NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F035023

Metagenome / Metatranscriptome Family F035023

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F035023
Family Type Metagenome / Metatranscriptome
Number of Sequences 173
Average Sequence Length 40 residues
Representative Sequence PRDFGRREALERVAKHGDLFEPVLRGGQALGPALRKLRG
Number of Associated Samples 159
Number of Associated Scaffolds 173

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.31 %
% of genes near scaffold ends (potentially truncated) 95.95 %
% of genes from short scaffolds (< 2000 bps) 94.22 %
Associated GOLD sequencing projects 155
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (86.127 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(22.543 % of family members)
Environment Ontology (ENVO) Unclassified
(28.324 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.289 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 35.82%    β-sheet: 0.00%    Coil/Unstructured: 64.18%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 173 Family Scaffolds
PF13450NAD_binding_8 30.06
PF13419HAD_2 5.20
PF07690MFS_1 2.89
PF01872RibD_C 2.31
PF13489Methyltransf_23 1.73
PF00801PKD 1.73
PF12697Abhydrolase_6 1.73
PF08448PAS_4 1.16
PF13683rve_3 1.16
PF02782FGGY_C 1.16
PF00730HhH-GPD 1.16
PF00211Guanylate_cyc 0.58
PF01230HIT 0.58
PF01887SAM_HAT_N 0.58
PF00528BPD_transp_1 0.58
PF00144Beta-lactamase 0.58
PF11941DUF3459 0.58
PF07676PD40 0.58
PF06467zf-FCS 0.58
PF00462Glutaredoxin 0.58
PF07883Cupin_2 0.58
PF07730HisKA_3 0.58
PF13669Glyoxalase_4 0.58
PF01863YgjP-like 0.58
PF10604Polyketide_cyc2 0.58
PF00089Trypsin 0.58
PF12821ThrE_2 0.58
PF00561Abhydrolase_1 0.58
PF14362DUF4407 0.58
PF01593Amino_oxidase 0.58
PF00174Oxidored_molyb 0.58
PF00903Glyoxalase 0.58
PF08546ApbA_C 0.58
PF01078Mg_chelatase 0.58
PF00581Rhodanese 0.58
PF00293NUDIX 0.58
PF02608Bmp 0.58
PF03618Kinase-PPPase 0.58
PF06210DUF1003 0.58
PF13458Peripla_BP_6 0.58
PF13191AAA_16 0.58
PF00106adh_short 0.58
PF01925TauE 0.58

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 173 Family Scaffolds
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 2.31
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 2.31
COG0177Endonuclease IIIReplication, recombination and repair [L] 1.16
COG01223-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 1.16
COG1059Thermostable 8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 1.16
COG1194Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairsReplication, recombination and repair [L] 1.16
COG22313-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamilyReplication, recombination and repair [L] 1.16
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.58
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.58
COG4420Uncharacterized membrane proteinFunction unknown [S] 0.58
COG3915Uncharacterized conserved proteinFunction unknown [S] 0.58
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.58
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.58
COG2367Beta-lactamase class ADefense mechanisms [V] 0.58
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.58
COG2041Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductasesEnergy production and conversion [C] 0.58
COG1912Stereoselective (R,S)-S-adenosylmethionine hydrolase (adenosine-forming)Defense mechanisms [V] 0.58
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 0.58
COG1806Regulator of PEP synthase PpsR, kinase-PPPase family (combines ADP:protein kinase and phosphorylase activities)Signal transduction mechanisms [T] 0.58
COG1744Lipoprotein Med, regulator of KinD/Spo0A, PBP1-ABC superfamily, includes NupNSignal transduction mechanisms [T] 0.58
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.58
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.58
COG1451UTP pyrophosphatase, metal-dependent hydrolase familyGeneral function prediction only [R] 0.58
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 0.58


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.13 %
UnclassifiedrootN/A13.87 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559005|cont_contig06852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1801Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101400766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium636Open in IMG/M
3300000550|F24TB_10167676All Organisms → cellular organisms → Bacteria3566Open in IMG/M
3300000559|F14TC_101808135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1421Open in IMG/M
3300000858|JGI10213J12805_10398390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium824Open in IMG/M
3300000891|JGI10214J12806_10528921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium936Open in IMG/M
