098 | All Organisms → cellular organisms → Bacteria | 2907 | Open in IMG/M |
3300028138|Ga0247684_1088669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
3300028146|Ga0247682_1077099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
3300031040|Ga0265754_1022444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
3300031231|Ga0170824_111982563 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300031549|Ga0318571_10307356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
3300031573|Ga0310915_11234268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
3300031640|Ga0318555_10021936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3013 | Open in IMG/M |
3300031708|Ga0310686_119199271 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300031720|Ga0307469_10940327 | Not Available | 803 | Open in IMG/M |
3300031736|Ga0318501_10306192 | Not Available | 849 | Open in IMG/M |
3300031744|Ga0306918_10489841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 962 | Open in IMG/M |
3300031753|Ga0307477_11048632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
3300031754|Ga0307475_10489069 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
3300031819|Ga0318568_10841210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
3300031823|Ga0307478_11304882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
3300031912|Ga0306921_10216344 | All Organisms → cellular organisms → Bacteria | 2245 | Open in IMG/M |
3300031947|Ga0310909_10226211 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
3300031962|Ga0307479_10679441 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
3300031962|Ga0307479_11423891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
3300032089|Ga0318525_10688662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300032091|Ga0318577_10341324 | Not Available | 716 | Open in IMG/M |
3300032180|Ga0307471_102270887 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300032180|Ga0307471_103303910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
3300032205|Ga0307472_101193918 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300032205|Ga0307472_102227723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
3300032261|Ga0306920_102853180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
3300032782|Ga0335082_10094140 | Not Available | 2981 | Open in IMG/M |
3300032897|Ga0335071_10339404 | Not Available | 1455 | Open in IMG/M |