3300000956|JGI10216J12902_103288316All Organisms → cellular organisms → Bacteria2812Open in IMG/M
3300000956|JGI10216J12902_107524381All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300004114|Ga0062593_100805696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium935Open in IMG/M
3300004156|Ga0062589_102572719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium528Open in IMG/M
3300004157|Ga0062590_101869638All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae618Open in IMG/M
3300004463|Ga0063356_100995928All Organisms → cellular organisms → Bacteria1196Open in IMG/M
3300004463|Ga0063356_105518466All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae543Open in IMG/M
3300004480|Ga0062592_101168821All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300004643|Ga0062591_102372234All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300005340|Ga0070689_102181239All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300005444|Ga0070694_100340592All Organisms → cellular organisms → Bacteria1159Open in IMG/M
3300005459|Ga0068867_101713425All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae589Open in IMG/M
3300005467|Ga0070706_100975682All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300005471|Ga0070698_100052626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4141Open in IMG/M
3300005518|Ga0070699_101228681All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300005530|Ga0070679_102077165All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300005538|Ga0070731_10247349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1184Open in IMG/M
3300005556|Ga0066707_11001199All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300005564|Ga0070664_100206004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1756Open in IMG/M
3300005569|Ga0066705_10432852Not Available824Open in IMG/M
3300005840|Ga0068870_11240912All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300005841|Ga0068863_102349219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium543Open in IMG/M
3300005842|Ga0068858_100610235All Organisms → cellular organisms → Bacteria1059Open in IMG/M
3300005844|Ga0068862_102314144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium549Open in IMG/M
3300006058|Ga0075432_10261015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria706Open in IMG/M
3300006175|Ga0070712_100394680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1141Open in IMG/M
3300006237|Ga0097621_102084683All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300006572|Ga0074051_11769501All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300006845|Ga0075421_100644959All Organisms → cellular organisms → Bacteria1238Open in IMG/M
3300006847|Ga0075431_100793038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria921Open in IMG/M
3300006871|Ga0075434_101516991All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300006881|Ga0068865_100461529All Organisms → cellular organisms → Bacteria1052Open in IMG/M
3300006918|Ga0079216_10561955All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300006954|Ga0079219_10365132All Organisms → cellular organisms → Bacteria936Open in IMG/M
3300009098|Ga0105245_11477280All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300009137|Ga0066709_101042087All Organisms → cellular organisms → Bacteria1200Open in IMG/M
3300009147|Ga0114129_10152224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3165Open in IMG/M
3300009147|Ga0114129_10308923All Organisms → cellular organisms → Bacteria2105Open in IMG/M
3300009162|Ga0075423_13163842All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300009174|Ga0105241_10097971All Organisms → cellular organisms → Bacteria2326Open in IMG/M
3300009174|Ga0105241_12699511All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300009553|Ga0105249_11360258Not Available782Open in IMG/M
3300010037|Ga0126304_10932540Not Available591Open in IMG/M
3300010041|Ga0126312_10254118All Organisms → cellular organisms → Bacteria1235Open in IMG/M
3300010041|Ga0126312_11426260Not Available513Open in IMG/M
3300010166|Ga0126306_11299179Not Available600Open in IMG/M
3300010301|Ga0134070_10158598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium814Open in IMG/M
3300010326|Ga0134065_10283509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium629Open in IMG/M
3300010335|Ga0134063_10594929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium562Open in IMG/M
3300010337|Ga0134062_10358240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium704Open in IMG/M
3300010362|Ga0126377_11411698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium769Open in IMG/M
3300010371|Ga0134125_10455171Not Available1419Open in IMG/M
3300010375|Ga0105239_10738939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1126Open in IMG/M
3300010399|Ga0134127_10234072All Organisms → cellular organisms → Bacteria1729Open in IMG/M
3300010399|Ga0134127_13124563All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300010401|Ga0134121_12408709All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300010880|Ga0126350_10953778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium741Open in IMG/M
3300011106|Ga0151489_1673373All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300012022|Ga0120191_10072390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium654Open in IMG/M
3300012210|Ga0137378_11417375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium608Open in IMG/M
3300012354|Ga0137366_10146484All Organisms → cellular organisms → Bacteria1778Open in IMG/M
3300012356|Ga0137371_10147279Not Available1845Open in IMG/M
3300012356|Ga0137371_10187766All Organisms → cellular organisms → Bacteria1619Open in IMG/M
3300012361|Ga0137360_11070707All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium696Open in IMG/M
3300012532|Ga0137373_10330997All Organisms → cellular organisms → Bacteria1201Open in IMG/M
3300012684|Ga0136614_10381067All Organisms → cellular organisms → Bacteria1034Open in IMG/M
3300012895|Ga0157309_10169501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium663Open in IMG/M
3300012897|Ga0157285_10160179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium677Open in IMG/M
3300012899|Ga0157299_10152591All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300012907|Ga0157283_10325916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium543Open in IMG/M
3300012911|Ga0157301_10318852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium574Open in IMG/M
3300012914|Ga0157297_10039927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1175Open in IMG/M
3300012915|Ga0157302_10137110All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300012943|Ga0164241_10415255All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300012961|Ga0164302_10951153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium664Open in IMG/M
3300012961|Ga0164302_11652213Not Available535Open in IMG/M
3300012971|Ga0126369_11404049All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300012975|Ga0134110_10323610Not Available670Open in IMG/M
3300012989|Ga0164305_12162617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria511Open in IMG/M
3300014150|Ga0134081_10021499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1818Open in IMG/M
3300014157|Ga0134078_10007675All Organisms → cellular organisms → Bacteria3067Open in IMG/M
3300014301|Ga0075323_1044928Not Available850Open in IMG/M
3300014497|Ga0182008_10177680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1076Open in IMG/M
3300014745|Ga0157377_10964539Not Available643Open in IMG/M
3300014745|Ga0157377_11769283All Organisms → cellular organisms → Bacteria → Terrabacteria group501Open in IMG/M
3300014968|Ga0157379_10780718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium901Open in IMG/M
3300015200|Ga0173480_10172387All Organisms → cellular organisms → Bacteria1124Open in IMG/M
3300015357|Ga0134072_10035589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1323Open in IMG/M
3300015372|Ga0132256_101310946All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300015373|Ga0132257_101750498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium797Open in IMG/M
3300015374|Ga0132255_101588539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium991Open in IMG/M
3300016319|Ga0182033_11199751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium680Open in IMG/M
3300017657|Ga0134074_1228869All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300017965|Ga0190266_11090807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium543Open in IMG/M
3300018027|Ga0184605_10266221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium778Open in IMG/M
3300018071|Ga0184618_10249752All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300018073|Ga0184624_10441511All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300018077|Ga0184633_10367860All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300018089|Ga0187774_11481141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium501Open in IMG/M
3300018422|Ga0190265_11999532Not Available685Open in IMG/M
3300018465|Ga0190269_10401308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9848Open in IMG/M
3300018476|Ga0190274_12698721All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300018482|Ga0066669_10545164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1010Open in IMG/M
3300019377|Ga0190264_11158528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium637Open in IMG/M
3300020070|Ga0206356_11223356Not Available1266Open in IMG/M