3300033402|Ga0326728_10146679 | All Organisms → cellular organisms → Bacteria | 2579 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 27.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.50% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.78% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.20% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.05% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.05% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.47% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.47% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.31% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.73% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.73% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.73% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.73% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.73% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.73% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.16% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.16% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.16% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.16% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.58% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.58% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.58% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.58% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.58% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.58% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.58% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.58% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.58% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.58% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009621 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 | Environmental | Open in IMG/M |
3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
3300025469 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300026890 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 51 (SPAdes) | Environmental | Open in IMG/M |
3300026896 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 71 (SPAdes) | Environmental | Open in IMG/M |
3300026941 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 39 (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
3300031040 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0066679_100075401 | 3300005176 | Soil | MALNTKHLEMTLETQVESVNLAEEMCLRVAEAAGFGEDDCYRI |
Ga0066685_104332152 | 3300005180 | Soil | MTTETKHLEVTLDTQVESVNLAEEMCLRVAEAIGFGEDDCYRIG |
Ga0070706_1003224222 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPDTKHLEMTLETQVESVNLAEEMCLRVAEAAGFGEDDC* |
Ga0070706_1008237791 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VADEHMAQDNKHLEVVLDTQVESVNLAEEMCLRVAEAAGFDEEVCYRIGM |
Ga0070730_101914041 | 3300005537 | Surface Soil | MGTDPKHLEITLETQVESVNLAEEMCLRVAEAAGFGED |