3300021344|Ga0193719_10475881All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300021560|Ga0126371_13514882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium529Open in IMG/M
3300022898|Ga0247745_1053922All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300023066|Ga0247793_1013584All Organisms → cellular organisms → Bacteria1140Open in IMG/M
3300024055|Ga0247794_10023913All Organisms → cellular organisms → Bacteria1537Open in IMG/M
3300025559|Ga0210087_1023151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1264Open in IMG/M
3300025893|Ga0207682_10640655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium500Open in IMG/M
3300025906|Ga0207699_11468750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium504Open in IMG/M
3300025912|Ga0207707_10125148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter pauli2248Open in IMG/M
3300025922|Ga0207646_10757316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales866Open in IMG/M
3300025923|Ga0207681_11702366All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300025944|Ga0207661_11073812Not Available741Open in IMG/M
3300025945|Ga0207679_11490683All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300025961|Ga0207712_10904580Not Available780Open in IMG/M
3300025972|Ga0207668_10529680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1018Open in IMG/M
3300026078|Ga0207702_10873980All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300026089|Ga0207648_10190789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1816Open in IMG/M
3300026312|Ga0209153_1119801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium996Open in IMG/M
3300026944|Ga0207570_1009389All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales702Open in IMG/M
3300027706|Ga0209581_1016387All Organisms → cellular organisms → Bacteria4114Open in IMG/M
3300027821|Ga0209811_10111283All Organisms → cellular organisms → Bacteria → Terrabacteria group991Open in IMG/M
3300027907|Ga0207428_10253588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1311Open in IMG/M
3300027956|Ga0209820_1229809Not Available519Open in IMG/M
3300028712|Ga0307285_10184064All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300028719|Ga0307301_10044990All Organisms → cellular organisms → Bacteria1351Open in IMG/M
3300028744|Ga0307318_10145224Not Available813Open in IMG/M
3300028755|Ga0307316_10054625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1345Open in IMG/M
3300028771|Ga0307320_10134128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria953Open in IMG/M
3300028784|Ga0307282_10431132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium639Open in IMG/M
3300028796|Ga0307287_10184559All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300028796|Ga0307287_10357612All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300028807|Ga0307305_10395618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria625Open in IMG/M
3300028811|Ga0307292_10015777All Organisms → cellular organisms → Bacteria2614Open in IMG/M
3300028811|Ga0307292_10080507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1260Open in IMG/M
3300028811|Ga0307292_10462987All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300028812|Ga0247825_11183605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria558Open in IMG/M
3300028814|Ga0307302_10078034Not Available1566Open in IMG/M
3300028814|Ga0307302_10624692All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300028876|Ga0307286_10361683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea marina541Open in IMG/M
3300028880|Ga0307300_10089171Not Available920Open in IMG/M
3300028881|Ga0307277_10587849All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300028884|Ga0307308_10153986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1101Open in IMG/M
3300028884|Ga0307308_10286752Not Available789Open in IMG/M
3300030336|Ga0247826_11140634Not Available623Open in IMG/M
3300031199|Ga0307495_10214969All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300031547|Ga0310887_10561875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis695Open in IMG/M
3300031562|Ga0310886_10532977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium713Open in IMG/M
3300031670|Ga0307374_10549350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium603Open in IMG/M
3300031713|Ga0318496_10610338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium603Open in IMG/M
3300031720|Ga0307469_11872324All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300031779|Ga0318566_10335446All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300031819|Ga0318568_10591758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium691Open in IMG/M
3300031858|Ga0310892_10496996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis812Open in IMG/M
3300031860|Ga0318495_10308642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium703Open in IMG/M
3300031910|Ga0306923_12550901All Organisms → cellular organisms → Bacteria → Terrabacteria group503Open in IMG/M
3300031940|Ga0310901_10250210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria726Open in IMG/M
3300032001|Ga0306922_12257008Not Available523Open in IMG/M
3300032180|Ga0307471_101399738Not Available860Open in IMG/M
3300032892|Ga0335081_11366640All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300033158|Ga0335077_10842822Not Available929Open in IMG/M
3300033412|Ga0310810_10249588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1953Open in IMG/M
3300033550|Ga0247829_11581818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria541Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil22.54%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil5.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.62%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.05%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.05%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.47%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.31%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.31%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.31%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.31%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.73%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.73%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.73%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.73%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.16%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.16%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.16%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.16%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.16%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.16%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.16%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.16%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.16%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.16%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.16%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.16%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.58%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.58%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.58%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.58%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.58%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.58%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.58%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.58%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.58%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.58%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.58%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.58%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.58%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.58%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.58%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated0.58%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.58%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000858Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006572Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011106Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012022Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6EnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012684Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014301Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1EnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300023066Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025559Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026944Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G01K2-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027706Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027956Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031670Soil microbial communities from Risofladan, Vaasa, Finland - OX-3EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
cont_0852.000006602166559005SimulatedAVALERVGEHGDLFEPVLHGTQPLGPALKQLRAAA
INPhiseqgaiiFebDRAFT_10140076613300000364SoilRDFGRREVLDRIAKHGDLFEPVLRGGXALGPGLRRLRAARPDK*
F24TB_1016767653300000550SoilWEELGEKVRPRDFGMREALDRVERYGDLFEQTLCGGQALGPALRKLRAASA*
F14TC_10180813523300000559SoilRWEELGEKVRPRDFGMREALDRVERYGDLFEQTLCGGQALGPALRKLRAASA*
JGI10213J12805_1039839023300000858SoilDELTEDVTPRRFGMREALERVEQHGDLFGPVLAGGQALGRALKKLR*