Ga0070733_105726821 | 3300005541 | Surface Soil | MGKDPKHLEITLETQVESVNLAEEMCLRVAEAAGFGEDDCYK |
Ga0070704_1018901702 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQENKHLEVVLDTQVESVNLAEEMCLRVAEAAGFDEEMC |
Ga0066708_106395282 | 3300005576 | Soil | MASGEKHLEITLETQVESVNLAEEMCLRVAEAAGFGEDDCYRIG |
Ga0070761_104739752 | 3300005591 | Soil | MGTDPKHLEVTLETQVESVNLAEEMCLRVAEAAGFGE |
Ga0068859_1013841221 | 3300005617 | Switchgrass Rhizosphere | MAQDENKHLEVVLDTQVESVNLAEEMCLRVAEAAGF |
Ga0070764_109222251 | 3300005712 | Soil | MAPDTKHLEVTLDTHVESVNVAEEMCLRVAESAGFGEDDCYRI |
Ga0066790_105330061 | 3300005995 | Soil | MAPDDKHLEVTLDTHVESVNLAEEMCLRVAEKAGFGEDDCYRIGM |
Ga0070715_107232291 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQDNKHLAVVLDTQVESVNLAEEMCLRVAEAAGFDEEMCYRIGMSV |
Ga0066659_107186481 | 3300006797 | Soil | MALTTKHLEMTLETQVESVNLAEEMCLRVAEAAGFGEDDCYRIG |
Ga0075435_1000697573 | 3300007076 | Populus Rhizosphere | MAPENKHLEVVLDTQVESVNLAEEMCLRVAEAAGFDE |
Ga0099795_103452022 | 3300007788 | Vadose Zone Soil | MTQDSKHLEVTLETQVESVNLAEEMCLRVAEAAGFGE |
Ga0066710_1001072066 | 3300009012 | Grasslands Soil | MAPETKHLEITLETQVESVNLAEEMCLRVADAAGFGED |
Ga0099829_107191342 | 3300009038 | Vadose Zone Soil | MASNAKHLEMTLETIVESVNLAEEMCLRVAEAAGFGE |
Ga0099830_100419783 | 3300009088 | Vadose Zone Soil | MASDIKHLEITLETQVESVNLAEEMCLRVAEAAGFGEDDCYRIGMS |
Ga0099830_118765882 | 3300009088 | Vadose Zone Soil | MAEDNKHLEVVLDTQVESVNLAEEMCLRVAESAGFDEE |
Ga0099828_100882451 | 3300009089 | Vadose Zone Soil | MASDTKHLKITLETQVESVNLAEEMCLRVAEAAGFG |
Ga0099828_112680932 | 3300009089 | Vadose Zone Soil | MAPETKHLEITLETQVDSVNLAEEMCLRVAEAAGFG |
Ga0066709_1014884222 | 3300009137 | Grasslands Soil | MASETKHLEMTLETIVESVNLAEEMCLRVAEAAGFGEDDCYR |
Ga0105241_127005141 | 3300009174 | Corn Rhizosphere | MAQENKHLEVVLDTQVESVNLAEEMCLRVAEAAGFDEEMCYRI |
Ga0116116_10673821 | 3300009621 | Peatland | MAPDTKHLEVTLDTHVESVNLAEEMCLRVAEAAGFAEDECYRIGMS |
Ga0116119_11285401 | 3300009629 | Peatland | MAPDTKHLEVILDTHVESVNLAEEMCLRVAEAAGFAEDECYRIGMSV |
Ga0126373_105260413 | 3300010048 | Tropical Forest Soil | MAQDNRHLEVVLDTQVESVNLAEEMCLKVAEAAGFDEEMCYRIGM |
Ga0126373_118382152 | 3300010048 | Tropical Forest Soil | MADDNKHLEVVLDTQVESVNLAEEMCLHVAEAAGF |
Ga0134082_103274102 | 3300010303 | Grasslands Soil | MALTTKHLEMTLETQVESVNLAEEMCLRVAEAAGFGEDDCYRIGM |
Ga0074044_104444792 | 3300010343 | Bog Forest Soil | MAPDTKHLEVILDTHVESVNLAEEMCLRVAEAAGFAEDECY |
Ga0126376_114283651 | 3300010359 | Tropical Forest Soil | MTDENKHLEVTLETQVESVNLAEEMCLRVAEAAGFGED |
Ga0126376_114848132 | 3300010359 | Tropical Forest Soil | MTASAKHLEITLETQVESVNLAEEMCLRVAEAAGFGEDDCYRIGMSV |