JGI10214J12806_1052892133300000891SoilMTIDAPNTXXXXPRRFGMREALDRVGRHGDLFEPVLAGGQALGRALRKLR*
JGI10216J12902_10328831643300000956SoilDFGMREALDRVERYGDLFEQTLCGGQALGPALRKLRAASA*
JGI10216J12902_10752438113300000956SoilDVTPRRFGMREVLERVDQYGDLFEPVLAGGQALGRALNKLS*
Ga0062593_10080569623300004114SoilFGRREALQRVEKHGDLFEPVLHGGQALSPALRRLRAGHTGD*
Ga0062589_10257271913300004156SoilDVTPRRFGMREALDRVERHGDLFEPVLAGGQALGRALKKNR*
Ga0062590_10186963823300004157SoilPRDFGRKEALARIEKHGDLFEPVLRGGQPLGPALRTLRS*
Ga0063356_10099592823300004463Arabidopsis Thaliana RhizosphereLTRKVTPRRFGMRQALERVEKHGDLFAPVLAAGQALGPALRTLL*
Ga0063356_10551846613300004463Arabidopsis Thaliana RhizosphereELTAKVRPRDFGMREALERVEKHGDLYEPVLKGGQSLAAALRSLR*
Ga0062592_10116882113300004480SoilLTPRRFGMREALERVESHGDLFSPVLMGGQALGRASRKLRS*
Ga0062591_10237223423300004643SoilRVRPRDFGRKEVLDRVDKHGDLFAPVLRGGQALAPALRRLRAAKPE*
Ga0070689_10218123923300005340Switchgrass RhizosphereRDFGRREALDRVAKHGDLFEPVLKGGQALAPGLRRLRAARPDK*
Ga0070694_10034059213300005444Corn, Switchgrass And Miscanthus RhizosphereDFGRREALQRVQRHGDLFEPVLRGGQALAPALRRLRASGS*
Ga0068867_10171342523300005459Miscanthus RhizospherePRDFGRREALARLEKHGDLFEPVLQGGQALAPALRSLRAA*
Ga0070706_10097568213300005467Corn, Switchgrass And Miscanthus RhizosphereVRPRDFGRREALDRVAKHGDLFEPVLRGGQALGPALRRLRAAEPSK*
Ga0070698_10005262613300005471Corn, Switchgrass And Miscanthus RhizosphereTPRRFGMREALERVDQHGDLFAPVLAGGQALGRALKKLR*
Ga0070699_10122868123300005518Corn, Switchgrass And Miscanthus RhizosphereLGEKVRPRDFGRREALARIAKHGDLFEPVLGGGQALGPALRSLREPA*
Ga0070679_10207716513300005530Corn RhizosphereVTPRRFGMRVALERVEEHGDLFAPVLAGGQALGAALRKLR*
Ga0070731_1024734923300005538Surface SoilVALERVAARGDLFEPVLHGKQALGPALRELRASA*
Ga0066707_1100119923300005556SoilERIRPRDFGRREALDRVAKHGDLFEPVLKGGQALAPALRQLRASASG*
Ga0070664_10020600433300005564Corn RhizosphereRFGMREALERVGRDGDLFEPVLAGGQALGRALRRLPG*
Ga0066705_1043285223300005569SoilGRREALQRVHRHGDLFEPVLRGGQALAPALRRLRASES*
Ga0068870_1124091223300005840Miscanthus RhizosphereEDVTPRRFGMRVALERVEEHGDLFAPVLAGGQALGAALRKLR*
Ga0068863_10234921913300005841Switchgrass RhizosphereRFGMREALERVEQHGDLFEPVLAGGQALGRALRRLPG*
Ga0068858_10061023513300005842Switchgrass RhizosphereDFGMREALARVQKHGDLFEPVLEGGQALGPALRKVRS*
Ga0068862_10231414423300005844Switchgrass RhizosphereFGMREALERVGRDGDLFEPVLAGGQALGRALRRLPG*
Ga0075432_1026101523300006058Populus RhizosphereALDRIEERGDLYEPVLKGGQALAPALKALRRSAQ*
Ga0070712_10039468013300006175Corn, Switchgrass And Miscanthus RhizosphereDRVAKHGDLFEPVLRGGQALGPALRRLRAAEPSK*
Ga0097621_10208468313300006237Miscanthus RhizosphereRFGMREALERVEQHGDLFEPVLAGGQALGRALRKLR*
Ga0074051_1176950133300006572SoilEALERFEKHGDLFEPVLKGGQSLGPALRALRAQAE*
Ga0075421_10064495913300006845Populus RhizosphereFGMREALERVEQHGDLFEPVLAGGQALGRALGKLR*
Ga0075431_10079303823300006847Populus RhizosphereFGMREALERVERHGDLFAPVLEGGQALGRALGELR*
Ga0075434_10151699113300006871Populus RhizosphereDFGMRDVLARVERHGDLFAPVLQGGQALNPALRNLRA*
Ga0068865_10046152933300006881Miscanthus RhizosphereRFGMREALERVERHGDLFEPVLAGGQALGRAMKKTS*
Ga0079216_1056195513300006918Agricultural SoilDLTPRHFGMREALERVERHGDLFAPVLAGGQALGRAMKKSRSSRPGA*
Ga0079219_1036513213300006954Agricultural SoilDFGRREALERFEKHGDLFEPVLEGGQALGPAFRVLRAE*
Ga0105245_1147728013300009098Miscanthus RhizosphereRREALERVEKHGDLFEPVLRGGQALGPALRKLRADD*
Ga0066709_10104208713300009137Grasslands SoilDFGRREALARIEKHGDLFEPVLRGGQALGPALRSLRA*
Ga0114129_1015222473300009147Populus RhizosphereMREALERVDRHGDLFEPVLKGGQGIARALRQLRE*
Ga0114129_1030892313300009147Populus RhizosphereLGEKVRPRDFGRREVLARVQKHGDLFEPVLGGGQAPGPALRRLRAE*
Ga0075423_1316384213300009162Populus RhizosphereLHWEELGEEVKPRDFGRREALERIEKYGDMFEPVLQGGQALGPALRRLRAESES*
Ga0105241_1009797113300009174Corn RhizosphereFGRREALDRVAKYGDLFEPVLKGGQALAPALGRLRAEKPDK*
Ga0105241_1269951123300009174Corn RhizosphereTPRRFGMRVALERVEEHGDLFAPVLAGGQALGAALRKLR*
Ga0105249_1136025813300009553Switchgrass RhizospherePRRFGMLEALERVERHGDLFAPVLEGGQALGRALGKLR*
Ga0126304_1093254023300010037Serpentine SoilRFGMREALERVEEHGDLFEPALAGGQALGRALKKLP*
Ga0126312_1025411823300010041Serpentine SoilRRFGMREALERVEEHGDLFEPVLAGGQALGPALKKLP*
Ga0126312_1142626033300010041Serpentine SoilETLERVERHGDLFEPVLAGSQALGRALRKLRQSRG*
Ga0126306_1129917913300010166Serpentine SoilIALERVERLGDLFEPVLRGKQALGPALKALRVDAA*
Ga0134070_1015859813300010301Grasslands SoilERVRPRDFGRREALARVAKHGDLFEPVLKGGQALGPALRKLRR*
Ga0134065_1028350913300010326Grasslands SoilPRDFGRREALDRVAKHGDLFEPVLRGGQSLGPALRKLRS*
Ga0134063_1059492913300010335Grasslands SoilPRRFGMREALERVEQHGDLFEPVLAGGQALGRALKKWRY*
Ga0134062_1035824013300010337Grasslands SoilLTETVRPRDFGRREALDRLAKHGDLFEPVLRGGQSLGPALRTLRS*
Ga0126377_1141169813300010362Tropical Forest SoilPRRFGMREALERVERLGDLFEPVLGGGQALGRALRRQPK*
Ga0134125_1045517113300010371Terrestrial SoilRREVLDRVQKHGDLFEPVLQGGQALGPALRAVRK*