Ga0126376_116467922 | 3300010359 | Tropical Forest Soil | MAPETKHLEVTLETQVESVNLAEEMCLRLAEAAGFGE |
Ga0126376_120963251 | 3300010359 | Tropical Forest Soil | MTPKTKHLEVTLDTEVESVNVAEAMCLRVAEAAGFGE |
Ga0126378_106626821 | 3300010361 | Tropical Forest Soil | MAPETKHLEVTLDNHVESVNLAEEMCVRVAEASGFNEDECYR |
Ga0126378_115646041 | 3300010361 | Tropical Forest Soil | MAQENKHLEVVLDTQVESVNLAEEMCLRVAEAAGFDEEMCYRIGM |
Ga0137392_106395072 | 3300011269 | Vadose Zone Soil | MASEIKHLEMTLETIVESVNLAEEMCLRVAEAAGFGEDDCYRI |
Ga0137391_100758861 | 3300011270 | Vadose Zone Soil | MASDTKHLEITLETQVESVNLAEEMCLRVAEAAGFGEDDCYR |
Ga0137393_101329091 | 3300011271 | Vadose Zone Soil | MAPDTKHLEMTLETQVESVNLAEEMCLRVAEAAGFGEDDCYR |
Ga0137393_104059572 | 3300011271 | Vadose Zone Soil | MASNAKHLEMTLETIVESVNLAEEMCLRVAEAAGFGEDDC |
Ga0137393_107119142 | 3300011271 | Vadose Zone Soil | MPQDTKHLEVTLETQVDSVNLAEEMCLRVAEAAGFGED |
Ga0137389_100138116 | 3300012096 | Vadose Zone Soil | MASDTKHLEITLETQVESVNLAEEMCLRVAEAAGFGE |
Ga0137389_114960392 | 3300012096 | Vadose Zone Soil | MSEDSRHLEITLETQVESVNLAEEMCLRVAEAAGFGEDDCYRIG |
Ga0137388_117352322 | 3300012189 | Vadose Zone Soil | MASDAKHLEITLETQVESVNLAEEMCLRVAEAAGFGEDDCYR |
Ga0137363_113895781 | 3300012202 | Vadose Zone Soil | MALTTKHLEMTLETQVESVNLAEEMCLRVAKAAGFGEDDCYRIGMSV |
Ga0137399_102014512 | 3300012203 | Vadose Zone Soil | MASDTKHLEVTLETQVESVNLAEELCLRVAEAAGFGEDDC |
Ga0137399_112726592 | 3300012203 | Vadose Zone Soil | MASYTKHLEMTLETQVESVNLAEAMCLRVAEAAGFGEEDC* |
Ga0137381_115688922 | 3300012207 | Vadose Zone Soil | MVSNTKHLEMTLETQVESVNLAEEMCLRVAEAAGFGEDDCY |
Ga0137381_117757371 | 3300012207 | Vadose Zone Soil | MQAVFEVADQHMAQDNKHLEVVLDTQVESVNLAEEMCLRVAEAAGF |
Ga0137379_103505721 | 3300012209 | Vadose Zone Soil | VDGFARGSGLRMAPDNKHLEITLETQVESVNLAEEMCLRVAEAAGFGEDDCYRIGMSV |
Ga0137379_113802122 | 3300012209 | Vadose Zone Soil | MASEIKHLEMTLETHVESVNLAEEMCLRVAEAAGFGEDDCYRIGM |
Ga0137378_114937591 | 3300012210 | Vadose Zone Soil | MSSDTKHLEMTLETQVESVNLAEEMCLRVAEAAGFGEDDCYRIG |
Ga0137387_107011261 | 3300012349 | Vadose Zone Soil | MASETKHLEMTLETIVESVNLAEEMCLRVAEAAGFGEDD |
Ga0137371_102367411 | 3300012356 | Vadose Zone Soil | MQAVFVVADQHMAQDNKHLEVVLDTQVESVNLAEEMCLRVAE |
Ga0137384_103861151 | 3300012357 | Vadose Zone Soil | MVSNTKHLEMTLETQVESVNLAEEMCLRVAEAAGFGE |
Ga0137360_1000736311 | 3300012361 | Vadose Zone Soil | MASDTKHLEITLETQVESVNLAEEMCLRVAEAAGFGEDDCY |
Ga0137358_106305182 | 3300012582 | Vadose Zone Soil | VTPERKHLEVTLETQVESVNLAEEMCLRVAEAAGFGEDECYR |
Ga0137398_106704291 | 3300012683 | Vadose Zone Soil | MASYTKHLEMTLETQVESVNLAEEMCLRVAEAAGFGEDDCYR |
Ga0137395_101698941 | 3300012917 | Vadose Zone Soil | MAEDNKHLEVVLDTQVESVNLAEEMCLRVAESAGFDEEMCYRIGM |
Ga0137359_111250011 | 3300012923 | Vadose Zone Soil | LLVADKHMAQDNKHMEVVLDTQVESVNLAEEMCLRVAEAAGFDEEV |
Ga0137413_114947241 | 3300012924 | Vadose Zone Soil | MAPETKHLEVTLDTHVESVNLAEEMCVRVAEAAGFNEDECYRIGMSV |
Ga0137419_111259822 | 3300012925 | Vadose Zone Soil | VTPERNHLEVTLETQVESVNLAEEMCLRVAEAAGFGEDD* |
Ga0137404_112913072 | 3300012929 | Vadose Zone Soil | LLVADKHMAQDNKHMEVVLDTQVESVNLAEEMCLRVAEAAGFDE |
Ga0137404_116704782 | 3300012929 | Vadose Zone Soil | LQVADEHMAQDNKHMEVVLDTQVESVNLAEEMCLRVAEAA |
Ga0137407_108190731 | 3300012930 | Vadose Zone Soil | LLVADKHMAQDNKHMEVVLDTQVESVNLAEEMCLRVAEAA |
Ga0153915_134978561 | 3300012931 | Freshwater Wetlands | MEPESKHLELTLQTKVESVSLAEEACLRVAEAAGFGE |
Ga0126375_116040452 | 3300012948 | Tropical Forest Soil | MAQENKHLEVVLDTQVESVNLAEEMCLRVAEAAGFD |
Ga0164303_101944401 | 3300012957 | Soil | MVEENKHLEVVLDTQVESVNLAEEMCLRVAEAAGF |
Ga0153916_131683732 | 3300012964 | Freshwater Wetlands | MEPDSKHLELTLQTKVESVSLAEEACLRVAEAAGFGEDECYRI |
Ga0134077_104844922 | 3300012972 | Grasslands Soil | MASETKHLEMTLETIVESVNLAEEMCLRVAEAAGF |
Ga0120127_100924642 | 3300013503 | Permafrost | MADPKQLDVTLETQVESVNLAEEMCLRVAEAAGLE |
Ga0181539_10464041 | 3300014151 | Bog | MAPDTKHLEVTLDTQVESVNLAEEMCLRVAEAAGFAE |
Ga0134079_102894172 | 3300014166 | Grasslands Soil | MASGDKHLEITLETQVESVNLAEEMCLRVAEAAGFGED |
Ga0137411_12951491 | 3300015052 | Vadose Zone Soil | MASDAKHLEITLETQVESVNLAEELCLRVAEAAGFGEDDCYRIGMSL |
Ga0137411_129514915 | 3300015052 | Vadose Zone Soil | MASDAKHLEITLETRSRASICRELCLRVAEAAVREDDCYRIGM |
Ga0137420_14279571 | 3300015054 | Vadose Zone Soil | MTQDSKHLEVTLETQVESVNLAEEMCLRVAEAARFGEDD |
Ga0137403_101367875 | 3300015264 | Vadose Zone Soil | MAFNTKHLEMTLETQVESVNLAEEMCLRVAEAAGFGEDDCYR |
Ga0137403_112130021 | 3300015264 | Vadose Zone Soil | MAPETKHLEVTFETQVESVNLAEEMCLRLAEAAGFGEDECYRIGMS |
Ga0132258_131845041 | 3300015371 | Arabidopsis Rhizosphere | MAQDEKKHLEVVLDTQVESVNLAEEMCLRVAEAAGFDEEMCYRIGM |
Ga0182041_120499642 | 3300016294 | Soil | MAPDTKHLEVTLDTHVESVNLAEEMCVRVAEAVGFN |
Ga0182033_115119132 | 3300016319 | Soil | MTPEAKHLEVVLDTHVESVNLAEEMCLRVAEAVGF |
Ga0182032_107720592 | 3300016357 | Soil | MAQEKKHLEVLLDTQVESVNLAEEMCIRVAEAAGFDEEMCYRIGM |
Ga0182038_113643671 | 3300016445 | Soil | MTPQAKHLVVILDTHVESVNLAEEMCLRVAEAVGFSEDECYRIGMS |
Ga0187818_102985001 | 3300017823 | Freshwater Sediment | MGTDPKHLEITLETQVESVNLAEEMCLRVAEAAGFGEDDCYKIGM |
Ga0187818_105814161 | 3300017823 | Freshwater Sediment | MAPETKHLEITLETQVESVNLAEEMCLRVAEAAGFGEDDCYRI |
Ga0187849_10625713 | 3300017929 | Peatland | MAPDTKHLEVTLDTHVESVNLAEEMCLRVAEAAGFAEDECYRIGMSV |
Ga0187825_100593091 | 3300017930 | Freshwater Sediment | MGTDPKHLEITLETQVESVNLAEEMCLRVAEAAGFGEDDCYKIG |