Ga0105239_1073893923300010375Corn RhizosphereMREALERVERHGDLFEPVLKGGQGIAKALRQLRAETIQQ*
Ga0134127_1023407213300010399Terrestrial SoilLDRVAKYGDLFEPVLKGGQALAPALGRLRAEKPDE*
Ga0134127_1312456323300010399Terrestrial SoilGEKVRPRAFGRKEALARIEKHGDLFEPVLRGGQALGPALRTLRA*
Ga0134121_1240870923300010401Terrestrial SoilREALDRVAKHGDLFEPVLKGGQALAPGLRRLRAARPDK*
Ga0126350_1095377813300010880Boreal Forest SoilALERVERHGDLFEPVLRGGQSIGPALRTLRSSAAST*
Ga0151489_167337323300011106SoilEKVRPRDFGMREALARVQKHGDLFEPALEGGQALAPALRKLRA*
Ga0120191_1007239023300012022TerrestrialALTPPRLGMREALERVEQHGDLFEPVLAGGQALGRAMKKLR*
Ga0137378_1141737523300012210Vadose Zone SoilRDFGRREALERAERHGDLFEPVLQGGQALGPALRRLRR*
Ga0137366_1014648413300012354Vadose Zone SoilPRDFGRREALDRVAKHGDLFEPVLRGGQALAPALRQLRASG*
Ga0137371_1014727913300012356Vadose Zone SoilRPRDFGLREALQRVERHGDLFEPVLQGGQALAPALRRLRG*
Ga0137371_1018776613300012356Vadose Zone SoilPRDFGRREALDRVAKHGDLFEPVLRGGQALGPGLRRLRAAKPDK*
Ga0137360_1107070713300012361Vadose Zone SoilERVRPRDFGRREALDRIAKHGDLFEPVLRGGQALRPALRRLRAAGPNK*
Ga0137373_1033099713300012532Vadose Zone SoilDFGMREALERVERHGDLFEPVLKGGQALSPPLRQLRG*
Ga0136614_1038106723300012684Polar Desert SandLRWEELTAKVRPRDFGMQEVLARVEQHGDLYEPVLGGGQALGPALRTLR*
Ga0157309_1016950113300012895SoilRRFGMREALERVGRDGDLFEPVLAGGQALGRALRRLPG*
Ga0157285_1016017923300012897SoilGRREALARIEKHGDLFEPVLRGGQALGPALRSLRA*
Ga0157299_1015259123300012899SoilRPRDFGMREALERIERHGDLYEPVLKGGQSLAAALRSLR*
Ga0157283_1032591623300012907SoilDELPEDVTPRRFGMHEALERVERHGDLFAPVLAGGQALGAALRKLR*
Ga0157301_1031885223300012911SoilGRREALDRVAKHGDLFEPVLKGGQALAPGLRRLRAARPDK*
Ga0157297_1003992713300012914SoilGRREALARVEKLGDLFEPVLRGGQSLGPALRHLRAE*
Ga0157302_1013711023300012915SoilLERVERHGDLFEPVLANGQALGRALKRLRQDAHEITA*
Ga0164241_1041525523300012943SoilRRFGMREALERVERHGDLFAPVLAGGQALAPALKNVR*
Ga0164302_1095115323300012961SoilDFGRREALDRVAKHGDLFEPVLRGGQALGPALRRLRAAELSK*
Ga0164302_1165221313300012961SoilDLTPRRFGMREALERVEQHGDLFGPVLAGGQALGQALKRLR*
Ga0126369_1140404913300012971Tropical Forest SoilRREALERVERHGDLFEPVLRGGQALSPALRRLRG*
Ga0134110_1032361023300012975Grasslands SoilFGMREALKRVDKHGDLFEPVLEGGQALGPALRSLRG*
Ga0164305_1216261713300012989SoilMTPRRFGLREALERVEQHGDLFEPVLAGGQALGPASKR*
Ga0134081_1002149943300014150Grasslands SoilPRDFGRREALERVAKHGDLFEPVLRGGQALGPALRKLRG*
Ga0134078_1000767513300014157Grasslands SoilERVQPRDFGRREALERVAKHGDLFEPVLRGGQALGPALRKLRG*
Ga0075323_104492813300014301Natural And Restored WetlandsELIEEVTPRRFGMRETLEQVAVLAGGQALGRALKKLR*
Ga0182008_1017768023300014497RhizosphereGEKVRPRDFGRREALERFEKHGDLFEPVLQGGQALGPAFRVLRAE*
Ga0157377_1096453913300014745Miscanthus RhizosphereWDELTDDVTPRRFGMREALERVERHGDLFAPVLEGGQALGRALGKLR*
Ga0157377_1176928323300014745Miscanthus RhizosphereEKVRPRDFGRREALERLHLYGDLFEPVLQGGQALSPALRQLRG*
Ga0157379_1078071813300014968Switchgrass RhizosphereRREALQRVEKHGDLFAPVLRGGQALGPALRRLRAGT*
Ga0173480_1017238733300015200SoilRREALARIEKHGDLFEPVLRGGQALGPALRSLRTESSVDVE*
Ga0134072_1003558913300015357Grasslands SoilELTESVRPRDFGRHEALDRVAKHGDLFEPVLRGGQALGPGLRRLRAAKPTK*
Ga0132256_10131094613300015372Arabidopsis RhizosphereLTEDVTPRRFGMREALERVERHGDLFAPVLAGGQALGAALRKLR*
Ga0132257_10175049823300015373Arabidopsis RhizosphereGMREALERVGQHGDLFEPVLAGGQALGRASRRLR*
Ga0132255_10158853923300015374Arabidopsis RhizosphereVAPRQFGMREALERVEKHGDPFEPVLAGGQALGRALGKLR*
Ga0182033_1119975113300016319SoilVRPRDFGTREALQRVELHGDLFEPVLHGGQALGPALRELRRLVA
Ga0134074_122886923300017657Grasslands SoilPTRLGMSEALERVKRDGDLFEPVLRGGQTLGPALRALRRGA
Ga0190266_1109080723300017965SoilTAKVRPRDFGMREALERIERHGDLYEPVLKGGQSLAAALRSLR
Ga0184605_1026622113300018027Groundwater SedimentRPRDFGRREALDRVAKHGDLFEPVLQGGQALAPALRLLRAANPSK
Ga0184618_1024975213300018071Groundwater SedimentNVRPRDFGRREALARIEKHGDLFEPVLRGGQALGPALRSLRA
Ga0184624_1044151113300018073Groundwater SedimentMREALARIEKHGDLFEPVLQGGQALGPALRSLRAA
Ga0184633_1036786013300018077Groundwater SedimentFGMSEALERIEQHGDLYEPVLRGGQALGSALRSLRKSSVSDAS
Ga0187774_1148114123300018089Tropical PeatlandMVAALDRVARHGDLFEPVLRGGQALGPALRQLRERS
Ga0190265_1199953213300018422SoilRFTMEAVLKRVEEHGDLFAPVLEGGQALGDALRRIG
Ga0190269_1040130813300018465SoilRRFGMREALERVEQHGDLFGPVLAGGQALGRALKKLR
Ga0190274_1269872123300018476SoilRDFGMREALERIERHGDLYEPVLKGGQSLAAALRSLR
Ga0066669_1054516413300018482Grasslands SoilVGRREGLERVAKHGDLFEPVLRGGQALGPALKTLRR
Ga0190264_1115852823300019377SoilFGMREALERVEQHGDLFEPVLAGGQALGRALKRLRSAS
Ga0206356_1122335613300020070Corn, Switchgrass And Miscanthus RhizosphereVRPRDFGRREALQRVQRHGDLFEPVLRGGQALAPALRRLRASGS
Ga0193719_1047588123300021344SoilFGRREALDRVAKHGDLFEPVLRGGQALGPGLRRLRAARPDK
Ga0126371_1351488213300021560Tropical Forest SoilRREALQRVEKLGDLFEPVLRRGQALGPALRRLRAD
Ga0247745_105392213300022898SoilDVGRKEALARIEKHGDLFEPVLRGGQALGPALRALRA