Ga0187803_101266291 | 3300017934 | Freshwater Sediment | MAPDTKHLEVLLDTQVESVNLAEEMCLRVAEAAGFAEDECYRIGMS |
Ga0187819_107604301 | 3300017943 | Freshwater Sediment | MTPEAKHLEVVLDTHVESVNLAEEMCLRVAEAVGFNEDECYRIGM |
Ga0187785_100832033 | 3300017947 | Tropical Peatland | MTPQAKHLEVILDTHVESVNLAEEMCLRVAEAVGFTE |
Ga0187805_104287461 | 3300018007 | Freshwater Sediment | MTPEAKHLEVVLDTNVESVNLAEEMCLRVAEAVGFSEDECYRIGM |
Ga0187889_101160411 | 3300018023 | Peatland | MAPDTKHLEVTLDTHVESVNLAEEMCLRVAEAAGFAE |
Ga0187869_103772411 | 3300018030 | Peatland | MAPDTKHLEVILDTHVESVNLAEEMCLRVAEAAGFAEDECYRIGM |
Ga0187788_101468361 | 3300018032 | Tropical Peatland | MAPETKHLEVTLETQVESVNLAEEMCLRVAEAAGFGE |
Ga0187766_102961052 | 3300018058 | Tropical Peatland | MTPEAKHLEVILDTHVESVNLAEEMCLRVAEAVGFSEDECY |
Ga0066667_101204381 | 3300018433 | Grasslands Soil | MALNTKHLEMTLETQVESVNLAEEMCLRVAEAAGFGEDDCYRIG |
Ga0210403_102598451 | 3300020580 | Soil | MASDTKHLEMTLETQVESVNLAEEMCLRVAEAAGFGEDDCYRIGMS |
Ga0210399_102605542 | 3300020581 | Soil | MGTDPKHLEVTLETQVESVNLAEEMCLRVAEAAGFGEDD |
Ga0210399_108878581 | 3300020581 | Soil | MAPDTKHLEVTLETQVESVNVAEEMCLRVAEAAGFGEDDC |
Ga0210399_114020321 | 3300020581 | Soil | MTPETKHLEVTLQTQVESVNLAEEMCLRVAEAAGFGEDDCYR |
Ga0210395_113661531 | 3300020582 | Soil | MGTDPKHLEITLETQVESVNLAEEMCIRVAEAAGFGEDDCYKIG |
Ga0210401_106834992 | 3300020583 | Soil | MAPDTKHLEVTLETHVESVNLAEEMCLRVAESAGFGEDDCY |
Ga0210401_114300492 | 3300020583 | Soil | MADQKHLDVTLDTQVESVNLAEEMCLRVAEAAGFDE |
Ga0210404_103681912 | 3300021088 | Soil | MASDTKHLEMTLETQVESVNLAEEMCLRVAEAAGFGEDDC |
Ga0210406_105914481 | 3300021168 | Soil | MASETKHLEVTLDTHVESVNLAEEMCVRVAEAAGFNEDECYRIGM |
Ga0210406_110221872 | 3300021168 | Soil | MAPETKHLGVTLDTHVESVNLAEEMCVRVAEASGFNEDE |
Ga0210396_107193761 | 3300021180 | Soil | MPQDSKHLEVTLETQVESVNLAEEMCLRVAEAAGFGEDDCY |
Ga0210396_116353522 | 3300021180 | Soil | MGTDPKHLEITLETQVESVNLAEEMCIRVAEAAGFGEDDC |
Ga0210384_100599741 | 3300021432 | Soil | MGSDNKHLEVTLETQVESVNLAEEMCLRMAEAAGFGEDDC |
Ga0210384_116806041 | 3300021432 | Soil | MSEDSKHLEMTLETQVESVNLAEEMCLRVAEAAGF |
Ga0210392_114260901 | 3300021475 | Soil | MAPDTKHLEVTLDTHVESVNVAEEMCLRVAESAGFGEDDCYRIGMS |
Ga0210402_104281621 | 3300021478 | Soil | MGTDPKHLEITLETQVESVNLAEEMCLRVAEAAGFG |
Ga0210410_102273293 | 3300021479 | Soil | MGTDPKHLEITLETQVESVNLAEEMCLRVAEAAGF |
Ga0242662_102740982 | 3300022533 | Soil | MAFNTKHLEMTLETQVESVNLAEEMCLRVAEAAGFGEDDCYRIGM |
Ga0179589_102302581 | 3300024288 | Vadose Zone Soil | MAQDNKHLEVVLDTQVESVNLAEEMCLRVAESAGFDEEM |
Ga0247681_10471382 | 3300024310 | Soil | MAPETKHLEVTLDTHVESVNLAEEMCVRVAEAAGFSEDECY |
Ga0208687_10250593 | 3300025469 | Peatland | MAPDTKHLEVTLDTHVESVNLAEEMCLRVAEAAGFAEDE |
Ga0207663_111955732 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPETKHLEVTLDTHVESVNLAEEMCLRVAEAAGFGE |
Ga0207663_114017121 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQDNKHLAVVLDTQVESVNLAEEMCLRVAEAAGFDEEMCYRIG |
Ga0207641_119389882 | 3300026088 | Switchgrass Rhizosphere | MAAETKHLEVTLETQVESVNVAEEMCLRVAESAGFG |
Ga0209438_11398731 | 3300026285 | Grasslands Soil | MTQDSKHMEVTLETQVESVNLAEEMCLRVAEAAGFGEDD |
Ga0209647_11950431 | 3300026319 | Grasslands Soil | MASDIKHLEMTLETQVESVNLAEEMCLRVAEAAGFGEDDC |
Ga0257146_10795971 | 3300026374 | Soil | MASDTKHLEMTLETQVESVNLAEEMCLRVAEAAGFGEDD |
Ga0257172_10751881 | 3300026482 | Soil | MASDAKHLEITLETQVESVNLAEELCLRVAEAAGFGEDDCYRI |
Ga0257158_10506131 | 3300026515 | Soil | MAADTKHLEMTLETQVESVNLAEEMCLRVAEAAGFGE |
Ga0209161_100320613 | 3300026548 | Soil | MALNTKHLEMTLETQVESVNLAEEMCLRVAEAAGFGEDDCYRIGMS |
Ga0209648_104546421 | 3300026551 | Grasslands Soil | MASNAKHLEMTLETIVESVNLAEEMCLRVAEAAGFGED |
Ga0209648_105497561 | 3300026551 | Grasslands Soil | VTPERKHLEVTLETQVESVNLAEEMCLRVAEAAGFGED |
Ga0209577_102479751 | 3300026552 | Soil | MALTTKHLEMTLETQVESVNLAEEMCLRVAEAAGFGEDDCYRIGMS |
Ga0179587_101767911 | 3300026557 | Vadose Zone Soil | MASDTKHLEMTLETIVESVNLAEEMCLRVAEAAGFGEDDC |
Ga0207781_10089873 | 3300026890 | Tropical Forest Soil | MTPQAKHLEVILDTHVESVNLAEEMCLRVAEAIGFSED |
Ga0207730_10167471 | 3300026896 | Tropical Forest Soil | MTPETKHLEVTLDTHVESVNLAEEMCLRVAEAAGFGED |
Ga0207741_10044534 | 3300026941 | Tropical Forest Soil | MTPEAKHLEVVLDTHVESVNLAEEMCLRVAEAVGFN |
Ga0209117_11956072 | 3300027645 | Forest Soil | MAPDTKHLEVTLETQVESVNVAEEMCLRVAEAAGFGEDD |
Ga0209118_10923752 | 3300027674 | Forest Soil | MASDTKHLEMTLETQVESVNLAEEMCLRVAEAAGFGED |
Ga0208989_102305942 | 3300027738 | Forest Soil | MASDTKHLEMTLETQVESVNLAEEMCLRVAEAAGFGEDDCY |
Ga0209180_107429232 | 3300027846 | Vadose Zone Soil | MASEIKHLEMTLETHVESVNLAEEMCLRVAEAAGFGEDDCYR |
Ga0209693_104108872 | 3300027855 | Soil | MGTDPKHLEITLETQVESVNLAEEMCIRVAEAAGFGED |
Ga0209693_105484913 | 3300027855 | Soil | MGTDPKHLEITLETQVESVNLAEEMCLRVAEAAGFGE |
Ga0209701_103989302 | 3300027862 | Vadose Zone Soil | MSEDSKHLEITLETQVESVNLAEEMCLRVAEAAGFGE |
Ga0209701_107385852 | 3300027862 | Vadose Zone Soil | MALETKHLEITLETQVESVNLAEEMCLRVAEAAGFGEDDCYRIG |
Ga0209283_109125631 | 3300027875 | Vadose Zone Soil | MASDTKHLEMTLETQVESVNLAEEMCLRVAEAAGFGEDDCYRIGM |
Ga0209488_110116512 | 3300027903 | Vadose Zone Soil | MASDTKHLEMTLETQVESVNLAEEMCLRVAEAAGF |
Ga0209415_101130984 | 3300027905 | Peatlands Soil | MAPDTKHLEVTLDTHVESVNLAEEMCLRVAEAAGFA |