Ga0247793_101358413300023066SoilRWDELTDDVTPRRFGMREALERVERHGDLFAPVLEGGQALGRPLGKLR
Ga0247794_1002391333300024055SoilGMREALERVERHGDLFEPVLKGGQGIAKALRQLRAETIQQ
Ga0210087_102315123300025559Natural And Restored WetlandsEDVTPRRFGMREALDRVERYGDLFEPVLAGGQALGRALKNLR
Ga0207682_1064065523300025893Miscanthus RhizosphereKVRPRDFGMREALARVQKHGDLFEPVLEGGQALGPALRKVRS
Ga0207699_1146875013300025906Corn, Switchgrass And Miscanthus RhizosphereAVAMQRVERYGDLYEPVLRGGQSLGPALRTLQADAGD
Ga0207707_1012514833300025912Corn RhizosphereRRFGMRVALERVEEHGDLFAPVLAGGQALGAALRKLR
Ga0207646_1075731613300025922Corn, Switchgrass And Miscanthus RhizosphereQVALDRVAKHGDLFEPVLHAQQALGSALKALRARA
Ga0207681_1170236623300025923Switchgrass RhizosphereGRREALHRVAKHGDLFEPVLRGGQALGPSLRRLRAARPDK
Ga0207661_1107381223300025944Corn RhizosphereKVRPRDFGRREVLARVQKHGDLFEPVLQGGQALGPALRAVRK
Ga0207679_1149068313300025945Corn RhizosphereFGRREVLQRVGKHGDLFEPVLRGGQAVAPALRRLRT
Ga0207712_1090458013300025961Switchgrass RhizosphereRRFGMLEALERVERHGDLFAPVLEGGQALGRALGKLR
Ga0207668_1052968033300025972Switchgrass RhizosphereFRMREALDRVERHGDLFAPVLAGGQALGAALRKLR
Ga0207702_1087398013300026078Corn RhizosphereDVTPRRFGMRVALERVEEHGDLFAPVLAGGQALGAALRKLR
Ga0207648_1019078913300026089Miscanthus RhizosphereRFGMREALERVERHGDLFEPVLAGGQALGRAMKKTS
Ga0209153_111980113300026312SoilGRHEALDRVAKHGDLFEPVLRGGQALGPGLRRLRAAKPTK
Ga0207570_100938923300026944SoilMREALARVQKHGDLFEPVLEGGQALGPALRRLREEDAAG
Ga0209581_101638763300027706Surface SoilRDFSMAAALERVAARGDLFAPVLRGGQSLAAALRTLRGAG
Ga0209811_1011128333300027821Surface SoilELGEKVRPRDFGRREALERLHLYGDLFEPVLQGGQALSPALRQLRG
Ga0207428_1025358823300027907Populus RhizosphereLTEDLTPRRFGMREALERVESHGDLFAPVLMGGQALGRASRKLRS
Ga0209820_122980913300027956Freshwater SedimentRFGMREALERVEQHGDLFEPVLAGDQALGRALRKLR
Ga0307285_1018406423300028712SoilFGRREALDRVQKHGDLFEPVLKGGQALGPALKRLRADRSQESV
Ga0307301_1004499033300028719SoilMREALARIEKHGDLFEPVLQGGQALGPALRSLRAP
Ga0307318_1014522423300028744SoilEKVRPRDFGRKEALARIEKHGDLFEPVLRGGQALGPALRTLRS
Ga0307316_1005462533300028755SoilREALERVARHGDLFEPVLKGGQGLARALRQLRAETI
Ga0307320_1013412813300028771SoilGMREALERVARHGDLFEPVLKGGQGLARALRQLRAETI
Ga0307282_1043113223300028784SoilRDFGMREALARVEKHGDLFEPVLRGGQALGPALRKVRA
Ga0307287_1018455913300028796SoilRDFGRHEALERVEKHGDLFEPVLRGGQALGPALRRLRADD
Ga0307287_1035761213300028796SoilRREALARLEKHGDLFEPVLQGGQALGPALRSLRAA
Ga0307305_1039561823300028807SoilSDFGRREALDRVAKHGDLFEPVLRGGQALAPALRQLRSSG
Ga0307292_1001577713300028811SoilRDFGMREALARIEKHGDLFEPVLQGGQALGPALRSLRAP
Ga0307292_1008050713300028811SoilLRWDELTEDVTPRRFGMREALKRVEQHGDLFSPALAGGQALGRALKKLR
Ga0307292_1046298713300028811SoilKVRPRDFGRREALARLEKHGDLFEPVLQGGQALGPALRSLRAA
Ga0247825_1118360523300028812SoilHFGMREALERVERHGDLFAPVLAGGQALGRAMKKSRSSRPGA
Ga0307302_1007803413300028814SoilMREALKRVEKHGDLFEPVLQGGQALGPALRKLRSS
Ga0307302_1062469223300028814SoilRREALERVEKHGDLFEPVLRGGQALGPALRRLRADD
Ga0307286_1036168313300028876SoilLGEKVRLRDFGRREALARIEKHGDLFEAVLCGGQALGPALRSLRTESSVDVE
Ga0307300_1008917113300028880SoilVRPRDFGRKEALARIEKHGDLFEPVLRGGQALGPALRTLRS
Ga0307277_1058784923300028881SoilRDFGRREALDRVAKHGDLFEPVLRGGQPLGPGLRRLRAAKPDK
Ga0307308_1015398623300028884SoilGRREALARVEKHGDLFEPVLQGGQALGPALRALRK
Ga0307308_1028675223300028884SoilDFGMREALASVEKHGDLFEPVLQGGQALGPALRQLRT
Ga0247826_1114063423300030336SoilDELKEDVTPRGFGLREAVERVEQHGDLSEPVLADGQALGRALKKLR
Ga0307495_1021496923300031199SoilDFGRREALQRVEKHGDLFEPVLRGGQALGPALRRLRT
Ga0310887_1056187513300031547SoilRFGMREAIDRVERHGDLFEPVLAGGQALGRALKKAR
Ga0310886_1053297713300031562SoilDFGRREALDRVAKYGDLFEPVLKGGQALAPALGRLRAEKPDK
Ga0307374_1054935013300031670SoilVAVDRIAALGDLFEPVLHGGQALGPALRELRGRGG
Ga0318496_1061033813300031713SoilEGWTPRRFGMREALERVDQHGDLFAPVLAGGQALGRALKTVR
Ga0307469_1187232413300031720Hardwood Forest SoilRDFGRREALDRVATHGDLFEPVLRGGQALGPALRRLRAAEPSK
Ga0318566_1033544613300031779SoilFGMREVLERIEQHGDLFEPVLAGGQALGRALKKWR
Ga0318568_1059175833300031819SoilGWTPRRFGMREALERVDQHGDLFAPVLAGGQALGRALKKSW
Ga0310892_1049699613300031858SoilTPRRFGMREALDRVERHGDLFEPVLSAGQALGRALKKIR
Ga0318495_1030864223300031860SoilVRPRDFGRREALQRVEKLGDLFEPVLRGGQALGPALRRLRAD
Ga0306923_1255090123300031910SoilYSMEVALERVELHGDLFEPVLHATQSLAPALKSLR
Ga0310901_1025021013300031940SoilPRRFGMREALERVERHGDLFEPALAGGQALGGALKKTS
Ga0306922_1225700813300032001SoilTPRRFGMREALERVDQHGDLFAPVLAGGQALGRALKKSW
Ga0307471_10139973813300032180Hardwood Forest SoilERVRPRDFGRREALDRVAKHGDLFAPVLRGGQALGPALRRLRAAEPSK
Ga0335081_1136664013300032892SoilLGRVQRHGDLFAPVVKGGPALGPPLRALRAQSEQT
Ga0335077_1084282213300033158SoilVRPRDFPMAVALERVEGLGDLFAPVLEGGQALGPALRELRRSRTA
Ga0310810_1024958833300033412SoilELMEDVTPRRFGMRVALERVEEHGDLFAPVLAGGQALGAALRKLR
Ga0247829_1158181813300033550SoilRREALDRVAKHGDLFEPVLKGGQALAPALRQLRASASG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.