Ga0247684_10886691 | 3300028138 | Soil | MAEDTKHLEVTLETQVESVNLAEEMCLRLAEAAGFG |
Ga0247682_10770991 | 3300028146 | Soil | MAQDENKHLEVVLDTQVESVNLAEEMCLRVAEAAGFDEEM |
Ga0265754_10224442 | 3300031040 | Soil | MGTDPKHLEITLETQVESVNLAEEMCIRVAESAGFGEDDCYKIGM |
Ga0170824_1119825631 | 3300031231 | Forest Soil | MTQDNKHLEVVLDTQVESVNLAEEMCLKVAESAGFDEEMC |
Ga0318571_103073562 | 3300031549 | Soil | MAPENKHLEVVLDTQVESVNLAEEMCLRVAEAAGFDEEMCYRIGMS |
Ga0310915_112342682 | 3300031573 | Soil | MAPENKHLEVVLDTQVESVNLAEEMCLRVAEAAGFDEEM |
Ga0318555_100219361 | 3300031640 | Soil | MTAGAKHLEITLETQVESVNLAEEMCLRVAEAAGFGEDD |
Ga0310686_1191992711 | 3300031708 | Soil | MGRMAPETKHLEVTLETHVESVNLAEEMCLRVAESAGFGED |
Ga0307469_109403271 | 3300031720 | Hardwood Forest Soil | MAQDNKHLEVVLDTQVESVNLAEEMCLRVAEAAGFDEEVC |
Ga0318501_103061921 | 3300031736 | Soil | MTPEAKHLEVVLDTHVESVNLAEEMCLRVAEAVGFNEDECY |
Ga0306918_104898412 | 3300031744 | Soil | MAQEKKHLEVLLDTQVESVNLAEEMCIRVAEAAGFDEEMCYRIGMSV |
Ga0307477_110486321 | 3300031753 | Hardwood Forest Soil | MASDTKHLEITLETQVESVNLAEEMCLRVAEAAGFG |
Ga0307475_104890691 | 3300031754 | Hardwood Forest Soil | MTQDNKHLEVVLDTRVESVNLAEEMCLRVAESAGFDE |
Ga0318568_108412101 | 3300031819 | Soil | MTPQAKHLEVILDTHVESVNLAEEMCLRVAEAVGFSEDECY |
Ga0307478_113048822 | 3300031823 | Hardwood Forest Soil | MAEDSKHLEVTLETQVESVNLAEEMCLRVAEAAGFGE |
Ga0306921_102163441 | 3300031912 | Soil | MTAGAKHLEITLETQVESVNLAEEMCLRVAEAAGVGEDDCYRIGMS |
Ga0310909_102262111 | 3300031947 | Soil | MTPEAKHLEVVLDTHVESVNLAEEMCLRVAEAVGFNEDECYRI |
Ga0307479_106794412 | 3300031962 | Hardwood Forest Soil | MAPDTKHLEVTLETQVESVNLAEEMCLRVAEAAGFGEDDCY |
Ga0307479_114238912 | 3300031962 | Hardwood Forest Soil | MASDTKHLEMTLETIVESVNLAEEMCLRVAEAAGFGE |
Ga0318525_106886621 | 3300032089 | Soil | MAQEKKHLEVVLDTQVESVNLAEEMCLRVAEAAGFDEEMCYR |
Ga0318577_103413241 | 3300032091 | Soil | MTPQAKHLEVILDTHVESVNLAEEMCLRVAEAVGFSEDECYRIGM |
Ga0307471_1022708871 | 3300032180 | Hardwood Forest Soil | MAPDTKHLEMTLETQVESVNLAEEMCLRVAEAAGFGEDDCYRIGM |
Ga0307471_1033039101 | 3300032180 | Hardwood Forest Soil | MAPDTKHLEMTLETQVESVNLAEEMCLRVAEAAGFGEDD |
Ga0307472_1011939182 | 3300032205 | Hardwood Forest Soil | MATDPKHLEITLETQVESVNLAEEMCLRVAEAAGF |
Ga0307472_1022277231 | 3300032205 | Hardwood Forest Soil | MAPDTKHLEMTLETQVESVNLAEEMCLRVAEAAGFGED |
Ga0306920_1028531802 | 3300032261 | Soil | MAPEAKHLEVVLDTHVESVNLAEEMCLRVAEAVGFNEDECYRIGMSV |
Ga0335082_100941404 | 3300032782 | Soil | MAPETKHLEVTLDTHVESVNLAEEMCVRVAEAAGFNEDECYRIGM |
Ga0335071_103394043 | 3300032897 | Soil | MTPQAKHLEVILDTHVESVNLAEEMCLRVAEAVGFSEDECYRIGMSV |
Ga0326728_101466793 | 3300033402 | Peat Soil | MAPETKHLEVILDTHVESVNLAEEMCLRVAEAAGFAEDE |
⦗Top⦘ |